3E6AA

Crystal structure and functional analysis of glyceraldehyde-3-phosphate dehydrogenase from oryza sativa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
334
Chain Sequence
KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
publication title Crystal structure and Functional Analysis of Glyceraldehyde-3-phosphate Dehydrogenase from Oryza Sativa
rcsb
source organism Oryza sativa japonica group
total genus 84
structure length 334
sequence length 334
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3e6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e6aA01
3TZKA 4XQGA 5HS6A 2FPIA 3MWEB 3LT0A 5CDTA 3VDRA 3HN2A 5BSFA 1UDCA 3FPLA 3JQBA 4HBGA 3DMTA 1YWGO 5IJZA 5IN5A 3LC1O 3ENKA 4E0BA 4ZQHA 4PZCA 4BO1A 3VKUA 2V6FA 1V6AA 2YYYA 3ZHXA 5KIAA 4TZTA 3IL2A 1FDVA 5LC1A 1I32A 3KM0A 1LDEA 5KWEA 2J3KA 1T2DA 2Q2VA 4BNHA 1PTJA 3O38A 1UP7A 3OIDA 4FB5A 1FXSA 4GVLA 4R01A 3JQBC 4RQTA 3DMTC 3ZWPA 1RM3A 2NVWA 4Y67A 5BNIA 5G0UA 4DLAA 2X9GA 1YOVA 4YA6A 4CQMA 3PXXA 1GUFA 1E7SA 4OSOA 4AJLA 1ZKMA 3R3JA 2DUWA 2C5EA 2F00A 3KLMX 3MCVA 2JJYA 1EFKA 2W2KB 4XEHA 2DKNA 1I8TA 2VYVD 4B7CA 1QSGA 1NQ5A 3PDUA 1KEPA 3Q9NA 5L53A 5A9SA 2O3UA 4PLYA 3ROQA 4JN6B 1IB6A 1B2LA 2CFCA 4WUVA 2J8ZA 4E2WA 1M6HA 2HK7A 1PJCA 1A4UA 1YGYA 4OQZA 1J6UA 1PL8A 3JQFA 3RQSA 2P68A 1X0XA 2HUNA 4QEDA 4AG3A 1BXZA 2Y0DA 4BS9A 3AFMA 3GFBA 2VN8A 5T57A 3RUHA 4MVJG 3NTOA 3H9QA 3L4BA 1Y8QB 4GL4A 3GG9A 4GWKA 3HG7A 1ONOA 4WLNA 4NNJA 3VVBA 3K5PA 1TT5A 2NACA 3JQFC 3KO8A 4QXMA 3VPGA 3HB5X 4IPTA 5JC8A 3O4RA 1PJLA 3JD0A 2DBQA 1EMDA 1YL6A 3W4JA 4LN1A 3L4BC 4WLVA 1TLTA 2VZ0A 1PJ3A 1I3NA 1B16A 5HTOA 3JV7A 5EQDA 1R4MB 4ZRMA 1DRUA 1N9GA 1UXJA 1RM5A 3Q6IA 5L95A 3OFSA 2CDCA 2RH8A 4PZEA 1IHYA 2GPTA 3BYZA 3QLJA 5HWSA 3WGTA 1GPJA 1U3UA 4J49A 2PTGA 4OXKA 4U0KA 1XELA 4WOJA 4D41A 3ZU4A 4R5HA 2ZTMA 2DPGA 3FD8A 5CG1A 3A28A 3RU7A 1P77A 1SMKA 3EAGA 3PTZA 4TKMA 5F5NA 4XB1A 3RUAA 2DVMA 3COSA 1D8AA 1LLQA 3SC4A 1SNYA 1U4OA 5C5IA 3I23A 1AXEA 1ULSA 5TGDA 2Q22A 3BTSA 2HK8A 1LEHA 4AJHA 4TQGA 4JROA 4XIYA 5TS3A 5L4NA 1YQGA 3PHHA 2B4QA 2OZPA 3BMNB 4A73A 3LC7O 2GN9A 1ADBA 5FFFA 3F5SA 2UYYA 5AXAA 3VHRA 1JKIA 1NYTA 2DFDA 1DPGA 4MIEA 3OJLA 3HN7A 3KOUA 4WPGA 4B7XA 5C37A 5ITVA 1QYCA 2WM3A 5IFLA 1T26A 3G1UA 4CM1A 4WGGA 1F0YA 1BXGB 3TOXA 2IRWA 1OOEA 1PX0A 1U3TA 4BNIA 4CMAA 3W8EA 1RYEA 3LT2A 3K9QO 1R12A 1KOLA 4GSKA 5JMWA 1DB3A 3FN4A 3IC5A 2GZ1A 5IXYA 2AQ8A 2X8LA 3E1KA 3PWZA 4ZJUA 4HFRA 4D3SA 4Z3DA 4PLVA 1MG0A 1UDAA 4IS3A 1E7WA 1AGNA 4NHEA 3M2TA 3Q2IA 2QRJA 3PLNA 4J1QA 3JQAB 1WVGA 4E5NA 1Y1PA 1LLCA 5BQFA 4BUCA 3OP4A 4GMGA 5CDYA 5L9AA 5ENVA 3DAFA 3PP8A 4CQMD 3H9GA 1XIVA 3O26A 2RIRA 5JDIA 4ALMA 3PI7A 4TROA 5G4LA 3N7UA 1O5IA 1VJTA 1WMBA 5B4TA 1OC4A 3ROMA 4IJKA 1R4MA 2BGLA 5BR7A 3B20A 1D7OA 4CPDA 5EIOA 3ETGA 4J7XA 3VPXA 4YAGA 5LDHA 4IMPA 5JY1A 2AMFA 3E5RA 1JW9B 2EF1A 2VHWA 1IULA 2TMDA 1DC5A 3HJAA 3KRTA 1YXMA 2WSBA 4FFPA 2I67A 4IS2A 1X1TA 4YR9A 4BO5A 2VHYA 4MVJF 1GQ2A 3AI1A 2YQ5A 3GH3A 2PH5A 4FQ8A 4OO3A 1ZEJA 3RVDA 3U9LA 1HZJA 4H16A 2C20A 5JXWA 4FSHA 2CZCA 2V6GA 1FDSA 2JD0A 4U6QA 1MV8A 2Z95A 3GDOA 2BMAA 3JYPA 2DU8A 3LVFO 4D7AA 3GZ4A 2NU7A 4UUOA 4OSPA 1KVQA 5K0ZA 3AK4A 3G79A 3GK3A 2P4HX 1ZMOA 1PJQA 4Z0TA 4WCFA 3TN7A 4BV8A 4DIOA 4CR8A 1ZVMA 3DOJA 3FRJA 5CDUA 3WTCA 1E1NA 4WASA 2VHXA 5IZCA 4R68A 3GHHA 3QWFA 1NR1A 3L77A 4GX0A 2B37A 5EMHA 2Q46A 3AUTA 3NKLA 4E32A 1NHWA 3IIEA 3JYLA 4GI2A 4CV0A 4WCFC 5A5FA 2DBZA 3JD4A 8LDHA 3PYMA 2Q49A 3BMOB 3V1UA 4A26A 5FWNA 1E92A 5IZCC 1BXGA 1NX6A 4NH4A 3CINA 1QRRA 3MJ4A 1F17A 2VHZA 3ZU3A 1C0LA 4J4TA 1P74A 1QV7A 4II2A 4PVDA 3S2IA 1Z6ZA 4WNIA 1LLDA 2WTBA 5A03A 4EITA 3EVTA 5IDWA 4BNZA 1ZEMA 3L9WA 4XR4A 3CPSA 2GGSA 1QORA 2IEDA 4PG7A 1HXHA 2R6JA 4ZQEA 3WB9A 3ASVA 4BQPA 1V35A 2IZ1A 4YT2A 1VSVA 1VL6A 4CLOB 3ZWXA 1XQ1A 4NIMA 5C7OO 4NDNE 3M2PA 3H2ZA 4L76A 3W4IA 3SJ7A 3PJFA 1SC6A 5T6BA 2YHUA 1DC3A 4O5OA 4LMPA 1NP3A 5DN9A 4YPOA 4FJ0A 1N5DA 3WJAA 3B70A 1Y7TA 1AN9A 4DA9A 4WEQA 4ROSA 1I30A 3WGZA 3FSRA 3JQGB 4BOYA 1F12A 1M76A 1ZW1A 3SBOA 1D1SA 3VH2A 4QO8A 2O4UX 5ICSA 1RJWA 4R3NA 4ZQGA 1E7RA 4DC0A 3DBRB 2E4AA 4FOOA 1FF9A 4IDGA 4HX5A 4E4YA 3ZNPA 4CM8B 4AL4A 2VT2A 4ITUA 2IDZA 4IM7A 3H65A 1U7TA 2YDYA 4CMKA 5TJHA 1BDBA 1MG5A 1EBUA 4JNKA 2GZ2A 3K96A 3RUEA 1TI7A 4AJPA 1B14A 4I08A 2VCYA 3L0DA 5JYEA 3OF2A 4M1QA 1DEHA 1KEVA 3WSVA 3OM9A 5JLAA 4L4XA 4OM8A 3AUAA 2DTXA 4CODB 3P2YA 3OICA 1DIHA 4M87A 5CAEA 3ITKA 4BMSA 1NFQA 2GN8A 2F1KA 2BKAA 1MC5A 1WAMA 1LQUA 2X0JA 1BW9A 2HK9A 4U6SA 5JO9A 5IDQA 4LRTB 5IAAA 1RM0A 4J4HA 2DC1A 4R16A 2X23A 3V5NA 4Q3BA 3TZ6A 1HDGO 5EQFA 3RJ9A 2C29D 4ZVVA 1B7GO 1A7AA 5GZ3A 4DIFA 1UXHA 1JAXA 4OYRA 2CUKA 1DFGA 4NBTA 4HXYA 4ZU3A 2O3TA 3UCXA 2FP4A 2RHCA 4EDFA 4W82A 4ID9A 4R5MA 4FD3A 4FOSA 3UAGA 5DOVA 1W6UA 3IUPA 2NVUB 2C7GA 2GSDA 3ZWYA 4CLXA 3VPFA 1A4IA 4RVUA 5G0VA 1Y5RA 1PWZA 1Y9EA 2HRBA 3GZNA 1SB9A 2I9PA 3RBZA 3H9EO 1HWYA 4Q39A 1NVTA 2B5WA 1T2CA 1KC3A 3GAFA 4G5HA 4WE3A 3V2GA 2FOIA 4I9NA 3WBBA 4JXKA 3WFIA 1B8VA 3JQGA 4E33A 1ULUA 3A9WA 4PRKA 4PG6A 1U1IA 3JYQA 1G0NA 2ZYDA 3OA2A 1Y5MA 4MOWA 1BGVA 1VRWA 3DBRA 4H7PA 3DBLB 2DUUA 3GUCA 4NPCA 1HE5A 4A03A 1T25A 4PZDA 3WJ7A 3D0OA 1C14A 4JCOA 4MIYA 2D4AA 4CM8A 3EVNA 1PJ2A 3I9KA 3P19A 3E48A 3TFQA 4JBGA 4BNLA 4TKLA 5FI3A 1QP8A 5TC4A 5C3MA 1X0VA 4AVYA 4E13A 3RUCA 3F46A 4D0RA 2WD7B 1NWCA 4DRYA 1ID1A 2AEJA 2YFQA 5B37A 4RVHA 1EQUA 3DFUA 1OI7A 2O50A 5A05A 4CUJA 1I0ZA 1H5QA 4NFHA 3VTFA 1YS4A 1C3VA 2VNAA 2YFHA 1V8BA 1Y8RB 4KP7A 1ZXBA 2JKVA 3AI2A 2YV1A 1BRMA 7MDHA 3RU9A 1BWSA 3QP9A 4IXTA 1SPXA 1ENOA 3JQ9A 4HNGA 2PKQP 2A94A 4FJ1A 4O63O 2AW5A 1GR0A 3KHUA 2VWQA 1F06A 2J5RA 5KNLA 4R1SA 4YAKA 3K2BA 1DHTA 3JQ9C 3WYCA 2ZIZA 4XDZA 3B1JA 2JCYA 3BHJA 3NX4A 1P45A 2UAGA 4NU6A 1WP4A 4D0SA 3ONDA 1DFIA 1EVJA 1GZ6A 3EMKA 4F6CA 1YDWA 3U3XA 3GMDA 5A06A 1EK6A 3VZSA 1ZIDA 1WZIA 5IZ4A 4XR9A 4CMGA 1N8KA 4F45A 3EGOA 2X22A 4HV4A 3GPDG 3K6JA 3LZ6A 5G0SA 4J16A 3FWZA 3I9JA 1M67A 2NU6A 4Z3KA 4C7KA 1Q2XA 2FRDA 3MJTA 1KVSA 3MJCA 1K0UA 3GQVA 1N7HA 1XG5A 1GTMA 1HL3A 1EDOA 3ADPA 5EINA 4KWHA 1VC2A 4NFSA 4XCVA 4WEOA 1GADO 2VTEA 3ITDA 3DZGA 1UXIA 3IOYA 3FCOA 5KVCA 3F1KA 5HA5A 3ZW9A 4JP2A 1DC6A 5JYDA 5L4SA 1ZSVA 5JFOA 4G81A 4KQWA 4L73A 1H2BA 3U5TA 2HRZA 3PWKA 4YTEA 3JCZA 3I1JA 4GSLA 1TT7A 1XEAA 1U5AA 4L4RA 2B0JA 1A9ZA 4INAA 4CR6A 1QYDA 3BZUA 2NTNA 1MX3A 3SVTA 3C1TA 4RQUA 3INTA 3RASA 5TIIA 5C7IO 2X9VA 4WJZA 4J2OA 1NQOA 3T7CA 2O4CA 4OGWA 5G0WA 3FR8A 2I3AA 4QQRA 1HSZA 1BDMA 1DAOA 3GNSA 3OJFA 1FK8A 3I9LA 5TSDA 1GD1O 2RH4A 3GVPA 5KCZA 3Q1LA 3LK7A 1WDKA 2PK3A 4QO7A 2VWHA 3A06A 5BSGA 1H93A 2CSUA 3WMWA 1AHHA 2PFGA 3PPIA 1I2ZA 5DCYA 3SEFA 4C4OA 3GVXA 5JDCA 1I36A 3M1LA 2UUPA 3IKTA 1OC2A 3DFZA 1V0JA 2PZLA 3C24A 5JCXA 3PYLA 5FI5A 1Z7BA 2WEKA 5CPFA 1ADCA 1V9LA 1ZXLA 4LSMA 3BMCB 3KEOA 2HJSA 1DLJA 3AOEA 4B3JA 4IUYA 1NPDA 1DOHA 2P9CA 5JDCC 2GN4A 2X58A 3VVCA 5TLSA 5TRTA 1H9BA 4Z9YA 1JKFA 5DOZA 4C7JA 2X5JO 3GAZA 3E9QA 1P1HA 4ZA2A 4W4TA 1BSVA 4XDYA 2PKRA 1HDCA 5KTKA 5GZ1A 3AOEC 3VTZA 2Y68A 5I7VA 3P2OA 4ND3A 4YRAA 1X15A 1NPTO 4P8RA 3HDHA 2EP5A 3OSUA 4YT4A 4BNFA 1R37A 1GUZA 2J5KA 3GNTA 5H83A 2VTDA 3LT4A 3TFOA 4JBIA 1VPDA 2Y67A 3QV1A 4FS3A 4Y98A 3CXRA 5COAA 4GLOA 4BVAA 5ADHA 5AXDA 1JWAB 4OIMA 3F6YA 4NG5A 2TMGA 5CHEA 5DP1A 3ULKA 4ESOA 3ETDA 4LCJA 2ZB7A 4UEOA 2P2SA 1LRKA 3MJVA 1EQ2A 2C59A 4CV2A 4PVCA 4P4LA 3AWDA 3G0OA 1ONNA 3CEAA 5IDYA 5A5EA 4XZ3A 3WG9A 1YBVA 2WDZA 3WWYA 5T64A 4W99A 4OJNA 3TOZA 1U8FO 3P5SA 3ZWAA 4AJEA 1E3IA 2OUIA 3ZHBA 4BGVA 3GHYA 3NTRA 5JPIA 2I3GA 4O1MA 3CMCO 4R1TA 1DRVA 2O23A 1KVTA 4B8WA 4J4BA 1EE9A 3ETEA 3MTGA 3BMQB 2PZJA 3PHGA 1XR3A 3PHJA 4FFLA 3M1AA 1ZK3A 4FJ2A 3H6KA 1JLLA 3DAGA 1ENYA 4CL8A 4CM7A 4CMIA 4E2YA 3VAZA 3O8QA 2HU2A 3DZIA 1PR3A 1SAYA 3K92A 1OMOA 2O3QA 3H2SA 1LRLA 4Y6PA 3MEQA 3UGKA 1Q0HA 1ZO8A 3KVOA 5A02A 2YV2A 5T67A 4RO0A 4LISA 4BO3A 1GQYA 1H6DA 3BTOA 5CEFA 1EZ4A 5KJCA 2X86A 2Y1CA 4E5PA 2Z1NA 1HDYA 3JQ7B 1PJSA 2E49A 3GVIA 3T4EA 3F4BA 3UICA 1LQTA 4TMFA 4DLBA 5MGBA 5JAZA 2GD1O 2X7HA 1CJCA 2AQHA 3RUIA 1XQ6A 3JQ8B 1NTOA 2JHGA 4J1SA 3SLKA 3DZKA 2ZQZA 5THKA 3BTUA 3U49A 3NUGA 3WSWA 1E3WB 5MDHA 1I24A 4XQCA 4B7UA 4R41A 1M2WA 4JP3A 3SX2A 5U4QA 3TZHA 3QA9A 1P44A 4CMEA 4W6ZA 4J6FA 1PJTA 4GBJA 2NU8A 1MA0A 1DC4A 3WOHA 3FHLA 4PLGA 3EHEA 3EY4A 4Q3CA 4R3WA 4RL6A 4J43A 5JAMA 4ZGWA 1I3LA 4IBOA 2XPCA 1R4NA 4CMCA 3MOIA 4EEZA 2J3IA 1MB4A 4XYLA 4CMEC 5B12A 1LA2A 3DTYA 1TVEA 1KY5A 4HFJA 4RCVA 1H6BA 5ILGA 1A72A 4BO9A 1HDZA 3V2UA 2RBEA 4BHTA 2NV6A 4CLEA 2C7VA 1Y9AA 4Z6KA 2FZEA 4YBZA 3TF5A 1IUKA 3Q3CA 3I4CA 4RGBA 1LDGA 5TJ9A 2CD9A 3HADA 2PA3A 1JQBA 2ZTLA 1MLDA 4RVDA 3PFWO 4IGFA 3KV3O 2NUAA 1GEEA 4JJGA 3LF2A 4JQCA 5JAQA 5JNLA 1NXQA 2VRCA 2X4GA 3ON5A 1HDXA 3EZLA 2PZMA 2FSVA 2IODA 2Y99A 4M89A 4AJIA 4N18A 3AUSA 1X7DA 4XA8A 2FSSA 3RWBA 3EYWA 4EGFA 3GLQA 2FWMX 2ZCUA 3NYWA 4H15A 4P4GA 1T2FA 1ZCJA 4YQZA 3ZU2A 1B26A 3WMXA 4R54A 2JHFA 1W0CA 2UVDA 4RORA 3D4OA 4U8GA 4PLZA 3JQ7A 3KB6A 3FTPA 2IZZA 5JO0A 3JD3A 2O3RA 2W2KA 3ZU5A 4XRGA 3GG2A 2HO5A 1B0AA 3DO5A 4YRDA 3TQHA 4G2NA 3VKVA 1ADGA 1U2GA 2EW2A 3ONFA 4LVCA 3ZV5A 4DBZA 5A04A 1ZH8A 5KKAA 3KYBA 4RPKA 3QY9A 1IPEA 1HRDA 2D1YA 1RM4A 4R9SA 3UW3A 4UVHA 1YVEI 4BKUA 4M8SA 4NJMB 4GLLA 2NTJA 5HM8A 3UH1A 4A7PA 1Y8QA 2JCVA 3NAQA 1VM6A 4QTZA 4PN3A 1HTBA 5B4UA 1CETA 1G6KA 3DB2A 1WZEA 3DZFA 4TZKA 3U62A 1HETA 3HB4X 2H63A 3FBGA 2XXJA 3FTNA 3QJ5A 3ZWMA 4ALNA 2BGMA 4BGUA 1XYGA 2X1HA 4YJGB 5EN4A 1EVZA 4DUPA 1I5RA 2IXBA 4NFYA 2Q45A 5CP8A 4BO4A 1T4DA 3WTBA 1PEDA 3KTDA 4N5MA 2VHVA 1P0CA 3A14A 1TEHA 1PGQA 3L6DA 1YL7A 2HMWA 2ILTA 2GASA 1LDNA 1R0LA 2CF6A 3KSUA 1O95A 3SXPA 3VH1A 2BH9A 4E12A 1ONPA 3WXBA 3ZHYA 2OBNA 3AM3A 1HSOA 4RPJA 3FBTA 4EI2A 3EDMA 5JMPA 2P91A 1DLIA 2CDAA 4Q3EA 3RFXA 3EC7A 3ONEA 1DO8A 3ROPA 4UULA 4PFJA 4DPKA 3DDNA 2Y0EA 4L0QA 5FF9A 1YH3A 4DVJA 3PJGA 3NDRA 2RCYA 4K6CA 4KZPA 1MFZA 2GERA 3I4FA 1ISGA 2QQ5A 4D3DA 3BMNA 4IGEA 1D1TA 2ZB4A 4I1IA 4J9VA 2LDBA 4NBRA 2PV7A 3E8XA 2JFGA 2XF8A 2DBRA 4LRSB 4R1UA 1GU7A 2X0IA 4BNKA 3WGIA 1ZFNA 2Q2QA 3A4VA 5I7FA 4DYDA 3IP3A 4Q3NA 1DJNA 4J7CA 4MDHA 3W1VA 5I7SA 2YV3A 2HMVA 3U09A 2CY0A 2EERA 3QRWA 2B35A 2ZJ0A 4E5YA 2ZYGA 2EW8A 4QX6A 2Q1TA 2VRCD 5KKCA 3MJSA 2D3TA 3EZYA 1HF3A 1U4SA 2OFPA 4RF2A 3UCEA 4RF5A 2YW9A 2Y1FA 3DBHB 5COQA 4UAGA 4ZQBA 4BO2A 4R1NA 1U7HA 3HSKA 3JQAA 3MOGA 4AFNA 1DIBA 3RBVA 1JVBA 4JJFA 3E9MA 1C1XB 2X5OA 2ZQYA 2DTDA 4BO6A 4MJLA 4EZBA 3EW7A 3WQQA 2WE8A 4XGIA 3ZN2A 2QW8A 2Y1GA 2GYYA 4NK5A 3ZWNA 1YJ8A 4EJ6A 2H5LA 1A9YA 2EG9A 5G4KB 3S8MA 4PLPA 1PS0A 4OMUA 1OFGA 4DYVA 1MXHA 4PLFA 1H94A 4IY1A 1Z75A 1J5PA 1EK5A 4GGOA 4TRRA 5JAIA 4Y8VA 3VDQA 4YT5A 2QYTA 4MVJH 1PL6A 2VZ9A 4E5MA 4UUPA 3S2FA 4OOEA 3AU9A 4N5NA 3C8MA 4MKXA 1HT0A 2W98A 1KVRA 3GGPA 4AJ4A 5F1OA 4CM4B 2OOSA 4IDBA 2FR8A 4RF4A 6ADHA 1T4BA 3PYXA 2Y93A 4EEXA 1EBFA 4XJSA 4U5QA 3TZQA 2DAPA 1J49A 3R0IA 3P7MA 5A9RA 2VOEA 1YL5A 3RI3A 2GRAA 5KOIA 3CMMA 2UDPA 2QZZA 4IDCA 4MIOA 1QV6A 3GUYA 4CM6A 2Q50A 2G1UA 3Q2KA 1JU9A 4DBVO 1IL0A 4I5FA 4Q3AA 3NV9A 4UVIA 4BNXA 4ZQFA 1ZJYA 5FEUA 1SEPA 2Z5LA 4Z0PA 3G17A 4A27A 3F5QA 5I8ZA 4YDRA 1MGOA 3RUDA 3K31A 2W90A 4GWGA 2G5CA 2VZ8A 3U4HA 2HQ1A 5AYVA 2DPHA 2A4KA 3QE3A 2NADA 1HE4A 3E5MA 2UV8A 3LF1A 4UEKA 5KJ6A 5CDSA 3MJEA 3L6EA 5L51A 4NZ9A 2Q99A 2EGGA 3BMOA 4XD2A 1YQDA 3BA1A 3ORFA 4RDIA 4BNJA 4AJOA 7ADHA 1NWHA 1TA4A 2AE2A 1IHXA 3HFSA 4TRMA 4YAIA 3ZH2A 1XSEA 2QHXA 2JCXA 3C1OA 1V3TA 1VSUA 3K8ZA 2BD0A 4MKRA 2HMUA 1O6ZA 3WGYA 3QSGA 4DQVA 3B1KA 3DBHA 4XYMA 2EJVA 3RFTA 5I9LA 2C2XA 1EUCA 1VE9A 2AA3A 3STHA 2PD4A 4OH1A 4CLOA 4BKRA 5BSHA 4P38A 3ZWBA 3DR3A 3CZRA 3JD2A 1H9AA 5JYFA 1DAPA 1WDLA 1PGOA 2I65A 4JLWA 1PR9A 1V3VA 4HY3A 4E3ZA 1T24A 4OXNA 4BMVA 5G4KA 2B4RO 1MFPA 4BGIA 3PDJA 1OZAA 1UXGA 3R3SA 1ADFA 1N2SA 2QIOA 3F3SA 4FC7A 1MUUA 2GNAA 1V3UA 4L74A 4OKIA 4RV9A 3BHMA 4RPGA 1E5QA 3NDJA 4MINA 4DC1A 1KYQA 1PJ4A 5JCJA 5HS4A 1DBVO 1YB5A 1W4ZA 4JBHA 5CDGA 3H8VA 3PIDA 4TWRA 3HDQA 1A71A 4KDEA 3V1YA 1TXGA 2VOJA 4XIJA 4FGWA 2X0NA 5EESA 4OL9A 3VZRA 4WNCA 3PQFA 1K3TA 3QIVA 1NBOA 2EV9A 2BI8A 5DULA 3WLEA 2H1SA 3PFFA 1C1DB 3TDKA 4OKNA 1JAYA 3I9MA 5F1PA 1E7YA 2DQ4A 1ZUD1 3CKYA 3GA0A 3JQAD 1JN0A 2D8AA 3AW9A 1NQTA 2FZWA 4P22A 1JDJA 3RFVA 1YKFA 3UFXA 1BVRA 1I2CA 1O8CA 3DQPA 3RD5A 5A1TA 1PZHA 1IY8A 2QX7A 1PZEA 3CIFA 5M6DA 1ZSNA 2YY7A 4W7IA 5I9MA 5JS6A 2X5KO 2EJWA 3WGHA 2NWQA 2AQIA 4CV3A 3OA0A 2G76A 3L07A 4WK6A 4EBFA 2DM6A 1NR7A 4B4VA 5T5QA 5EL0A 3FR7A 3E18A 4X54A 3D4PA 1Y81A 3TWOA 4B3IA 4CUKA 4RZIA 3RC7A 1U2DA 1CIVA 2V6MA 1QMGA 3U4CA 2O2SA 2GCGA 2HMTA 1EUZA 4GKVA 3D3WB 5DCWA 3GNQA 2NVUA 4D44A 1UZLA 3WIEA 2P9EA 4IJVA 1LDMA 4BNUA 1CF2O 2Y1DA 6LDHA 5KJ1A 4LW8A 4S3MA 4CJXA 1OAAA 5DP2A 4ALKA 5DF1A 2Y1EA 4BIIA 1JTVA 2PNFA 2YHIB 5HRUA 2CMDA 1T2EA 4IQ8A 4CM9A 1R66A 2B36A 2OP1A 3JYNA 4CMHA 1X13A 2Q3EA 3LDHA 4WLEA 4JK3A 3FF4A 1PQWA 4QFDA 1SCUA 4G65A 4XB2A 4BKOA 3LT1A 2X0RA 2R00A 4DWVA 4JIGA 1HE3A 2I99A 5BSEA 2JD2A 3WR5A 3D7LA 3GEDA 2HJRA 4DPLA 2Z1MA 1ZMTA 4JJIA 3QHAA 4YYZA 3BTVA 1UAGA 1VL0A 1AE1A 2FR0A 3AUUA 3DBLA 4GKBA 3U0BA 2FY8A 3ICPA 4N7RA 3D5QA 4I5EA 4QFCA 2GDZA 2SCUA 3AFNA 2R00C 1EVYA 3DWFA 4CLRB 1NM5A 1ZBQA 2W2LA 3QWBA 3TJRA 3H3JA 1Y6JA 5CEJA 1ARZA 5GMOA 4FGSA 4GH5A 4A10A 3C7CB 1JWBB 1P33A 1E3LA 2EGHA 2ZTUA 5G0TA 1UR5A 1E3EA 5JBIA 5T73A 2WD7A 3UCFA 2J6IA 1Z7EA 2POQX 4FCCA 5H82A 5B4VA 2JD1A 1P1RA 3ASUA 4GX5A 4BNMA 5AQ1A 4I5DA 4YRBA 2VUTA 4NI5A 1Y8RA 1E6WA 1FDWA 1U8XX 4DGSA 2P4QA 3H5RA 2JAHA 2WJPA 4B4WA 5TQVA 1GQQA 4CQLB 1CQJA 3JQEA 3OIFA 1LU9A 1I01A 5LDGA 3DHYA 1KVUA 1Z73A 1ZSYA 1DJQA 4R69A 2AXQA 5ILOA 3E9NA 2R2GA 4WLUA 3AOGA 4NBVA 4IDAA 2HCTA 2ZJ1A 5JCJD 4QT0A 2V6BA 3WQRA 5IN4A 3OHSX 1RWBA 2Q4EA 2G17A 3AI3A 4HP8A 4URFA 2FMUA 1WXDA 5DNAA 1LC3A 1XU9A 2A9FA 1ISMA 3BAZA 4IJWA 2FN7A 1KY4A 2NSDA 1UJMA 1YJQA 4AJ1A 3RC2A 1VL8A 4KMSA 4ZRNA 1AXGA 3H3FA 4N5LA 4BMNA 1GV0A 5J9GA 2E48A 2Q1SA 9LDTA 2OMEA 4DPMA 1P3DA 3JQ6A 1YOVB 3WFJA 5I9NA 1SO8A 1ZK2A 1BG6A 1DIAA 4WCDA 4WECA 3DTTA 1LNQA 4M54A 1D4FA 3LLSA 2HLPA 2ZCVA 1FDUA 2JFFA 2ZB8A 3WDSA 4I9HA 1SBYA 4Q3DA 4RDHA 1K6JA 3UF0A 4MVJA 3WIDA 3G3EA 4U0JA 2HAEA 3ZZNA 2V7PA 4L9RA 3VOSA 2YDXA 1Q0QA 3F4LA 4J2HA 3AY3A 5A9SB 3PZRA 1O9BA 3DZJA 4YT8A 5KVSA 1QYVA 3ZWOA 1PSDA 3R1IA 1MXFA 5DT9A 1P1IA 1ML3A 3BHIA 1R0KA 1ZZEA 3L9XA 4RPLA 1HE2A 2A35A 1BTOA 3W8FA 1GDHA 2YQ4A 1H0KA 3K30A 3HFGA 3IUSA 2J3JA 4R51A 3K2EA 3FWNA 4XRRA 4W9NA 2O3JA 4R9RA 1E7QA 3ZV4A 3QWIA 2E37A 1NFFA 4UVGA 3WS7A 3NTQA 3DC2A 1E1LA 1HEUA 3UUWA 2DT5A 1TT5B 3H5NA 1UUFA 4A0SA 1UAYA 4XQEA 2Q1WA 4PIVA 1L7DA 1X7HA 4CM9D 4W9NC 3VZPA 3OBBA 4J1TA 5TT0A 2NU9A 4O59O 4L75A 4XYEA 5L7YA 4E30A 3I52A 4AJ2A 2HSDA 4FR5A 2GF2A 3I9NA 3BIOA 1N9GB 5ER9A 3DBVO 1IYZA 3DZHA 3KETA 2BFOA 4EJMA 4BNWA 3D64A 3DHNA 2GLXA 5AVOA 1LSUA 3NEPX 4TSKA 4YEDA 3UKOA 2NLOA 4Y9DA 4K6FA 3ROKA 3LC2O 2OHXA 3PZBA 3C7DB 1KBZA 3K73O 3DZBA 3DONA 3BMCA 3KBOA 4KQXA 5J23A 1NHGA 3E03A 2PGDA 1ZK1A 3KUXA 4TRNA 3I9OA 5KJEA 4YXFA 1E3SA 3OQBA 1CYDA 2W2LD 3JSAA 1T2AA 1NFRA 2QRLA 4NMHA 1U9JA 3ENNA 4KTVE 1KETA 3IAHA 4WLFA 2VT3A 1N1EA 4BO0A 1YB4A 4KUGA 3HUDA 4S1VA 2B83A 4E2ZA 5KJFA 4L8VA 3I6IA 4Z9FA 2EWMA 3WNVA 4RPHA 3LYLA 4HNHA 2C0CA 4DLLA 1W73A 1Z45A 3CZMA 2YUTA 5JYAA 4FW8A 2AE1A 4PG5A 3VH3A 4KUHA 4E31A 4IQGA 1UP6A 5C7LO 3ANLA 4LCEA 3Q0EA 2EHDA 2I66A 1TB4A 4XJTA 2B4TO 1I3MA 3QVXA 3D4NA 4YQYA 1NQAO 1KERA 2BFAA 1DDOA 5AOVA 3MZ0A 1X1EA 3RBXA 3FNFA 4IIUA 1A7KA 3C7AA 3ZWWA 2PGJA 2P9GA 1O0SA 4YAJA 2WE7A 4YJFB 2GUGA 4XGKA 1U3WA 1Z82A 1EVIA 2CF5A 3FNHA 4U7WA 3ZWVA 1CWUA 4J9UE 1QLHA 3HQ4O 4OQYA 1KEUA 4DTIA 1GPDG 4KOAA 1PJBA 4QSMA 4MVJE 3WGOA 1LSSA 4W7HA 1E1KA 1YBMA 1LRJA 2I6TA 1XKQA 1HKUA 5JY6A 5ICMA 2NTVA 3RIHA 4PLHA 4ND5A 1WDMA 3DEYX 4GAEA 3DL2A 3CSDA 3S1LA 3BMQA 1HYHA 2C82A 2QG4A 1ENZA 4NK4A 2O2YA 4XYBA 4IMRA 3AJRA 4UUMA 1AUPA 2D5CA 2HKIA 4IDDA 3NT5A 4F6LA 3OQ6A 4IDFA 2YJZA 4BNTA 1PQPA 4Y6RA 5ES3A 4E6PA 2H6EA 1P1JA 4MVJD 2CDBA 4LK3A 4I9UA 3PQEA 4YJHB 5COBA 3PQDA 4GPD1 4FN4A 1UH5A 3X2EA 1NNUA 3QW2A 1LSOA 3IDSA 3ANNA 1P31A 1XGKA 2WYVA 4BKPA 4ZICA 3ST7A 4HWKA 4OHUA 2HMSA 2YZ7A 2C07A 2DLDA 3TRIA 5K6AA 4BNNA 4XQ9A 1YDEA 1DXYA 2UUOA 3T7EA 3TPCA 4ALJA 2IYPA 4TRJA 3NJ4A 2LDXA 3CE6A 3IMFA 3JQ8A 5DBFA 3NT2A 3IJPA 4FBGA 1KIFA 3PWSA 1NPYA 2FR1A 4DXHA 4YCAA 3JTMA 4QECA 1K89A 2ZYAA 4MVJI 3WWZA 5IF3A 5CFZA 3TL2A 1E3WA 3OQ1A 2A92A 4J0FA 1RPNA 3H7AA 4WCFB 1I2BA 4MP3A 5K6AC 1AHIA 3GMSA 1E77A 3TSCA 4DMLA 3U4DA 2D2IA 1YO6A 4DMMA 1L7EA 1C0KA 5BNTA 1LSJA 3INGA 5HBRA 3QQPA 1LXCA 5JE8A 3WBFA 3U4IA 2V65A 1B3RA 5AXCA 1VJ0A 1QYXA 1HZZA 2Y66A 1WW8A 3JD1A 1GYPA 2D59A 1BXKA 4B8ZA 4YJFA 3AU8A 2PLAA 4K9DA 1HLPA 4PLTA 1M6WA 2G82A 2BF7A 3ADOA 1LBEA 4RZHA 4B79A 3HE3A 4JX8A 4XGNA 1A27A 5JC1A 1PU2A 2BELA 1YONA 4A5OA 1PWXA 2Q2WA 4CLHA 3ZNNA 1DIGA 1JKJA 1JVSA 4RVGA 1P1KA 4PG4A 3ZCXA 4CV1A 1CERA 3GOHA 3V8BA 2OL4A 3X2FA 4RLHA 4DL9A 3PLRA 4O0LA 3WNQA 3W6ZA 5TT1A 1VKOA 1ISIA 3KEQA 1J0XO 4AJNA 4FIZA 3H4VA 1PS9A 3VPSA 3W4KA 4NR0A 2NQTA 1FDTA 2EKLA 4II3A 3WGGA 4CR7A 1E7MA 2NNLD 2C54A 5BNFA 2BHLA 2VRBA 1R15A 2EKQA 4GGPA 4YJHA 1XWFA 2VQ3A 4FC6A 1B15A 2ZTVA 5JDIC 3I6QA 4IDEA 1H6CA 4E21A 1ZK4A 2Q4BA 2I5PO 3DMYA 4MVJP 1QXSA 3F47A 2QRKA 3DXFA 1FMCA 2Y1OA 3AM4A 1KC1A 1Q7BA 2OO5A 1DHRA 2P5YA 1HYGA 4P4NA 3UN1A 4CM3A 1ISHA 1VI2A 4NU5A 4OOFA 2PKQO 4LMRA 3H5AA 4K26A 4FFMA 3GT0A 2J5QA 1ISFA 1NVGA 2J3HA 3GC6A 3LLVA 2WYWA 4KDFA 2VNSA 3DOOA 1A5ZA 2VWGA 2D5AA 3ANMA 3GY0A 3KZVA 3CUKA 4MVJM 3NGXA 1UZNA 3AY6A 2PR2A 1GZ3A 3A1NA 2Y0CA 3MWDB 1X7GA 3GF4A 4NJMA 2JFHA 5F5LA 1BW9B 1GYQA 2C5AA 1GEGA 4ND4A 3PHIA 1WNTA 3GPIA 2ZK7A 5ITWA 3JQCA 3RUFA 3SC6A 1NVMB 4D3FA 5L7TA 3ZV3A 1N1GA 3RCBA 5LCXA 1DFHA 1KEWA 1QR6A 4B3HA 1EE2A 1QG6A 2DTEA 2WMDA 2GZ3A 3L4SO 4OAQA 5CG2A 4HKTA 1YQXA 1CQIA 4YJGA 3JQDA 4I5GA 1N92A 1SEVA 3VPHA 3R6DA 4YB8A 3E6AA 2PZKA 3S55A 1EUDA 4IQ0A 1E1MA 5F3RA 3V1TC 1U3VA 1RYDA 1XLTA 2PGLA 1PIWA 5TX7A 3I3OA 1XA0A 1Q7CA 1O89A 2PD6A 4N54A 1BVUA 3LU1A 3GR6A 3OJOA 4RJTA 2JAPA 2PD3A 3GZNB 2AEMA 3D1LA 3RKRA 4XKJA 1QKIA 4ND1A 2BFPA 4UEJA 3MTJA 1IZ0A 1PS8A 2AQKA 4ALLA 4D79A 1B8PA 4AJJA 4DREA 3FI9A 4D43A 4MP8A 1K6XA 1XCBA 2OORA 1IPFA 4GQAA 3PGJA 4BNGA 3V2HA 1U28A 3O03A 3DAPA 5KVQA 1K2WA 2O48X 1XDWA 3GEGA 1KS9A 4RF3A 5GZ6A 2ZB3A 3B6ZA 3O9ZA 2EKPA 1UP4A 2IEBA 3I5MA 4BV9A 4EW6A 1VJ1A 1E6EA 5I7EA 4PLWA 1MC4A 1PL7A 3OECA 2XAAA 4CL3A 1M75A 5L4LA 4BO8A 3HHPA 4LVUA 4Y6SA 2XXBA 5ENDA 5B1YA 1RKXA 3WGQA 2BFMA 2IZ0A 1HDOA 5TF4A 1UZMA 2OBYA 1XU7A 3UVEA 5DBGA 3E82A 3L6OO 5L40A 4PG8A 3GVCA 4BO7A 1J4AA 4ONEA 1CRWG 1WLYA 1ISJA 2OGUA 1JA9A 2CVQA 1WWKA 1IOLA 3UXYA 4F3YA 3TNLA 4Q9NA 5THQA 5L3ZA 1QYWA 4J91A 4KUEA 3WQSB 4ZN6A 2QYSA 5F21A 1S7CA 1K6IA 3SLGA 3QVWA 3UHAA 3ZI0A 3QVOA 4J3FA 1R16A 1PGNA 1SB8A 1PZFA 2WWRA 1C0PA 1C1XA 2AG8A 4EJ0A 4EYEA 1OBFO 2RAFA 1SOWA 3RKUA 1FJHA 4LSWA 3OH8A 1IZ9A 4BNYA 3D5TA 4BKQA 4BGEA 1O94A 4MO2A 5TNXA 1YBAA 3T4XA 4BNVA 2NVBA 3HDJA 4DQXA 2H9IA 3ZDFA 4J7UA 3RJ5A 1EDZA 1GYRA 5DDIP 3Q9UA 3RC9A 2AG5A 1W8DA 1HYEA 4NJOA 3EK2A 3G1TA 4CLDA 1DRWA 2EXXA 2BGKA 4WLOA 9LDBA 1ZNQO 3QWAA 4CM4A 4R4JA 1WPQA 5EJ2A 3NT4A 4IZHA 3ZWCA 3AM5A 1WMAA 4HADA 5H81A 5U1PA 4A2CA 1G0OA 4ILKA 3DHEA 4RLSA 2FPGA 3WYEA 4XX0A 3ICCA 2GO1A 1BHSA 3M6IA 3KYDB 4AICA 5JSFA 4YWJA 4FFNA 1LDYA 3VC7A 1LTHR 2BRUA 4BL5A 4D42A 3ZNQA 3WX0A 3GFGA 3RC1A 4CM5A 3IQDB 3OEYA 1YE3A 2OXIA 4UVDA 2EEZA 1ZK0A 5EPOA 4J90A 2IE0A 4ZHSA 4RVFA 3QVTA 1N7GA 1R6DA 2PWZA 2W4QA 1GL3A 4GVXA 2GN6A 4ND2A 1UXKA 5L7WA 1H6AA 4PLCA 3Q11A 2E82A 1LC0A 1E5LA 3GEMA 1GY8A 1GUYA 2BLLA 4WKGA 1I33A 3FPCA 3GGGA 1H2HA 5L45A 1P9LA 5CPBA 3N74A 4WOKA 3WYBA 3KYCB 4H3VA 2CNBA 3OEWA 2JL1A 1F8FA 2VYNA 2QZ9A 4FDAA 1XHLA 4FFOA 3ZGYA 4IINA 4IJUA 3LQFA 3H9JA 4YAEA 1E3JA 4FPXA 4IXWA 3KXDA 1C0IA 3LSYA 1SOVA 4BB6A 4DQUA 1U5CA 1ORRA 3IP1A 4BQRA 1E6UA 3AY7A 3PIIA 2RHRA 1LI4A 2OP0A 3TZCA 1UDBA 3GDFA 2ZKLA 4M55A 3SJUA 4B4UA 3RROA 1YRLA 4MKZA 3IKVA 2ET6A 1IE3A 4BB5A 3HWRA 2I76A 4EUEA 4DIBA 2Y05A 4B4OA 2HDHA 4E5KA 1PZGA 2VWPA 3PRJA 5IG2A 3GRPA 1B8UA 3GN2A 3OJ0A 1PGPA 2DBVO 2IXAA 3BXXA 4XYGA 4EUHA 2NQ8A 5KVVA 4NQZA 3GN1A 3GDGA 4Z0HO 4KWIA 1GCUA 4L4SA 4RVSA 8ADHA 3H9UA 3IS3A 4GX2A 2CVOA 5GY7A 3NRCA 4CMBA 4HUJA 3KYDA 4OXYA 4QUKA 1HDRA 2D0IA 2IYOA 5U9CA 1LJ8A 3IJRA 4I8XA 5BT9A 1L1FA 1I10A 1EFLA 1C1DA 1DIRA 4UUNA 1Q7GA 2X9NA 4O6VA 1SZJG 1GV1A 2BI7A 3NJ8A 4CMJA 4YACA 1X14A 1Q1NA 3HNPA 1P1FA 1LUAA 4NBWA 3C1AA 4Z9XA 4MPDA 2O7QA 3C85A 3I83A 4PRLA 4TVOA 2FHSA 4ZD6A 3JYOA 1NAHA 4GX1A 1HLDA 3W6UA 4YVFA 3PVZA 3PEFA 4YJDA 2AHRA 2C2YA 3B1FA 3OJEA 1PQUA 1S6YA 2VYVA 2W8ZA 4HFMA 4K28A 5A3VA 3TL3A 2O7SA 4AJKA 3ZNOA 3GVHA 2PY6A 1MP0A 4D45A 3DOCA 5DCUA 2PH3A 3QWHA 4M49A 4XWYA 3KYCA 1GCOA 3KSDO 2B5VA 4J0EA 1VLLA 4IIVA 4J1NA 3ZV6A 3PK0A 3VZQA 1CEQA 1F14A 3RSHA 3PJEA 1GZ4A 1NAIA 3OIGA 3D3WA 4K1LA 3N58A 4CMIB 3WLFA 5K9ZA 3OETA 1ZJZA 3O8QB 3VH4A 2DFVA 1YB1A 4PGFA 1BMDA 3S2EA 1M66A 1EEHA 3PHLA 2B69A 5ER6A 3WICA 4PCVA 2YHIA 3S2GA 2Q1UA 1T1SA 5DZSA 1LDBA 5CEEA 2G0TA 3ZHZA 4CQMB 1NASA 3CTMA 4FFRA 4LGVA 1Q0LA 3HZZA 1LX6A 4HFNA 3ZW8A 2XOXA 1K5HA 1DSSG 2WYUA 2E6UX 3FNGA 3UOGA 1LLUA 3F9IA 1E0DA 5F1KA 3OMLA 4E2XA 5DBIA 1D3AA 3EUWA 1P0FA 3PJDA 3QVSA 5JW6A 2FPPA 5A4DA 3GGOA 1GAEO 5FYDA 5A9TA 1PGJA 3HDYA 2EIHA 4EUFA 1B3BA 2P5UA 3G49A 4CLRA 2VYND 1CDOA 5EERA 3KLPX 3C3XA 2VUSA 5AXBA 4D46A 2O3SA 4JGBA 1R0SA 1QLJA 2AEFA 4ALIA 2EP7A 4MP6A 4NBUA 3RAJA 5I8WA 3ABIA 2VUUA 4KTTE 4CUZA 2ZATA 4UVEA 5A3JA 5G2OA 4TVBA 1R4NB 4IZIA 1G1AA 3INRA 3PGXA 5T8KA 5IDXA 3KSZO 2WD8A 3NDIA 3F1LA 1VKNA 1GFSA 3CH6A 1I3KA 4UREA 3W8DA 2CVZA 4CQLA 5IXSA 1Z74A 3NGLA 1ENPA 3D3EA 2NM0A 4M86A 1T1RA 1F8GA 2GR9A 5T8KC 2X6TA 3GRKA 4GMFA 4F46A 3FNEA
chains in the Genus database with same CATH superfamily
2BL4A 4XQGA 5HS6A 3MWEB 1S89A 5EJ9A 4GRIA 5LQKA 3DKIA 4QGAA 3LV8A 3LQ4A 3K8YA 5HUQA 5I5EA 3W2EA 3G8BA 3RQIA 4CEIA 2OAGA 3ENKA 2YUIA 5B1IA 4A0FA 2NO6A 5KNDA 4MRSA 5J40A 5CLLA 1Z28A 2WC1A 4QUEA 5EZ5A 3M49A 3AHGA 3SZMA 4ENVA 2J59A 1SQ5A 3HJHA 5LC1A 2PR7A 1NUSA 1LDEA 2ISQA 3DTVD 3KM0A 4CKYA 4Q34A 2OHFA 4U4AA 4BNHA 2Q2VA 1RS0A 3W6PA 4ZMBA 1TCVA 3OIDA 4CBVA 1FXSA 4RQTA 4NV3A 4Y67A 3CRNA 3ZQJA 5ICCA 2EDCA 2XEXA 3QKRB 3V34A 2X9GA 3BF8A 4LE0A 5ADHA 2DT8A 2WJ6A 3LXUX 4TLLB 4CQMA 3HVRA 2JK1A 3Q10A 3KBBA 3IP7A 4C4RA 3EUFA 2B4YA 1MJHA 3ODPA 5F52A 3SVZA 3VDNB 1ZISA 2Q0SA 2ZGVA 1R2QA 1JR6A 5AT1A 3N5KA 1JALA 1GOTA 2DUWA 2F00A 1EM8B 3K9GA 4DA7A 1TKRA 2F1HA 3MCVA 1IVYA 4DBLE 2QF7A 1RPAA 3OX4A 4XEHA 4C0LA 4E1BA 2B1RA 1QMPA 1PV2A 3D43A 2P9JA 1VLHA 1SUIA 2HY7A 2VL7A 3CKLA 5D3QA 4OHOA 3PDUA 4F4JA 3U44B 3T3OA 1M73E 3O74A 3Q9NA 1BWRA 3PC4A 2PZGA 2O3UA 3OMXA 2EJUA 1VSTA 2ENUA 4N5DA 1NYQA 2ETVA 3VR6H 4PLYA 1EXVA 5KEIA 1UBFA 5KDLA 4JN6B 2VF8A 1BEEA 2I2XB 1NVUQ 2ASVA 4KQJA 5M34A 2HK7A 3DEJA 4MYRA 5P8WA 4X95A 3SD7A 4CF7A 3C5VA 5FV7A 4Y2TA 1OAOA 4ES6A 1J6UA 1J8VA 3JQFA 4V24A 3RSFA 2P68A 3UHFA 4ZIRA 1X0XA 2AXPA 1D6NA 1OYVA 1BXZA 2Y0DA 3E5NA 1N2CB 5E4YA 1XL0A 2E4WA 2PSHA 2VN8A 4MVJG 1LJUA 5B7QA 3NTOA 2J0UB 4HH4A 3PCXA 4KU4A 3EGIA 4Q47A 3CNEA 4G4GA 4ZT4A 4KQGA 1Y8QB 4GWKA 2QNRA 3HG7A 1WMEA 1ONOA 3R3VA 3TEMA 3GP3A 4QHTA 5JECA 1PJ8A 2P5TB 5C5DA 3W9BA 3VNVA 3SEZA 1TT5A 3G5MA 1A9SA 4JT8A 1F8XA 1ZD9A 3ORHA 2XB8A 1TMGE 3OPMA 2PO7A 1KH1A 2EQBA 4WESA 1W1WA 3BMXA 1EMDA 4YIKA 1PFVA 2WICA 4J0HA 5REQB 4DR7B 4WLVA 3UK2A 1X80A 4JLOA 1PJ3A 2I6UA 1IN5A 4ZT6A 4YRMA 4TYPA 4C21A 4YP0A 5EIBD 5NULA 2R97A 3WKAA 3OT1A 2AUTA 4JSYA 1GUDA 4KO2S 4TVKA 3Q6IA 3O1IC 1I4WA 1LGYA 2QLMA 4XW2A 1L5HB 1Z0SA 2AD5A 2CDCA 3H2YA 3W3AA 4ZDKA 3CB4A 4PZEA 2XMZA 3T35A 3TLEA 1GPJA 3M9WA 3HJCA 4N8EA 1U3UA 4DN6A 1JUDA 4C4YA 1Y9JA 4MJXA 1YF3A 1XNJA 4IR7A 1N75A 1NJGA 2PTGA 4OXKA 1ECPA 5IUKC 5IFKA 1R9MA 4RW0A 3NKVA 5I01A 2XWPA 1MABB 3B9PA 1T43A 4WOJA 3M5PA 4MYDA 4ZI2A 2WKRA 4R5HA 2ZTMA 2DPGA 3MK31 3OMWA 4XCXA 1W2HA 1P4SA 3OI7A 5FJIA 5AW0A 1GL7A 4A5SA 1T8PA 1P77A 1SMKA 3EAGA 4Z4HA 3ND9A 2UZIR 5ALQA 1G3RA 4C29A 3COSA 1D8AA 1RRCA 2WFMA 3SC4A 4JGGA 4R9UC 4Q4JA 1NULA 1JB1A 3ZDZB 1NZJA 3QLEA 2WQ6A 1AXEA 1R5JA 2Z8XA 3IXMA 3M9LA 3LA6A 2FHPA 1IOWA 1WKBA 1LEHA 1U0GA 4HQ6A 2BEVB 4JROA 1BN6A 2OESA 1QPZA 5FOTA 2ZB2A 2I6XA 2QTBA 2OZPA 3HKBB 2JIOA 3EFOA 3UQYS 3WDMA 5ALIA 2A84A 1PR2A 2RSLA 4FBMA 4JUBA 2OWEA 3SBEA 2UYYA 4U2EA 821PA 4KEAA 3VHRA 1QIIA 1TC1A 1JKIA 1NYTA 2Q5OA 4G84A 1EJ2A 1YFJA 4WPGA 5C37A 1QYCA 3QUAA 2WD9A 1ZJJA 1PTKA 2HQSA 4V1CI 3AQ4A 1NQWA 3Q41A 1R0RE 4EA8A 1NF2A 3C8UA 4ZCRA 1DXOA 2ACEA 4RH0A 5IULC 3TOXA 4GDMA 5IARA 3M8KA 1BD4A 1WMFA 4G0PA 4PGGA 1HEIA 2IXTA 1DB3A 2PX8A 3D6JA 4GRAA 5AW4A 5IXYA 3AVXA 4OI0A 1IY1A 4V0KA 4JLSA 3N2NA 3RU2A 2JI7A 4G26A 4FT4A 2WAOA 4H7DA 4RXTA 1FJXA 1P29A 4GM0A 2WAXA 4WI1A 2DMRA 3RANA 1WVGA 4MMYB 2EQ5A 1G5PA 2HBQA 3H97A 1Y1PA 4OAPA 5BSMA 4BUCA 3PNOA 2V3WA 3OP4A 3ZJ4A 5M7EA 2BY4A 1L8QA 3ZQ4A 4GMGA 1OFHA 3IV6A 4EY7A 1O4WA 2DSNA 3CW9A 2ECFA 5ENVA 3EDQA 1ISRA 3DAFA 4BP8A 4HH0A 3RTBA 4F3RA 4ALMA 1ZCBA 4ZYXA 4TX1A 1IPHA 1VJTA 2Z9CA 5DGXA 4CWAA 3RRFA 3A6PC 4DADA 1N7IA 5K0GA 2RC5A 2GEDA 1SVSA 5EIOA 3NR2A 1TAQA 4EKNB 1J00A 3IDZA 5JVDA 5LDHA 1EFTA 1ST2A 3TLGA 4A0QA 4M7PA 3E5RA 4LWOA 3JZIA 1BA2A 4WNAB 2EF1A 2IC5A 2VHWA 1IULA 4UTXA 2DLCX 4OATA 3QPDA 1YXMA 4LK2A 1T3ZA 4LRQA 4ML3A 5KYXB 2XJ9A 4BO5A 4V0SA 2ONYA 3ZCQA 3AI1A 5LD2C 2PH5A 3TV1A 1SULA 3FDZA 4FQ8A 2WT4A 2H9AA 3EXFA 2NUTA 1ZEJA 1EP2B 1XAJA 1XALA 4IZ6A 5IKEA 4KI0A 2FXVA 1RLIA 3VJRA 4YQEA 3COPA 3GELA 2ANCA 4FSHA 1QFSA 2H92A 2X9LA 3N39C 4QA9A 4US2R 3FPKA 1FDSA 2B34A 2H57A 1YZGA 2JD0A 2Z95A 4TMKA 2CVHA 2OCAA 2VDWB 5HKBA 2IOHA 1DAMA 4UUOA 5FKJA 1HNNA 1N2ZA 1CNEA 3MAAC 4OQFA 1E2KA 3G2QA 3O9MA 4NPAA 3LY7A 2ZANA 5IH3A 3FOCA 1ZAKA 4AKEA 4WCFA 5CAEB 1CNFA 1CW2B 4BV8A 4CR8A 5KX5B 1V16B 2QE7A 3K1AA 3ZWVA 1E1NA 3AJ8A 3FETA 2OR3A 4NE9A 5IZCA 4KXYA 4E2ZA 3O1LA 4BASA 3JWGA 5KOJA 1NR1A 3L4EA 4GX0A 5EMHA 3LBIA 3VOBA 3AUTA 1RVDA 1L7PA 2QI9C 1E2MA 4WY8A 2H4HA 4E32A 3IIEA 1XPJA 5LYJB 5DVZA 1YHNA 1D4OA 1ZN9A 1KQOA 3L7LA 1KO1A 8LDHA 1JQ3A 3BMOB 5AJTA 2P4SA 5FUQA 3D0QA 2NZ2A 2Q62A 5FWNA 1E92A 4Y6LA 4NICA 1IBSA 2IPMA 1ORWA 3UHPA 1NX6A 4EYGA 1QRRA 4QQNA 5CT8A 3T9AA 5C51B 1QF7A 1E1RA 1C0LA 4J4TA 1P74A 4PVDA 3UYKA 2DH6A 1F60A 1NI3A 2R3SA 3DTNA 2BSQA 4WNIA 1NJSA 5MHTA 5A03A 1CNMA 4DUZB 1HH4A 1XHEA 4LYEA 4YREA 4K0RA 1T36A 1A96A 3L9WA 3QI7A 2IYVA 3Q5GA 1DGQA 3CPSA 2R6JA 4RX1A 1QDLB 3IUNA 5SV2A 2WUVA 1CUBA 4BB9A 3GLFA 2RJ3A 3ZWXA 5JROA 1FTQA 1XQ1A 1UEXC 2OGSA 3F3KA 3LSTA 8MHTA 1FXWF 3KEMA 2HHJA 3EFBA 2AT1A 3ORYA 1JBKA 3SYLA 3SJ7A 4K1XA 5T6BA 5FH9A 3BB3A 1I7MB 2VNKA 2Y27A 5JZOA 2QN2A 1P1BA 4XGQA 3TUJC 5HXAA 1NP3A 1N2CE 4W5JA 4FJ0A 5JCZA 4RE6A 3WJAA 2Q6OA 4OHBA 4JFRA 4WEQA 1XWWA 1YAHA 2RK6A 4OY3A 5B6JA 1NXTA 4BOYA 3ONWA 3CGGA 2D62A 4PQYA 3WA6A 3BUSA 4LHZA 3O2JA 3GJ3A 4IIEA 3FWPA 4DC0A 1A7JA 1YDGA 4G5SA 3LQQA 1P9OA 3MS4A 2PM8A 3R7AA 2V7BA 4F5DA 2YJ4A 2CHUA 4FOOA 5ALOA 4RTLA 4TXLA 3C70A 2IUTA 4HX5A 3CHYA 5KYYB 3A0UA 5F77A 3UJNA 3BT7A 3QG5A 4B6OA 2VT2A 1TLFA 1M54A 1XV5A 3I2FA 3PEVA 2J3DA 4IM7A 1K7XB 4BQOA 5HOQA 1H5NA 1KFBB 4Y2RA 2YDYA 4I99A 4CMKA 5TJHA 4KR3A 4AQ7A 4DG8A 3T4PA 2WYOA 1EBUA 1QH0A 2XUGA 4JNKA 3I2JA 4JLJA 4QPNA 5HF6A 4P36A 4M1QA 1JHUA 2LRHA 2WG0A 4OM8A 4QHYA 2G1JA 3AR4A 3IFSA 3FYHA 1W88A 5EIXA 4CODB 1Q11A 3BCRA 1MAHA 1FRVA 1SCDA 2LE0A 2JGLA 4D9FA 1NFQA 5EXSA 4MQEB 2ZE6A 3DNFA 1QYIA 4R3UC 2BKAA 9ATCA 1XTZA 4X00A 1MC5A 3SHVA 1OXTA 1WAMA 1YUMA 1Z25A 1LZLA 4DC9A 2X0JA 4PHHA 5CCDA 2WI8A 4W5QA 4KXNA 4Y3UA 3UAZA 1MW8X 1UBKS 2VEDA 4B82A 5EE1A 2C97A 1D7AA 2KM1A 5AH0A 1O58A 1TTPB 2VJNA 3P26A 4QUGA 1Q83A 3IOCA 4UU8A 3TSYA 4R16A 5BV7A 3SKVA 4NNOA 3LBYA 4UOZA 4Q3BA 1EH5A 3F6PA 2C29D 3BOSA 3RRXA 1P2FA 1GU1A 2GEVA 2C2HA 1TJ3A 3QYAA 4ZU3A 5FYQA 3ROFA 4YMVA 2QM7A 3NOXA 3UCXA 4GSYA 4ZTZB 2AFRA 5JD5A 5JS7A 2FP4A 2RHCA 1ZL2A 4EDFA 1IZ8A 4BXOB 1EIZA 2WWVD 1JDSA 4PHCA 3EXEB 4X44A 4FFBB 1V71A 3IEKA 2JGKA 1KSFX 1Q3TA 5DCLA 1JEYB 4RK0A 4X1IA 2MCFA 1C7ZA 4DCPA 3IB6A 3WLMA 1XF1A 3K32A 5G0VA 1Y5RA 4QUIA 2G9ZA 4IWXA 2ZXFA 3GZNA 2EWVA 1S8NA 3DYVA 1XRLA 5CUQA 2IH5A 4ZARA 3H9EO 2I29A 2A1UB 4FILA 4DIEA 1NVTA 2NU6B 1XN4A 3PB3A 4XLLA 1ESNA 3ITEA 1FU4A 1SCUB 1Z4KA 4I9NA 3NCHA 4HYTA 1PEYA 2IP1A 1JQDA 3K20A 1SBZA 2Q9UA 4ENQA 3OZUA 1KEZA 3IVCA 2PXHA 5G1NA 3UPDA 1UMKA 1U1IA 1U2QA 2F1RA 1Y5LA 3UAYA 1FX0A 5HUJA 1BGVA 1THTA 2CB0A 3F9CA 2J87A 4H7PA 2V7QA 2RKBA 3OZEA 5IVDA 1CDEA 3CQ9A 1ORDA 2G83A 4A03A 3SXUA 3D0OA 4XOIA 5E9QA 1KFKB 4IRXA 4JCOA 3K0HA 4CM8A 2JG3A 4D0LB 1DEOA 1PJ2A 3V8MA 2D3WA 3O4GA 3QOYA 3PQ4A 1WCV1 1T9KA 3ES9A 4RM2A 4KQMA 3KHSA 2V7UA 2YWCA 1KH2A 2YIDA 2QMYA 3PVSA 2ZS8A 1X0VA 2ATVA 1TYZA 4QDKA 3U9TA 4DARA 3PR3A 4FXOA 2YWFA 3PLAE 1XC7A 5FBRB 4D0RA 3IBGA 4Q1CA 3IHWA 4D9EA 4YK7A 5GONA 1ID1A 2PANA 3MPUA 5CH5A 1SGWA 2B8JA 3VNAA 2PMFA 2O50A 1T5HX 3JAKA 4HX9A 2JFOA 1I0ZA 1QC5B 4MB2A 4YRRA 4MDEA 4XVHA 2IHZA 3OTWA 1YMUA 4D82A 1TM1E 2VNAA 2YFHA 4K9RA 1V8BA 3I2IA 4M7WA 3OM1A 4KP7A 3I6MA 2OECA 1IJKA 2YV1A 2A1TR 3STXA 1CRLA 1WNFA 1BWSA 4KXFB 4DLWA 1SPXA 3JQ9A 4MQFB 4OLJA 3G9QA 4MAFA 1KYIA 2ZUDA 3A31A 4F2HA 5GINE 3VYRB 4I9FA 3VR3A 4AP9A 4O63O 4KXXA 1DQYA 4EA7A 5JZ9A 3F90A 1FQOA 2J5RA 1R5BA 1O97C 3ABZA 3V4ZA 1RLUA 2H1CA 5TVGA 1DHTA 1RQGA 1UKBA 3DV0A 3LFTA 4FYWA 4OI2A 5E6RA 4ZVTA 1ZD5A 3LQKA 3QXJA 4ZHQA 4CL2A 1DQPA 2UAGA 2FGKA 3MJFA 4KZKA 3ONDA 1DFIA 4D0SA 2HA0A 4OHWA 4KR9A 2B78A 3ZX5A 4LJ6A 3CS3A 2CKDA 3HI6A 4HGRA 4D4HA 2DWOA 2GHQA 3LFUA 5A0FA 4EFMA 3A58B 2GYUA 2AYXA 3ESXA 3PKJA 1ZIDA 4CMGA 3FMVA 4UE2A 4ZJZA 4DLRA 3IYLW 2BYTA 3EXG2 5FHRA 2GEKA 1E0AA 2W6MA 2V7EA 4M9QA 4YCJA 3BDVA 1M67A 2OC4A 1TUIA 1PQ4A 2NYAA 3B85A 4Z3KA 2DB3A 1Q2XA 3LLMA 3MFYA 3MJTA 4XIGS 5BPFA 3MJCA 3AB7A 1IAVA 3LP8A 3C3BA 3JASA 4H4CA 3RV3A 4B6SA 3CXUA 1G19A 3PNMA 1EFCA 2C2ZA 3DZDA 3FKSD 1U98A 2HRDA 3MRVA 4N5IX 1JT2A 4F8JA 5BN3B 4J16C 2ZTHA 2OZEA 1PYOA 5TPWA 3O91A 4FX5A 3TW6A 3UKDA 4I4CA 4WEOA 3HKDB 2QRQA 1GADO 1PG0A 2VTEA 4IQFA 3ITDA 3CUUA 1FP4A 1UXIA 1PVDA 4B74A 1Z2CA 4JEIA 1UEJA 3RK0A 3VR5H 3ZW9A 4AN4A 2N47A 4G23A 1KKMA 3VX4A 5KYUA 3UK6A 4FS8A 4IYRA 3O4IA 4O1IA 4G81A 5BUZA 1SHTX 4E11A 1XXHA 1TM3E 3PWKA 3V97A 1GZDA 3MS2A 4RQAA 3C5HA 3RVKA 3EBPA 1USWA 4DIUA 1QTNA 1Y4ZA 3DF9A 4L4RA 5BYKA 1Q5PA 4INAA 3CF6R 2RK3A 3UJHA 2GUWA 1N5LA 3C1TA 1OF1A 3MC1A 1UBUS 3RASA 5C7IO 3LHSA 5F12A 1PI3A 4H3SA 3GA7A 2O4CA 5G0WA 1L3CA 2CE2X 3FR8A 4QQRA 1UPUA 1HSZA 4OX9Y 1DAOA 1YCHA 4UBLA 1FK8A 3ED5A 3LW8A 5EE5B 1ZW6A 3U7FB 1L5FA 4AULA 4XH9B 3WK8A 4X91A 1NXPA 5C5EA 3GVPA 3K6KA 4F92B 5KCZA 5FPPA 2VWHA 2RCNA 2FOLA 2RH5A 1H93A 3OQIA 3EQ9A 1PDOA 5DCYA 4EI7A 1KZ1A 4OM7A 5JDCA 2WWXA 3CUTA 1YC2A 1H3FA 5C1IA 1ZOLA 2FA9A 1ADYA 1QG4A 4S0XA 1WBBA 3TW3A 1TF2A 1X70A 3O31A 2DWCA 1SQ0A 2QVBA 1BWQA 2WJJA 3CRVA 4ZO8A 1V9LA 3KTAA 3QE9Y 3ZJXA 2XQKA 4X20B 4AMUA 5JAUA 1FSZA 3PX3A 4OPMA 3TLAA 4MGEA 2HTEA 4Z99A 3AOEA 5EMKA 2GCPA 1NPDA 1FFXA 3OU6A 4H0CA 4UU1A 4DJAA 3VXKA 1KZ6A 4NCAA 4ZEMA 1F6DA 1Z6AA 1M34E 1JBQA 1RHRA 1SELA 1T6YA 4L85A 2EZTA 1JAHA 2CK3D 3E9QA 5B55A 2V7VA 3NHMA 1BSVA 1IVNA 1KO7A 1U3CA 3ECSA 4PAQA 2PKRA 2RI6A 5KTKA 5GZ1A 1RMYA 2JFNA 2IY7A 3VV2A 1V9CA 3ZHOA 2NYRA 1I6MA 4ND3A 4PYLA 3ZVKA 2JFBA 1X15A 1NPTO 1IIBA 4HUTA 2YC4C 2L82A 1YJ5A 5K05A 1WUYA 5B1DA 2EP5A 4AN1A 4G36A 3U0VA 5K03A 2WB2A 1UC4B 4BNFA 2KS6A 1W0KD 1ZD3A 1VLQA 4QBFA 5FCDA 3GNTA 1ORIA 4MWEA 4NDZA 4X9XA 4DYHA 2VTDA 4K0KB 3LT4A 1A8QA 1KOJA 2ZRPA 1ZN8A 3CR3C 3K5HA 4F1KA 2QAGA 3DT9A 1NVFA 3FDJA 2Y67A 3OUZA 4EZEA 3COWA 4FS3A 5E4FA 4ZCTA 3CXRA 4BVAA 4Z53A 5ADUS 1JWAB 1RXIA 3F6YA 3ULKA 4M9UA 3HABA 4TYNA 2F3PA 3FMPB 3IBSA 4ESEA 2ZB7A 4OQLA 4BAGA 1H2RS 1EQ2A 1YR3A 3CRQA 3L6RA 3Q3VA 4AF6A 1SU8A 2IW3A 3AWDA 1T3SA 3E9ZA 4IFIA 5K45A 2OCPA 5LOVF 4P34A 3CYFA 2WDZA 5A2QA 2QIPA 1IEWA 5DEOA 3UM9A 5JALA 4AECA 3IHLA 1U8FO 3K4HA 4BFUA 4AJEA 1E4OA 2I54A 2R4TA 2V8OA 2WZDA 1NVEA 1CDZA 2DY1A 4RKEA 3GHYA 3NTRA 1SVWA 3LG2A 2C58A 4L28A 3F74A 4PSKA 4RYLA 5JPIA 3CLVA 4OD0A 3CMCO 3BVPA 4R1TA 1P2DA 2O23A 4XJVA 1KVTA 2GK3A 2BVNA 1YS2X 2Z2ZA 2JLZA 1BHJA 2GETA 3MTGA 4MW5A 5ESRA 4H6VA 3PITA 4ZAWA 3WBJA 4DM4A 4NCJA 4DY6A 1NLYA 4IICA 1CHDA 2QP3A 4A2PA 4F4DA 4FFLA 4LRWA 1H2ZA 2XH8A 3INYA 1JLKA 4WZBE 4Q16A 4E2YA 4CL8A 4GDFA 3CJRA 1CUHA 2RHJA 1V1RA 2HU2A 2GZHA 3C6QA 3HCOA 1U9ZA 2JANA 1FA9A 3HCBA 3IP9A 3ITNA 1LRLA 2POCA 4DAEA 1AS3A 1TADA 1TGYA 2XECA 3KVOA 3KR1A 1DBWA 1QAMA 3E0XA 4K9QA 4LIPD 5T67A 1J0DA 1NUHA 2CMKA 1Y48E 1GQYA 1H6DA 1UEIA 3BTOA 5KJCA 1L4MA 2ZZKA 1BN7A 1LZKA 5LVAA 3WL4A 1PNTA 4INPA 1JIXA 1D9XA 4X6LA 3OF3A 3BKWA 3JQ7B 3GEIA 3PG5A 4FEYA 4JQOA 3NRBA 4Y2QA 3T4EA 4X85A 2FLKA 2HA5A 3L8HA 3EPBB 4BQQA 1QH8B 4TMFA 4UE3S 4DRXA 2WM8A 2HBZA 4Q5IA 5DN6D 4AF7A 5BVHA 4K6MA 3VSEA 2PLFA 3DE1X 4B2PA 1GUAA 4MI3A 2ZQZA 1CUWA 3BTUA 3PSAA 3VHXA 1VYTA 1N5JA 2FVXA 3LIPA 3L18A 4IGKA 1VYHA 4JJEA 2OVBA 5IVIA 5C32A 2VC2B 4R2MA 1N2GA 1Z2NX 2MSDB 4G5XA 1MV5A 3D4LA 2H3HA 1P44A 4CMEA 3H8SA 4AM8A 5CM9C 1Q15A 2RG7A 4KN5A 2TRSB 4QOSA 2FPMA 3O7WA 4GVPA 5CH8A 1EK1A 4RHEA 4BTEA 3WOHA 3FHLA 3EY4A 4IGIA 4Q3CA 3A1CA 4J43A 3EIWA 2YWJA 3MJHA 1U90A 2VSYA 1R4NA 3MWGA 3MOIA 1HQCA 2M98A 4KIJA 4LJ5A 3SF8B 1MB4A 4BFSA 1LPSA 4XYLA 6PFKA 3DTYA 3IVGA 1ZX1A 3D6TB 1L5KA 2O1WA 1OROA 4BIMA 1S0UA 1HL7A 1G66A 2ZWIA 2QL5A 4BHTA 4WAUA 2AJCA 3Q7PA 5K8JB 4UHJA 2VS1A 1Y9AA 5CVTA 4N9WA 2QAJA 1OVGA 2IVFA 2IOFA 2MINB 3D9QX 4Z6KA 3DMPA 5LNK1 1RYYA 3NUQA 2FZEA 2E87A 3OKPA 5AVQA 1YZ3A 2IU3A 3I01M 2BR4A 2Q6IA 3KYJB 4IHKA 4MV4A 3IBCA 2H1IA 4UMFA 5EI5A 2M6SA 2PA3A 1Q7TA 3MWEA 1P4AA 1QHYA 1MLDA 4M6WA 4PO3X 4RVDA 1J2UA 3PFWO 1JR4A 2XIJA 1U8EA 3KV3O 2Y4OA 1SOMA 3LF2A 5C2JB 4QELA 3EUAA 2IZ5A 2R96A 2X4GA 3K09C 4AK1A 4M1MA 4X8LA 3BGVA 1HDXA 3DE5X 3HK2A 1KU6A 4QU5A 4TL8A 2PL9A 1Z5ZA 3A27A 2HU7A 5JISA 3IJEB 2VQFB 1C9EA 1TIPA 1U7ZA 1TO6A 4WA7A 3V4PB 4M9CA 4JQYA 4TKUA 4B33A 3RWBA 1QX4A 2YS6A 3CEMA 3FHJA 1BKDR 1HMPA 2AWNA 5CLHA 3U39A 8AT1A 5IM4F 1OW3B 2GTIA 1GCIA 4EHKA 2V0NA 3ME5A 2IYQA 3V42A 1B26A 3U3DA 2B1QA 3KPJA 4LKOA 3TH5A 3VM6A 4N03A 2NSLA 3D4OA 4R8SA 4BZQA 1RIIA 2PX0A 2Z5VA 3O1HB 2JCBA 1EM8A 4RVOA 4XGRA 4B9AA 2IZZA 2G71A 1YB6A 3E84A 1AUQA 2RB4A 1E4EB 1QRTA 4QODA 2Q6LA 1B0AA 1D1PA 2FKAA 4IVPA 5BSVA 3DO5A 1VLVA 2NN3C 1E96A 2E4UA 2NPOA 3L8YA 3AIKA 3NHAA 3R44A 4RHTA 1ADGA 1QJ4A 1WM1A 3TBFA 2AXEA 4LVCA 3D6VA 3ZV5A 2OCGA 4DBZA 5A04A 3BHNA 4HH3C 3F7OA 3KYBA 5BQ3A 3UAVA 3ONNA 5CMLA 1I72B 1KFJB 1XMOB 1RM4A 4Z1MD 3UW3A 2X42A 3ND5A 2RHBA 2O8CB 2P1DA 1JEJA 4M8SA 2WWFA 3FTFA 2Q8PA 4P7KA 4OQMA 1CY8A 1GR1A 3BFJA 1P19A 1U2GC 3Q1KA 3R2JA 1C29B 2J0UA 5HM8A 1TTTA 2Q9CA 2WHPB 3KT3A 3UH1A 4AUNA 1Y8QA 3ACDA 3NAQA 1QVWA 2ZWMA 2HYDA 3KDSE 3OZCA 4QTZA 1UMDB 4UZFA 2M6LA 5IBQA 1HTBA 3BL5A 3WGMA 1CETA 1JIJA 3KVRA 1G6KA 4HAVA 4HAIA 2N1MA 4X7BA 5E6SB 1O08A 4FE7A 3U62A 1IZZA 3E2PA 3VR5A 4TWAA 3EWIA 2QMUA 2H63A 1X94A 4A8TA 3ZWMA 4TUYB 3RTEA 3GLIB 4YO8A 5REQA 4GICA 4BGUA 1EJ6A 2BGUA 2WG2A 4MWGA 1XYGA 4ZVRA 1I5RA 4HPXB 2XMSA 4QBIA 4N8DA 4QXPA 2Q45A 3TLCA 1DP4A 4BO4A 1T4DA 1QE3A 4P9NA 3TG2A 3EARA 3H75A 1NU6A 4U00A 3GRZA 5EZSA 3WTBA 4P0QB 2Q3FA 3KTDA 4N5MA 3PFCA 4KLCA 3UWOA 3FCYA 3NHPA 1BX3A 5K99A 3B6EA 1T4CB 2W2VA 2A5JA 3L7MA 1TKBA 5EE9A 1PHPA 1F6BA 2YZGA 1DDIA 2IYTA 2CF6A 1YS9A 4GLJA 2Z6AA 1ZI8A 3JWJA 3KJGA 4G4SO 5FOQA 3NNSA 4E3WA 5JRDS 2ZJ3A 3WLTA 4E4TA 2ERYA 4GOND 1P2GA 4OHVA 4RPJA 5B58C 3FBTA 3K9LA 4PAMA 4EI2A 5L6MB 1J5EB 1P7PA 4KGZA 4KN9S 1DLIA 1JHZA 4OQDA 4G56A 3OUUA 4RY9A 3C6BA 5D01A 4KBFA 3T7KA 1WF6A 2IUEA 1DO8A 3U4MA 4CTJA 3GXBA 4OGFA 1QOQB 1TRHA 2VUHB 2AMJA 3CF4A 4E5UA 3L79A 4N0DA 2IWHA 1YVUA 3OTHA 4EB6B 3DMFA 2W42A 2G9QA 3LKZA 5G40A 4L0QA 4DV3B 3PD7A 1DAFA 4MZDA 1RC0A 3COJA 2QQEA 3TJZA 3NDRA 1MF7A 1KJ8A 1LW7A 2BEVA 4J0JA 3LCVB 4UFOA 2GERA 1OPRA 5HZMA 4ERNA 4IGEA 1D1TA 3HKBA 4J9VA 4QDJA 1V5WA 2FEOA 3TR0A 3HEMA 1NURA 2FWRA 1GIAA 1H85A 4NBRA 3UO8B 2PV7A 4C0HA 4YMGA 1P6UA 1X7XB 2JFGA 1XAHA 3KWLA 2XF8A 4O4HF 2WM2A 3ELUA 3I3SR 1QP4A 4EHNA 5FAXA 1ML4A 2IOYA 1I4OA 1GU7A 2MIIA 5JWHA 4ZT2A 2PXCA 3A4VA 1JHMA 1BEZA 1M1ZA 1KIAA 3GBPA 1DJNA 4J7CA 3B5JA 4OJMX 4G1FA 3SJAA 2YV3A 2HMVA 2Q3HA 2YASA 3GCXA 5I51A 5K7SA 5KDDA 2CY0A 1OIWA 2QMHA 2QX6A 1MR3F 3CEHA 5KKCA 2FWPA 5JQWA 4C20A 2C4NA 2OB2A 2OFPA 3U60B 1LX7A 4RF5A 3ZE9A 1CQWA 1B43A 3DBHB 3VR4D 4DTCA 1WKVA 4ZQBA 3HY3A 3AETB 4B73A 1KBQA 4G63A 5LZ9A 1GTJ1 2D00A 1ZGJA 5HFNA 3SR0A 2WAYA 3I5AA 4B84A 2DTDA 3QX9A 1VPEA 1AZTA 4EZBA 3EW7A 1N8NA 2WE8A 3AGQA 4XGIA 4XWTA 2QW8A 4O4LB 4NK5A 1QK5A 2WJ4A 4OJKA 1YJ8A 4G41A 1ZAYA 1GPMA 3WK5A 2H9YA 2EG9A 5G4KB 2BGNA 2JI8A 3DVAB 3I12A 2GM9A 1N5MA 4KQKA 4MUNA 2FFQA 4MQUA 1OFGA 4OMUA 5K3SA 4YUXA 1N5OX 2XUKA 1H94A 3IAEA 1GLNA 1Z75A 1ZGAA 2QLJA 1ELOA 4G0MA 3HKEA 4Y8VA 3VDQA 3WB1A 5JAIA 3T52A 1Z0AA 3TOVA 1KI1A 3AP3A 3LJKA 5TGZA 1G8FA 1Z6GA 1RE1A 3GWZA 4FYXA 1SQGA 1HYBA 4A8JC 3EQ6A 1OASA 1XMJA 1ZDMA 3A6ZA 4GMXA 5LBIA 4XUEA 4LFBB 4RF4A 5FA8A 2Y93A 2WKPA 5KYXA 1EBFA 1TQ8A 2GB4A 4U5QA 5CGZA 3V8VA 3R0IA 5A9RA 2ZRHA 1IBLB 2LGJA 2KLBA 4GUAA 1YL5A 3PGMA 2Q2OA 2DFTA 5KOIA 2G5TA 2F3TA 4CI0B 4DMHA 2QZZA 4HXEB 4CM6A 1NVVR 1REQB 4M9ZA 2ZCJA 4Q3AA 3N8HA 5DNUA 1C9JA 4GM4A 3NV9A 4HSEA 3ESQA 3D3NA 4UVIA 2M6KA 2VDWA 1AM4D 1PNRA 2R1VB 1SEPA 1T2NA 3AFHA 3G17A 4RC9A 3F5QA 4ZI7F 1MGOA 3PRHA 3WK4A 3K0FB 3K31A 2Z3VA 4AROA 5ETJA 1P39A 2AOVA 1KR5A 3WMGA 3S5JA 1OQAA 3EN0A 5EJAA 1QWSA 2X8AA 3HXQA 4ZT3A 5GTDA 3NEJA 3AVPA 3G82C 1DT5A 4Y2SA 3T5MA 2ZPAA 4HDAA 2A4KA 1TFUA 3LPMA 3QE3A 5LP1A 10MHA 2ECPA 1D2HA 4AU1A 1HE4A 4KE8A 2UV8A 5JHHB 5A4FS 3MJEA 2J9FB 3LCRA 5LYJA 5FWYB 3VSCA 2X5NA 3LWZA 2EGGA 3BMOA 4PSAA 4BNJA 3BA1A 1H4SA 2UVQA 4QYIB 1KJJA 3R76A 4D8VA 1NQXA 2P3SA 2JAUA 2V9CA 3LLUA 7ADHA 5CXXA 1I5EA 1WV0A 3A4NA 4GI7A 3KE8A 3PVCA 1M8FA 3GLSA 4P92A 1XCLA 4TRMA 4YAIA 3OQMA 4YRGA 2JCXA 1U1DA 5FWDA 3T15A 3K8ZA 2REXB 4MKRA 1O6ZA 3GEEA 3UK1A 1TQ4A 3B1KA 5A5VA 3L84A 2EJVA 4XYMA 2C2XA 1VE9A 1DPFA 3ZVLA 4C3OB 1OZFA 5T4FA 2W83A 3IIIA 4PPYA 3REOA 4OH1A 2QX4A 1CUZA 1S3GA 2ZRBA 3DR3A 4JXZA 1TIBA 5FTJA 2H29A 3B3GA 3LIIA 3R5JA 1DAPA 3WVNA 1RCUA 2IPLA 4JLWA 2B9VA 3QEAZ 3ZG6A 2BZ1A 4CG3A 1U8ZA 4GXNA 4M0CA 1E5TA 2R6AA 4UPVA 1UXGA 1A1VA 1JIUA 3AEKB 4Z5XA 2GNAA 2ZRIA 4YGXB 1Z0KA 2AI3A 3L8CA 1DKNA 2D4HA 4L74A 1FU8A 4W9MC 3D4BA 4RPGA 1GAQA 5KDOA 1M2HA 4P32A 4A9AA 2BF4A 4L8LA 2ZUSA 1DBVO 3BSFA 5KO2A 1W4ZA 2QPAA 3H8VA 2WPDD 5A6VA 3JVIA 4YBRA 1DUSA 2QTRA 5JIBA 2YJ3A 3LUPA 3OEHA 5KYYA 1TXGA 3S8EA 3DO6A 3GLIE 2YQZA 1VP9A 2L0XA 5IW8A 3U56A 4FGWA 2X0NA 1JR3D 3AG6A 5GGXA 1K3TA 4EVIA 3O93A 4TXHA 5J3JA 1T9HA 3SSOA 3TDKA 1C1DB 1I6WA 4GP6A 1JAYA 3BILA 3MTEA 4KHZA 2COEA 2C99A 3CKYA 5AUPB 3ZD7A 3WYAA 3IQHX 2CBGA 3E8MA 5A7GA 3JQAD 3PC8C 3AW9A 4I1UA 5C8XA 2HGSA 2NXWA 5FPSA 4MUBA 4FCWA 4FUTA 3RAGA 1R6BX 4C1BA 1FUEA 3GX1A 4D4GA 3MWLA 1BVRA 1O8CA 1SC9A 1WQ4A 3BGWA 4MQEA 1AKMA 2YICA 1PZHA 3KSAC 2QX7A 2YWXA 4D4IA 5F76A 3LGXA 5M6DA 4ZC8A 2F8LA 2YY7A 1X1QA 4O2LA 2X5KO 2EJWA 4CV3A 1CQJB 3FOEC 2DJ5A 2GNPA 4F4FA 5M29A 4KGXA 1VDMA 3E3LA 4WK6A 2AXNA 2PMDA 5FEMA 5KHOC 4EBFA 1L8XA 4KYIB 4YUVA 1JTFA 5F2KA 4EFKA 1BE0A 4KPFC 1Y81A 4B2YA 5JZVA 3UJ8A 3OM8A 4RZIA 4MS1B 3D5EA 3OLXA 1T6XA 1T8RA 3I6ZA 4UDYX 2IYXA 2F64A 4BXOA 1UMBB 2R84A 4BWVA 3U5ZB 3EXEA 1EUZA 5EGNA 4GKVA 3D3WB 4IMIB 3GNQA 1JEYA 2X76A 3D54D 5EGSA 2ZIXB 2P9EA 3WWOA 4BNUA 4HMQA 3U3RA 4JX9A 4LDRA 5KJ1A 4S3MA 3TLBA 4CJXA 1OAAA 2CL5A 5JI3E 1U2DC 3FTQA 2QG9A 2DHRA 4L57A 4PFSA 2DHCA 2PS0A 5H68A 2ANBA 5HRUA 3D8RA 1PWHA 4IQ8A 1FYWA 1R18A 3LCUA 3JYNA 4Y2VA 3SQNA 4RCZA 2Q3EA 3O8OB 1Q1BA 1VL2A 2C88A 4NF2A 3TG8A 3H4IA 3ZJTA 3FF4A 1PQWA 4Q7JB 1SCUA 2WF6A 2AMLA 3DLTA 3LT1A 2G9VA 2R00A 1OT3A 2XDAA 3E81A 1HE3A 2ATIA 3C4QA 3WR5A 4HAXA 3GEDA 1KMMA 2D5BA 3QHAA 1C3LA 1DG3A 2ZIGA 5DHUA 4MVWA 4LVOA 2IS4A 1MB2A 1VL0A 4GKBA 2C1XA 2FPPB 2CBXA 3BWCA 3ICPA 1P7ZA 2Z8ZA 1G3MA 4UPEA 2CFTA 5BRAA 1GA1A 3L3BA 4N0MA 3IPXA 4HTFA 2NXJA 3OLWA 4NENB 4U2CA 1E20A 4CLRB 3QWBA 1KI4A 5CLFA 1RPTA 1Y6JA 1NC1A 2IZ7A 2WJYA 1ARZA 3NTXA 3WV5A 2ZYSA 4FGSA 4TMXA 4YRLA 4MV1A 4QATA 2XMBA 4FN5A 1E3LA 4GKAA 5G0TA 2HLNA 5GJWC 1K8QA 4IO1A 3ZK9A 1E3EA 5JBIA 3STWA 3PGLA 4NEGA 2XVXA 4WGFA 1H1LB 5HFAA 1IQUA 2ONKA 1NVDA 3ZS9A 2POQX 2P2ZA 4LZZA 3IIJA 4X8OA 4RK6A 1H66A 3G2PA 3M4NA 4DV0B 1C81A 1DELA 3GJ5A 1V9SA 1QC5A 3V7YA 1G3QA 5FOSA 3WYFA 5E9AA 2WHEA 3FPBA 3P9IA 2VUTA 4NI5A 1KKUA 2PAFA 4I1PA 3ZUGA 5DHSA 3HMQA 1NN3A 4B4WA 4GYKA 5TQVA 4CQLB 3DZ8A 2H5JA 4MQFA 3W5UA 3KUUA 3U37A 1M83A 3QU5A 1FLAA 5K4AA 5TV2A 4W1QA 5A71A 1DJQA 1GAXA 2AXQA 4QVIA 2R2GA 1P4RA 2PSJA 3UNXA 2FPIB 2HCTA 2ZJ1A 3WRXC 4F4HA 5JCJD 2KLHA 1UQUA 2G17A 4J76A 3FTEA 3FFTA 4KR6A 3LECA 1DJLA 1WXDA 4EBBA 3TGPA 3RTCA 1XU9A 1BJRE 4EOGA 1EM6A 4DCVA 1MO4A 3PUXA 2AKAB 5DIZA 4ZYTA 2G88A 4OXQA 1UJMA 1B1CA 4CZ2A 2R86A 4ZO7A 2I2AA 5HJ5A 5H8WA 4ZRNA 3SX0A 1YRWA 1BX1A 1L7QA 4N5LA 3HU5A 1XEWX 5T4HA 4BMNA 1GV0A 3BXFA 4KBGA 4UMEA 4WY5A 1JXOA 1X92A 1MAVA 9LDTA 2HU5A 1XTKA 1P3DA 2QW0X 4HO1X 3VX3A 4ASUA 3B48A 4CRWB 3GPLA 4OQ4A 2EFJA 2IUYA 4G2TA 1QIJA 4HDRB 2R5WA 3X1YA 1HTWA 1XTSA 2WIJA 4WECA 4M54A 1GHTA 1A69A 1AG9A 4XDGA 1IRXA 2M1ZA 2ZCVA 3AILA 9ABPA 3E27A 4I9HA 5DNYB 1SBYA 2QEQA 5A5DA 4RDHA 3IXQA 5JRJA 1OWPA