3E6AA

Crystal structure and functional analysis of glyceraldehyde-3-phosphate dehydrogenase from oryza sativa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
334
Chain Sequence
KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
publication title Crystal structure and Functional Analysis of Glyceraldehyde-3-phosphate Dehydrogenase from Oryza Sativa
rcsb
source organism Oryza sativa japonica group
molecule tags Oxidoreductase
total genus 84
structure length 334
sequence length 334
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3e6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e6aA01
2B5VA 4R1TA 1ZJZA 5TSDA 4WLFA 4YAJA 1ULUA 1GUYA 2W98A 2CF5A 5H83A 1GZ3A 3ZWOA 4DQXA 3F47A 5JYDA 2ZATA 4D0SA 3QSGA 4WPGA 1IE3A 3GEMA 4YACA 1BXGB 4OM8A 3H2ZA 3VH3A 1W0CA 3OP4A 3PFWO 4QXMA 1YL5A 1EDZA 2NU7A 4ESOA 4ZQFA 3DZKA 4CV0A 4OSPA 1X0XA 1DPGA 1JAYA 5DDIP 3N74A 1PQPA 5ER6A 3TDKA 4ONEA 1WW8A 4XGKA 4OXNA 2EWMA 5JLAA 1DIRA 3GY0A 1X15A 2A35A 3TRIA 5DF1A 4UUOA 4OGWA 1ENYA 3STHA 1NR7A 1NAIA 1ZUD1 2CVOA 3L07A 4YPOA 4NHEA 4YQZA 1SEVA 4BO6A 2YYYA 4OXKA 3ZWWA 2B36A 3H3FA 3P5SA 4RQTA 4WE3A 1ZCJA 1NVMB 3H9QA 3BMCB 1GEGA 4E13A 1P9LA 2GF2A 3FSRA 3AOEC 3NTRA 2C29D 2AMFA 1PJSA 3M2TA 4HFRA 2VN8A 4FGWA 5IZCA 1NR1A 3KLMX 3K6JA 4LISA 4E5NA 1YS4A 2QZ9A 1IOLA 2Y0EA 1WP4A 1FXSA 5B4UA 3COSA 1VKNA 1H94A 4P38A 4QO7A 4DC1A 4AJJA 2PV7A 4HUJA 3ZW9A 2BI8A 5KKCA 1F14A 3OMLA 3HADA 3DZIA 3K96A 2I3AA 1YJ8A 5GZ6A 2E49A 4KMSA 4H15A 4S1VA 4OO3A 4FFRA 4R51A 1HLPA 4HXYA 3IP3A 1NVGA 3V2HA 3C8MA 2Q3EA 3V8BA 1UXHA 2DT5A 3HHPA 5AQ1A 1DFIA 1Y9AA 3OECA 4JIGA 1GZ6A 2YY7A 4E30A 1SB9A 1HXHA 5L3ZA 4E2ZA 1N9GA 1KOLA 5C7LO 3B20A 4RPHA 2NADA 4PZEA 1ZSNA 5TRTA 4A26A 3H65A 4XIJA 3KSDO 2CNBA 4H3VA 1VPDA 4MPDA 2P9EA 2GERA 2DU8A 3GRPA 4XGIA 2GLXA 1TA4A 4R3NA 4RORA 5IN4A 2GNAA 1YRLA 4CMCA 2VRCD 2Q99A 3PLNA 4BUCA 3LLSA 3F9IA 2NSDA 4MVJD 4JBGA 2X23A 3D1LA 5DZSA 3S1LA 3U4HA 3F46A 1PEDA 1UXGA 2FPGA 3KLPX 2QRLA 5EMHA 3BA1A 1XLTA 2DPGA 5JAIA 4PCVA 5LDGA 2CDBA 5K6AC 1FJHA 4WCFC 1HDZA 3AM5A 3JQ8A 2RH4A 2YFQA 1I10A 4E2XA 4DPMA 3CMMA 1U8XX 5L7WA 3SVTA 1PGNA 5A9RA 3JQAA 2DTEA 4GWGA 1QV7A 3KYDA 1DIGA 2X9VA 5TC4A 1YL6A 4LGVA 2VOEA 2OFPA 2B83A 4E32A 4ZICA 3SJ7A 3DTTA 4B3IA 3NGXA 1N7GA 4MKZA 1R37A 4L4XA 1ISMA 3MOGA 3X2FA 3ZWYA 5DN9A 1HYHA 1QSGA 4RGBA 4DQUA 3GFGA 3KV3O 2JHGA 1KY5A 1UDCA 5AXBA 5L53A 1E3EA 1DC5A 5BSHA 4CM8A 2EKQA 1P44A 4OSOA 3KOUA 3S2FA 1E5QA 3M1LA 5F1OA 5A06A 3HDJA 5CFZA 3OSUA 1W4ZA 2ZTLA 4PLZA 4YJGB 1T26A 1P31A 5KJCA 1Y6JA 4WLVA 4GMGA 1R66A 3A28A 1Q0QA 4CMBA 1MC4A 4ROSA 3A1NA 4BO0A 2IXBA 2GUGA 4FFPA 2VOJA 3NUGA 3TZQA 4IUYA 5CG1A 3RD5A 4DYVA 4FBGA 2F00A 2CSUA 4RPLA 4MIYA 4FFOA 1OC4A 1DC3A 1KC1A 4YT4A 3ZWAA 4BNXA 2EG9A 3RC2A 1H6BA 4CM9D 3WWZA 2VTEA 5DCUA 3P7MA 4BGIA 5IFLA 3GOHA 3Q2IA 2ZCVA 3GVHA 2ZB7A 3LT1A 4I8XA 1HKUA 4R01A 3LC2O 5JY1A 3GN1A 3SC6A 3ZHYA 4ZGWA 1Z82A 5BNIA 3K8ZA 1A7AA 4RF3A 2Y67A 3UW3A 4JX8A 4ND1A 2YQ4A 1PGOA 1PGJA 1EUZA 4AFNA 2GYYA 4ZHSA 3PFFA 2ZYAA 4DVJA 3ZN2A 1O8CA 4J1SA 3GNTA 2FR1A 4W9NA 4A0SA 2CMDA 5I7VA 4HKTA 4JBHA 4XQGA 1Q0LA 3BMOA 1XELA 4IGEA 4CMHA 1LSJA 1H93A 4ND2A 3AM4A 3DBVO 4ZN6A 1W8DA 4GQAA 4EEZA 4BNFA 4QUKA 1F17A 2Y1GA 1I2ZA 3V1YA 3WGYA 1NFQA 3DFZA 3JQFA 3VZPA 4ALLA 3JV7A 3JYOA 3GDGA 1EVZA 1ZMTA 3HN2A 4GL4A 4PG8A 1N2SA 1R12A 3H4VA 5U1PA 1E7YA 1C0LA 4Z9XA 3F1KA 4ZQHA 5L40A 1NWCA 1E6WA 2HK8A 3TL3A 3F5QA 3CINA 2ZIZA 2YV3A 4J16A 2DQ4A 4PLTA 4B7CA 2P4HX 1QYVA 5EERA 3CE6A 4LVUA 3INGA 3RFTA 3AU9A 1E0DA 1PGPA 3EHEA 4GGPA 4E31A 1GFSA 1XG5A 3VPHA 4FR5A 1R4NB 2X8LA 4WGGA 3VH2A 1DRWA 3GAFA 1QYWA 1LU9A 1U2GA 4IGFA 3ANMA 3GHHA 2YV2A 3ABIA 4XQCA 4U8GA 5G4KA 1UAYA 2ZQYA 4BNJA 1EUDA 4NU6A 3OQ1A 3FCOA 1BDMA 3BMQA 1DIHA 1YGYA 4ALKA 4CM3A 2AG8A 4ZQEA 2VZ0A 1LRKA 2OOSA 3FPCA 3PK0A 3GA0A 1KYQA 1NPDA 4E2WA 5TT1A 4BB5A 4Q9NA 4TRJA 4CQLB 1ZK1A 1V3UA 1BSVA 2VZ8A 4GAEA 1KEVA 5GZ1A 1OI7A 4XKJA 1AUPA 1R0SA 4OQZA 5J23A 5EQDA 5JC8A 2PLAA 1KY4A 4NQZA 4CR6A 4DL9A 3RQSA 4ZQBA 1XYGA 4XB1A 4IDCA 1U7HA 2NACA 4BMNA 4NG5A 1NTOA 1U3UA 1MXHA 3W4KA 2DBRA 3NJ8A 5KKAA 2NU6A 2FR0A 2B4QA 1P45A 4GX1A 4OL9A 3JYPA 2EJVA 4MIOA 2HKIA 1Z45A 4F46A 1BXGA 2OORA 2ZB4A 1EVJA 4K1LA 4HBGA 4IJVA 3LLVA 2EGGA 3WQSB 1RWBA 1Z75A 2C54A 1DDOA 2ET6A 3G1UA 2WD7B 1YE3A 4M54A 4AICA 2HK7A 2HCTA 2ZYGA 3QVTA 2X86A 3PRJA 4ND5A 1K6IA 3AFMA 2GSDA 3Q9NA 1UZLA 2QG4A 5TF4A 1F06A 3C7AA 1WZEA 4HV4A 1DEHA 4YA6A 4N18A 1UXKA 1Y8RA 1DRVA 4KOAA 1R4MB 2POQX 4HWKA 2Y1CA 3EAGA 3ONFA 3DMTC 5EINA 5DBIA 4DIFA 1NNUA 3F6YA 3KUXA 4U5QA 4N54A 3ZWNA 5FFFA 3KHUA 1HE3A 1P74A 5TQVA 5JCJD 3BTVA 2IZ0A 4OHUA 4AJLA 2EXXA 5JNLA 2IXAA 2JD2A 4LMPA 1KVTA 5DCYA 3ICPA 3GZNB 6ADHA 1T2AA 3EZLA 3VTFA 1HE4A 1GCUA 4B3HA 5G2OA 1Y8QB 3LF1A 3F4LA 4WLNA 2Q1SA 5KCZA 2O4UX 2VRCA 3PGXA 1YBAA 1E6UA 4CL8A 5BNFA 4OH1A 3L0DA 1VRWA 1H6AA 1TEHA 4RVHA 2NTVA 1CDOA 3C24A 4JJGA 3LC1O 4GLLA 1KBZA 5T8KC 2RH8A 2FZWA 5JBIA 1MFPA 3JQBC 1ML3A 2Y1EA 3I6IA 3WFIA 3QA9A 2BGLA 5IN5A 3OF2A 4E2YA 5F1KA 3LSYA 4IDEA 3DFUA 2O3RA 1DHTA 4CMEC 3DR3A 3PWKA 1EEHA 3CTMA 1RYEA 2PKRA 3B70A 3C3XA 3UHAA 5MGBA 4NPCA 2O7SA 1BDBA 4G65A 1CIVA 1LQTA 2Q49A 3ENNA 5BQFA 1Z7EA 4BO9A 3NT4A 1NPYA 1PJLA 3DONA 4ILKA 5JFOA 2HRBA 4HP8A 3WXBA 4WECA 4JN6B 3VZSA 3HQ4O 4PLFA 1O5IA 4FCCA 4D43A 1JTVA 5ER9A 1HSZA 1LJ8A 2EV9A 2PFGA 3JQCA 4YAEA 3FTPA 4RCVA 3K73O 4Q3NA 3DZGA 1H6CA 3WYEA 1I32A 1EK6A 3FD8A 3IL2A 2G82A 2D2IA 3OFSA 4DBZA 1V0JA 2NQTA 1EK5A 3E8XA 3JQEA 2CVZA 3FRJA 2CVQA 5MDHA 2VRBA 1LXCA 3W6UA 4RF2A 3GNSA 1YB5A 4MVJG 2OUIA 3I4FA 2X0RA 2EEZA 3A4VA 1E1MA 2O7QA 2HLPA 4CLOB 1QP8A 3AJRA 2DVMA 1R0KA 2R00C 3HB5X 4D46A 3ZI0A 2DBQA 4NBTA 4NZ9A 4PLCA 1DLIA 1E3JA 1ADGA 4DIBA 1I2BA 3JQGB 3WS7A 4EBFA 3DZFA 2R6JA 3PVZA 4XYEA 2HUNA 4B7UA 1U1IA 1U9JA 1NAHA 1YXMA 1F12A 3OA0A 1OAAA 2VYVD 3BYZA 4CM1A 2C7VA 4AJ1A 1YB1A 6LDHA 1CQJA 1U4OA 5JYFA 3NDJA 3OM9A 3NT2A 4I5GA 2GCGA 4CMJA 2B5WA 1BXZA 4IQ8A 3ZZNA 2QX7A 2PZKA 1C3VA 3S2IA 4PIVA 3OQ6A 1P1JA 4A03A 2EW8A 4NK4A 3W8FA 1RM0A 3GFBA 4RVUA 4TRNA 5L4LA 1GYPA 1Q7GA 1Z73A 4KTTE 4CPDA 4D0RA 3RBXA 3WGQA 1JW9B 1LSUA 5FI3A 4EJMA 1JLLA 4MVJM 1OZAA 2I66A 2X9NA 1IHXA 3MJ4A 2IDZA 2P5YA 4QT0A 5CAEA 2VUTA 1O9BA 5I8WA 2DUUA 1C0IA 3KEQA 2Y99A 5CDTA 4BIIA 4MIEA 3FR8A 3IUPA 2A9FA 2Y0CA 2EGHA 4J2HA 3WR5A 2CZCA 5HM8A 1PTJA 4FFLA 4YT8A 1PJCA 1ZZEA 2O2YA 1PL7A 2VT3A 4ALNA 2AA3A 4B4UA 7ADHA 3GVIA 2AEJA 2VUUA 5H81A 3PQFA 4OIMA 3RI3A 2QRKA 3QQPA 5DT9A 2UDPA 4J49A 4M55A 1PJ2A 2NTJA 4YJHA 4J1QA 3JQ9C 3WWYA 4E5MA 4A73A 2FZEA 5BSGA 1XR3A 3ZU4A 2GGSA 3DBLB 4IS2A 4YRDA 2Q4EA 4BQPA 1X1TA 1K6JA 3DBRB 5IZCC 4RPKA 1SEPA 2WE8A 4RVDA 4L0QA 2Y1DA 2PZJA 5CPBA 2WEKA 3WG9A 3BMNB 2WWRA 3E48A 3ZHXA 1WLYA 1U3TA 4WEQA 4PLVA 4WLEA 5KVCA 1NYTA 1PJQA 3KYCB 1B8UA 3MWEB 3RKRA 4UUPA 5T64A 1B26A 3FBGA 3PHJA 5F1PA 1L1FA 1C1DB 3GQVA 2ZB3A 5BNTA 2FN7A 1JKIA 4D79A 4J4TA 3EY4A 1XSEA 4Z9YA 3ETGA 1PX0A 3H9UA 3MCVA 2X9GA 4MOWA 5L4SA 3PGJA 2UUPA 3SLKA 3L4BA 3ST7A 2D5CA 5L51A 2HMTA 2O3JA 3JYNA 3PI7A 3GVPA 3ANNA 3OJOA 4IJUA 3PJFA 4IDDA 2C82A 4Y8VA 1LRJA 2H9IA 2O3UA 3AY7A 4AJKA 4D42A 1U28A 3BTUA 1UH5A 2OO5A 1RM4A 1VKOA 1JKFA 4CQLA 2I3GA 5A02A 2JCXA 1HDGO 5IDYA 2BI7A 4Z3DA 5IG2A 2P5UA 4GWKA 4CR7A 5TIIA 4O59O 3WICA 4CUJA 3CSDA 3ZV3A 1GV1A 4YVFA 4FOSA 3MZ0A 1SMKA 2AG5A 4KQWA 1NQAO 3UGKA 4EEXA 4L75A 2J5QA 2Q4BA 2X58A 2H5LA 3KVOA 2GRAA 4J4HA 2O2SA 4YYZA 4CMIA 2Z1NA 4L8VA 2V7PA 2YUTA 1CJCA 3R1IA 2JKVA 5THQA 5JCJA 2O4CA 1H2BA 4HX5A 5DNAA 5L4NA 1G1AA 3V1UA 5JPIA 3T7CA 2LDXA 2I9PA 1JA9A 3ONDA 4P8RA 1PR9A 5M6DA 1I3MA 1X7DA 5F5NA 1D8AA 1AN9A 1CF2O 4CM7A 1A7KA 2WD7A 2UYYA 1V3VA 3GF4A 5HRUA 1KC3A 2XF8A 2G17A 4DYDA 1NVTA 1MA0A 3FTNA 2DAPA 1NHWA 3DEYX 2C59A 4RZIA 5GY7A 3O4RA 2PH5A 2ZYDA 5JAMA 2X7HA 3GDFA 1DC6A 2RHRA 4U0KA 4XYBA 1KVUA 1KEPA 1R4MA 3CXRA 1K6XA 3HZZA 3NAQA 1PJTA 2J3JA 2PA3A 3NDIA 2IZZA 4Y9DA 1LLUA 2PGJA 4CODB 3U4IA 2BFOA 3DC2A 4R1UA 4XA8A 1MFZA 2VHZA 2EIHA 4AJ4A 1LNQA 3OHSX 3PZRA 3ROMA 3UICA 4CM4B 1F0YA 2V6FA 5I9MA 4PLYA 5BSEA 3L6OO 3E9MA 1GUZA 4F45A 2D5AA 1XGKA 1TT7A 3IJPA 1B7GO 1Y5MA 3G0OA 2WYVA 2YJZA 4K26A 1IL0A 2DPHA 3HSKA 1E7QA 4TMFA 2Z1MA 3U49A 4XB2A 4M49A 2FHSA 5GMOA 4DC0A 1GR0A 3PJGA 3SBOA 1EDOA 4AJHA 1KEWA 3NYWA 1EBFA 1BW9A 3H7AA 1TB4A 3B1KA 5EQFA 4INAA 1GCOA 2CF6A 2E4AA 2PD6A 1NQOA 2UV8A 1ZJYA 4W9NC 3I4CA 4ND3A 4E21A 4BNHA 4XCVA 4GX2A 1T4DA 1VL6A 3RCBA 1Z74A 1T24A 2W2KA 1E6EA 1LC0A 4BKPA 2PH3A 3TF5A 1YOVA 2Q1TA 4XYMA 2Y05A 4E3ZA 3AUTA 4KWHA 3HUDA 5HTOA 3WBFA 3WLFA 2FP4A 3ZU5A 2VTDA 4FJ0A 2IEDA 2D0IA 4NR0A 4E12A 2CFCA 2F1KA 2FPPA 3JQFC 3QIVA 4H16A 4WK6A 4DMMA 3TSCA 1RKXA 2AQ8A 2VWQA 3ASVA 2VHYA 2X22A 2IE0A 2NV6A 1GQQA 4L74A 4W6ZA 3RUFA 4XDYA 5L95A 2VYVA 2EF1A 2FOIA 3W4IA 3A06A 3SLGA 1L7EA 4ALJA 5HBRA 1OOEA 5F3RA 4I9UA 3T7EA 3HE3A 4O5OA 3M2PA 1Y81A 2CD9A 3NJ4A 3QWBA 4DPKA 2J3HA 2X4GA 4J7UA 4BL5A 5DCWA 3CZRA 1R6DA 1GQ2A 3INTA 4E5KA 1O0SA 3N7UA 4JBIA 3OQBA 4E6PA 1C14A 4IDFA 3D4OA 3O8QB 5KIAA 4NNJA 2HO5A 3CPSA 4GSLA 1ZH8A 4YRAA 4UEJA 4CLOA 3UVEA 4OMUA 4CQMB 1XQ1A 4RVSA 1E3SA 5EPOA 3P2YA 1N92A 1PQWA 3U4DA 3K92A 3AOGA 4ALIA 3U3XA 1LUAA 1J0XO 1T25A 5C3MA 4RV9A 1GD1O 3H9EO 3ANLA 4IQGA 3QWAA 3ROPA 3JYLA 1BRMA 1ADFA 1ENOA 3MJEA 3E5MA 4HY3A 4IXTA 3PDUA 3B1JA 5ITVA 4H7PA 1YBMA 5JYAA 1C0PA 1J49A 3ZWCA 4JLWA 4B7XA 1NHGA 1MV8A 4NJMA 4YB8A 3RVDA 4GGOA 3WYBA 4BV8A 1MB4A 2WE7A 2J8ZA 1TI7A 2O23A 4IMPA 1I30A 3WGGA 4K28A 4Z0HO 4FS3A 1GTMA 4TRMA 2DBZA 2JAHA 5KNLA 1U2DA 1EVIA 1XU7A 3DBHB 3IIEA 1QMGA 4CQMD 4D41A 5C5IA 2NM0A 3AUSA 1M2WA 5K0ZA 3PYMA 2W2LD 3B1FA 3GN2A 4I08A 3TFOA 1HDXA 4R54A 1N8KA 4BNGA 3TPCA 2PKQO 1ZK0A 3TQHA 1XWFA 5KVVA 3EC7A 4QFDA 3GR6A 3GAZA 3BZUA 3DOJA 4W4TA 4MVJF 3BAZA 3QJ5A 3I9LA 4Z6KA 3D5TA 4L4SA 3ZNNA 4BQRA 4Z0TA 5T5QA 3RAJA 4RDIA 3WQRA 4PLGA 1E3LA 1YWGO 1U4SA 4LVCA 3RBVA 3QLJA 5CDGA 1VLLA 4CMKA 2OP1A 3VH1A 2OBYA 4IJWA 4JQCA 3IOYA 1B3RA 5ENDA 4BGUA 2EKPA 1P1KA 4F6LA 3BIOA 1ZO8A 3AI1A 3KO8A 3OJ0A 3QWIA 4WASA 1LEHA 3RUDA 4BGVA 4W82A 1O6ZA 1T2EA 1I33A 3NTOA 3BMNA 5B1YA 1DIAA 1DC4A 1T2DA 4IY1A 1UXJA 4Q3AA 1HDOA 3ZV6A 3D3WB 1VM6A 1DHRA 3LVFO 4DLBA 4XDZA 1GAEO 2ZJ1A 1FDUA 4FFNA 1P0CA 4RF4A 2ZJ0A 1I3LA 1XCBA 1YJQA 1C1DA 1WNTA 1LLCA 2NUAA 2NLOA 5FWNA 5U9CA 4R16A 3O9ZA 4IM7A 2JAPA 3S2GA 3AI2A 4MO2A 4BO3A 3MJSA 1D7OA 3L4SO 4GX0A 1LLQA 1G6KA 3Q9UA 2QIOA 5CP8A 3H5AA 1WDMA 5G0WA 3L9WA 3QVOA 4LN1A 3RFVA 2O50A 1YONA 3RASA 2PZLA 4XX0A 3Q3CA 4J9UE 4DA9A 4YDRA 2AXQA 2WSBA 5KJFA 2P4QA 1BMDA 4NBUA 2J3IA 3V1TC 4QQRA 4D7AA 1ZXBA 3RBZA 3ZW8A 3ONEA 4NFHA 2GN6A 5JDIC 1B16A 1XHLA 3DZHA 3OBBA 4QO8A 4TVBA 4RL6A 3H9GA 1EBUA 4U6SA 4MP8A 3A14A 4I1IA 2AHRA 3GRKA 4DBVO 2HMSA 1V35A 3WGOA 2Q46A 3EW7A 1A9ZA 4DREA 1BVRA 4WOJA 4OKIA 1GUFA 5KVQA 2IYPA 3GNQA 3ITKA 4BNYA 4MVJE 4UUNA 3FNHA 4I5DA 2DM6A 3W4JA 5IXYA 5IAAA 2UAGA 4L76A 4NH4A 3WGTA 2PD3A 3WFJA 1KERA 1J5PA 2HK9A 5CHEA 4BHTA 2TMDA 4UUMA 4B4OA 1YL7A 3EDMA 3HG7A 4YJFB 3VVCA 2GN9A 1D3AA 5DBGA 1YQXA 3WLEA 1AGNA 3NEPX 4OXYA 4CLRB 1XQ6A 1ZFNA 4IBOA 2O3TA 5L45A 4TKLA 1Y9EA 1Q1NA 2ZTMA 3IQDB 3FN4A 5CEJA 3OETA 2GZ1A 1MGOA 2GZ3A 3IAHA 4I5FA 5CEEA 1CYDA 2H63A 2Z95A 1X13A 1RM5A 1LC3A 1H5QA 1VI2A 1E3IA 2EP5A 4MINA 4UVDA 3X2EA 3JYQA 3HDQA 4RQUA 3JSAA 2IODA 1UAGA 4YAGA 3WNVA 5KJ1A 1KVQA 3C7CB 3RC9A 1SO8A 5T67A 1PZFA 4KZPA 2Y1OA 3ZV5A 1DXYA 3C1TA 3AWDA 3BMCA 3OEYA 5LDHA 1M76A 2D59A 2H6EA 2A92A 1P0FA 1CQIA 3FNFA 4CM4A 3FHLA 1QRRA 4PLHA 1BXKA 2X5KO 1ISIA 2EW2A 4DRYA 4B8WA 4FC7A 5L9AA 3TZKA 1SB8A 4A27A 4J4BA 3QHAA 5KJ6A 4PG7A 2BMAA 3INRA 3E9QA 1ENPA 1WPQA 5HA5A 5I8ZA 3HB4X 4R68A 4MVJA 4R1SA 3OJFA 4OYRA 3DOOA 4ZJUA 1KIFA 4J1NA 5ENVA 1IPEA 1P1FA 4ID9A 3I23A 4RPJA 4D45A 3TNLA 3GUYA 5A4DA 1PJBA 5ICMA 3KB6A 3G79A 4GLOA 5KVSA 1A4UA 1HZZA 3IS3A 4BNKA 1P33A 1LSOA 1O89A 5A9SB 5G0VA 3RU7A 4XJSA 4KUGA 2OP0A 3PWSA 2P91A 4EI2A 3E6AA 3R6DA 1U8FO 1SPXA 2DKNA 2QYTA 1H9AA 3K30A 5TJHA 3WIEA 1MC5A 2D3TA 3R3JA 3DAGA 3IUSA 1K3TA 4G81A 2BELA 4JP2A 2G76A 1DOHA 1DJNA 5THKA 3WMWA 4EUHA 3DL2A 4UEKA 1Q0HA 4O63O 3F4BA 4DGSA 3T4EA 5IZ4A 1QXSA 4KWIA 4HFJA 3ZWMA 3WQQA 5AXDA 5F21A 1ONNA 1HLDA 4J1TA 5F5LA 3UCFA 1JWAB 1SC6A 1N9GB 3PXXA 3UUWA 5EIOA 1U3VA 3LT4A 4JXKA 1M6HA 4B8ZA 2O3SA 2AW5A 1FF9A 3E5RA 3G49A 4CV1A 3LYLA 3NV9A 1B3BA 1ZXLA 1GL3A 4I9HA 2Y1FA 4ZRMA 4XZ3A 5JS6A 3GDOA 4BNMA 3L4BC 4J0FA 1HTBA 5TT0A 9LDBA 3RIHA 3LZ6A 3HDHA 3WMXA 2C2YA 4BNTA 1JN0A 4Q3BA 5TLSA 3K9QO 4J90A 5TX7A 1HWYA 3L6DA 4PLWA 1ZSVA 4NFYA 1OBFO 2J3KA 4NBWA 2QHXA 2NVWA 4ZVVA 4CM9A 1RM3A 4E5PA 1CEQA 4O1MA 1PJ3A 2W2LA 4ZQGA 2VHVA 5KJEA 4IXWA 4W7IA 3S2EA 3DZJA 4IIUA 3W8DA 5IDWA 1JKJA 3GMSA 4J9VA 1AXGA 1X1EA 2DFVA 3DWFA 4Z0PA 3WNQA 3QVSA 3RU9A 2HU2A 3SJUA 2IEBA 1XU9A 4D3FA 4Y6RA 5JDCA 1UJMA 3IJRA 4IZIA 1M75A 4M1QA 1ARZA 1FDWA 1UP6A 4YJGA 5IXSA 3RJ9A 1E3WB 4MDHA 1FDTA 2E82A 3JQ7B 5A03A 4MKRA 1P1IA 5ILGA 1ISJA 1ONPA 4IJKA 1B8VA 3V2UA 4GMFA 1LRLA 3I9KA 4CMAA 5CPFA 5ITWA 1GPJA 1SAYA 3ADPA 4AJPA 3GH3A 2I5PO 3MJCA 1B8PA 4PRKA 4TKMA 3VZQA 3F3SA 1Y5RA 3WB9A 5TGDA 4LMRA 1VSVA 1CWUA 1N1GA 4AJEA 4R4JA 1TXGA 1QV6A 2QQ5A 4BO7A 3KETA 2JCVA 4BO5A 3P19A 2WJPA 3OICA 2DC1A 4JNKA 1Q7CA 4DQVA 3TZCA 5CG2A 4R41A 3I9MA 4JJIA 3UXYA 3VPGA 3QW2A 3MEQA 3N58A 3ZDFA 3OIGA 4BNLA 2C0CA 4DXHA 1W6UA 2WD8A 3TWOA 1LI4A 1WWKA 3L77A 1JVSA 4BV9A 1M66A 1T1SA 4W7HA 5T57A 1ZIDA 2P2SA 4GSKA 4IZHA 4OOEA 2BH9A 2AEFA 1HE2A 2VWPA 1EFLA 4G5HA 4YT5A 1EE2A 3TZ6A 1MG5A 3GPIA 3GUCA 5T6BA 3ZHZA 4GVLA 4XR4A 1E1KA 1L7DA 1NP3A 3PYLA 1WMAA 4B79A 1SCUA 1DO8A 2QW8A 3LQFA 2Q22A 1ZK4A 2D8AA 1SNYA 4I5EA 1TLTA 3RUHA 4I9NA 1ZW1A 4E0BA 4AJOA 1NWHA 1ORRA 4L73A 1FMCA 1I3NA 2X0JA 4K6FA 3VKVA 4YTEA 1PS0A 2IZ1A 3I9NA 1EZ4A 5ICSA 3VKUA 3PHGA 4QEDA 3WTBA 3IKTA 3D3WA 2ZQZA 4WOKA 3MJVA 1U3WA 5JCXA 4RVFA 4R3WA 2JFFA 1XA0A 5C7OO 1DAPA 3KBOA 4NU5A 1V6AA 3GGPA 3S55A 4WEOA 2UVDA 5JMPA 4GPD1 2ZKLA 3RC1A 1NM5A 3D5QA 5B37A 1OFGA 1R4NA 1IUKA 3FNGA 4M89A 3R3SA 2Q1WA 4RJTA 4J43A 3Q0EA 3Q1LA 3PP8A 3QE3A 4LRSB 2B35A 2AE1A 2DTDA 4TZTA 4BVAA 3EZYA 2BD0A 4L9RA 2EKLA 4UVIA 3QY9A 3MTGA 3VVBA 5CDYA 1HYGA 1YDWA 3RUEA 2AE2A 4HFMA 2NTNA 4WKGA 3DXFA 4GKBA 1DLJA 1WZIA 1X7GA 4AVYA 5I7EA 1JVBA 3FWZA 3PQEA 5LCXA 1M67A 5JAQA 1I2CA 4FC6A 4BOYA 2VNSA 2FWMX 3MJTA 1WMBA 4NMHA 1GYQA 1UZNA 3AY3A 4CM5A 3W6ZA 4DUPA 1EUCA 4WCFB 1DJQA 2P68A 3FWNA 5G4KB 2DLDA 3H3JA 2RAFA 1MX3A 1Z6ZA 4YBZA 4WNIA 3GZ4A 4URFA 2JJYA 4TZKA 4LSMA 3JQDA 4N5MA 2X5JO 5BT9A 5BSFA 2FRDA 4PG4A 1O95A 2X6TA 2VT2A 2Y68A 4GX5A 1H9BA 3E82A 3GLQA 3PDJA 3PQDA 2HMVA 4BO2A 4FD3A 1H0KA 5FI5A 4DTIA 3H2SA 3IMFA 2C5AA 3HWRA 4HFNA 1SOVA 2W90A 4WUVA 3UH1A 5H82A 4HNGA 1A4IA 4BO8A 4NJOA 2FY8A 1EQUA 2B4RO 1YH3A 1WAMA 1R15A 2V6GA 1GDHA 5DULA 4II3A 1ZVMA 1DRUA 1BVUA 2HMUA 2PD4A 4CR8A 3G17A 3LT2A 1S7CA 5HS6A 1PL6A 3BHIA 1N7HA 5JO0A 3EVNA 1M6WA 1LDYA 3WTCA 2PK3A 2BFPA 1WVGA 1QG6A 3I5MA 4BKUA 4B3JA 1UZMA 2DFDA 4Y6SA 4GVXA 4II2A 4YQYA 2BFAA 4CMGA 3RFXA 3V2GA 1X0VA 4WJZA 3ULKA 1D1TA 3VPFA 4KTVE 4FPXA 1T4BA 4PN3A 1YDEA 5ADHA 3ZU2A 1DBVO 3AFNA 3PWZA 1A72A 5I9LA 1E7MA 3I6QA 3AW9A 2HAEA 1I0ZA 3Q6IA 3OEWA 3C1AA 2YW9A 2DUWA 5COQA 4JJFA 1KVRA 2D4AA 8ADHA 3GZNA 3PZBA 4CV3A 3VTZA 3RSHA 2Q1UA 4R9SA 3KXDA 2Q2WA 1DIBA 1Y8QA 1GV0A 1PWZA 4DWVA 3JD0A 3ZWBA 5JE8A 1Y8RB 1JU9A 4TROA 2X1HA 1E5LA 4PZCA 3C7DB 3PIIA 1PWXA 4QFCA 3UAGA 3Q11A 4DIOA 2QYSA 4M87A 4HADA 3PTZA 1A9YA 4NIMA 3JQ9A 3KTDA 4XWYA 3DO5A 4EUEA 2JCYA 2I67A 3O03A 1QLHA 5DP1A 4GKVA 4RLHA 2TMGA 2IRWA 4XGNA 4ALMA 5KOIA 3S8MA 1QLJA 1LDEA 4RO0A 4CM6A 2Y0DA 3IP1A 4UAGA 5AOVA 4ND4A 5A9SA 1FDVA 1UUFA 1CRWG 3O26A 4UEOA 2RHCA 1PL8A 3K2EA 2V65A 1I8TA 3NX4A 1NASA 2VZ9A 4LCJA 2HJRA 5L7TA 1WDLA 2FPIA 3IC5A 3PEFA 5G4LA 3VHRA 3AM3A 1GU7A 1MP0A 2NVBA 3LDHA 4AJ2A 1B15A 1PGQA 3HNPA 4W99A 2YHUA 2CUKA 3PJDA 3SX2A 1IB6A 1YBVA 3AUAA 3ROKA 3SEFA 1FDSA 3JCZA 5EJ2A 3WGHA 3HJAA 2EHDA 2G5CA 3QRWA 3ZHBA 8LDHA 2I65A 3GVCA 1IULA 2JHFA 3LK7A 1EFKA 4UVHA 5EN4A 1K0UA 4K6CA 4Q39A 2ZTUA 1EMDA 4D44A 3WBBA 3D4PA 1HDCA 1LX6A 1MLDA 2P9GA 2VNAA 1V9LA 1LDNA 1PZGA 5TS3A 4ZU3A 1NPTO 3KZVA 4FSHA 4IDAA 4TVOA 1VC2A 3NRCA 3FNEA 4U6QA 1IY8A 4MP6A 3DB2A 3SXPA 3U0BA 5IJZA 1GPDG 4Y6PA 2C07A 4YT2A 2HJSA 4BB6A 4C7JA 4MVJI 4MVJP 2HDHA 1Z7BA 2C7GA 2GZ2A 3ZV4A 5TNXA 1X14A 3GT0A 2HMWA 4O6VA 1HDRA 2CDAA 1W73A 4QSMA 5G0UA 1HZJA 4JGBA 3JQGA 4U7WA 3GG2A 5JY6A 3D3EA 1XIVA 3E18A 3MOIA 3IKVA 3DHNA 4PFJA 3C1OA 2OBNA 1WDKA 4ITUA 1QKIA 3FR7A 3ZNPA 3E1KA 3I52A 1C1XB 3JD2A 4PLPA 2FSVA 4IS3A 4AG3A 4CL3A 3AI3A 5G0SA 1P3DA 1NQTA 1E3WA 4CJXA 3JQ7A 3DDNA 4RDHA 4YJDA 4M8SA 3AY6A 3ORFA 2R2GA 2O3QA 1ZBQA 3FI9A 1QYCA 4CLDA 4CV2A 2BF7A 4DPLA 4Q3EA 2HQ1A 4MKXA 1IYZA 3DHEA 4UVEA 1P1HA 4BNWA 1KETA 3D64A 4PRLA 4TRRA 1A71A 1LSSA 1R0LA 4J6FA 4XYGA 4P4GA 3GEDA 1T2FA 1NBOA 2I99A 3RUAA 4J91A 2PWZA 3OJLA 3OIFA 1B0AA 5K9ZA 5ILOA 3OA2A 1ONOA 3K31A 2O48X 2VHXA 1JDJA 2C5EA 4EJ6A 2VYND 3G1TA 4NI5A 4Z3KA 1HRDA 3JD1A 3UFXA 2VWGA 1E7RA 3U9LA 3WJAA 1U5AA 1DAOA 1GEEA 1K89A 3QP9A 2XXJA 4J0EA 3VPSA 5A9TA 1ZKMA 2C2XA 2Y66A 1AXEA 3TJRA 2WM3A 1LDGA 3AOEA 2W8ZA 3SC4A 4BGEA 1IZ9A 3GG9A 4B4WA 2WYUA 1ENZA 4KDFA 1LA2A 5I9NA 3K2BA 4P4LA 5A05A 9LDTA 4BNUA 1QYDA 3BHJA 1HSOA 3CUKA 4PG5A 3CH6A 4R9RA 1PZHA 1O94A 4RPGA 1ADCA 5A5FA 1V3TA 3KM0A 1ULSA 3PHIA 3KSUA 1FK8A 1D1SA 3ETDA 2BFMA 3DBLA 1H6DA 2H1SA 3CMCO 1E1NA 1OMOA 3DBRA 5IDQA 4J3FA 2RIRA 4QTZA 2ZK7A 1TT5B 3GHYA 1B2LA 5BR7A 4FW8A 4E33A 1X7HA 1OC2A 2WYWA 2OMEA 3KYBA 2NVUB 1S6YA 1U5CA 4JP3A 3TZHA 4MJLA 2B0JA 2Q2QA 4HNHA 2CY0A 4PGFA 5AXCA 3WJ7A 2NQ8A 3GGOA 4A7PA 4YWJA 2OGUA 1KVSA 3KYCA 4QX6A 5COAA 4YJHB 5GZ3A 1GQYA 1K2WA 3JD4A 1YQGA 4XD2A 3VOSA 1KS9A 3PLRA 4M86A 4FFMA 1DFHA 4GBJA 7MDHA 4MP3A 1I24A 2E37A 4LCEA 1DB3A 4F6CA 1G0OA 4BNNA 2BLLA 3EK2A 1NXQA 1Q2XA 5I7FA 3RWBA 3AK4A 4KP7A 4CLXA 1LTHR 5DBFA 2XXBA 1EQ2A 2GR9A 3UCXA 2V6BA 5FEUA 2C20A 4DLLA 3AU8A 1A5ZA 2X5OA 1H2HA 2GASA 3DAFA 1HEUA 2JFGA 4EGFA 2YHIB 4R1NA 2G0TA 3I1JA 3JD3A 2JD0A 3FBTA 4C4OA 2PNFA 5TJ9A 3WGZA 3CKYA 4IMRA 3PHHA 3ITDA 4E5YA 5K6AA 1LDBA 4WCFA 3A9WA 4DLAA 5IDXA 1KEUA 4BO1A 2PGDA 2JD1A 2PGLA 1C0KA 1JAXA 3BTOA 3HFSA 5JC1A 1HT0A 4IIVA 4RLSA 1R16A 5C37A 2AQKA 4BKOA 1J6UA 1ID1A 1MXFA 3ICCA 5FYDA 3HFGA 1MUUA 3ON5A 5DOVA 4LRTB 2ZB8A 3GEGA 3P2OA 1QR6A 3DMYA 5COBA 2YFHA 4QECA 3U62A 3ZNOA 4FOOA 2Q50A 2B4TO 1ISGA 2BRUA 3H9JA 4F3YA 3L9XA 2SCUA 4NDNE 4TQGA 3ROQA 4B4VA 3QWFA 3PIDA 4IQ0A 3WSVA 3NGLA 4RF5A 4CMIB 5AYVA 1P1RA 1DSSG 2J5KA 4O0LA 2AQHA 3H5RA 5C7IO 2VUSA 4CUZA 5I7SA 2I76A 3PJEA 1GY8A 5T73A 1BG6A 5JDCC 3PHLA 2BGMA 4C7KA 1F8FA 3I83A 2VQ3A 4XEHA 4BMSA 1VJ0A 1Y1PA 2GO1A 5IF3A 2VWHA 2ILTA 2GD1O 4ZA2A 1PIWA 1UP4A 1V8BA 3E03A 2YDYA 4LSWA 2I6TA 4AJNA 2UUOA 4KDEA 3RJ5A 2WMDA 2DTXA 3NTQA 3D0OA 1HDYA 1N1EA 2B69A 4EJ0A 1RPNA 2XAAA 2BHLA 3VPXA 5A04A 1CETA 3DAPA 1YQDA 4YCAA 4NBVA 3EMKA 1U7TA 3LU1A 1CERA 1VJTA 3RUCA 3TN7A 2YQ5A 4MVJH 1Q7BA 5A3VA 3D4NA 4KUEA 1NQ5A 4FGSA 2A4KA 4XJTA 3RROA 2JFHA 4N7RA 3GC6A 1NFRA 4OAQA 1RYDA 2HRZA 4TWRA 2GPTA 1Y7TA 4NBRA 1DFGA 4BNVA 1E1LA 5B4TA 4D3SA 1YKFA 3UF0A 1GZ4A 4XIYA 2WDZA 3ENKA 1A27A 3WOHA 4YRBA 2G1UA 5FF9A 2FMUA 1HF3A 3KRTA 2D1YA 4YEDA 1BW9B 1HL3A 2GDZA 1LDMA 1ISFA 4JK3A 3ZU3A 5JAZA 3U09A 2Q2VA 1UDBA 4OJNA 3HDYA 3QVWA 4EYEA 1PQUA 3LC7O 4R5HA 4Q3CA 3RKUA 1ZSYA 1F8GA 4DMLA 3JQ6A 3EYWA 1T2CA 3DZBA 2P9CA 3IDSA 2W2KB 2Y93A 3DQPA 4OQYA 3VZRA 3I9JA 3OIDA 4BO4A 5HWSA 1YOVB 4N5NA 1ADBA 3AUUA 3LT0A 2W4QA 1N5DA 1XKQA 1UP7A 3ZNQA 1EVYA 5J9GA 4LW8A 3T4XA 4GI2A 1J4AA 1PJ4A 3LF2A 3D7LA 1B14A 1SOWA 2IYOA 4PZDA 3UN1A 4P22A 4BNIA 4YAKA 2X0NA 3VAZA 2A94A 3O8QA 2LDBA 3WIDA 5JDIA 1E7WA 1HE5A 2J6IA 4Q3DA 3ZH2A 3U4CA 4XRRA 3OJEA 1VL8A 3EGOA 4CQMA 3M6IA 1UDAA 1T1RA 2QZZA 3DHYA 4RZHA 1LQUA 3GGGA 2YV1A 4P4NA 3KSZO 3CIFA 2VYNA 1VE9A 1PR3A 1GYRA 3V5NA 3F5SA 3W1VA 5B4VA 1P77A 3QV1A 2VCYA 3JQ8B 4NK5A 4EITA 1XDWA 4J2OA 3GVXA 5L7YA 4D3DA 1C1XA 3BHMA 2PZMA 4U0JA 3TL2A 3F1LA 4CLEA 3JQAB 4G2NA 4FJ2A 3NT5A 4S3MA 3KYDB 2RCYA 1PS9A 1NX6A 1EE9A 2QRJA 1VJ1A 3EVTA 3R0IA 2VHWA 1AHIA 2PR2A 1MG0A 3VDRA 4WLUA 1VL0A 4EZBA 3W8EA 1AHHA 3FPLA 2EERA 2XPCA 4XYLA 1ZNQO 4EDFA 3GK3A 5JMWA 1ZMOA 4YXFA 3WYCA 3B6ZA 2B37A 3ZWVA 4CM8B 3M1AA 4BS9A 3DBHA 4CLHA 1BTOA 4IPTA 4YR9A 4XRGA 3MWDB 1I3KA 4A2CA 1VSUA 4XQ9A 4NJMB 1WXDA 3VH4A 2ZCUA 3DMTA 1I36A 2NNLD 3UOGA 3ZCXA 2GN8A 5ES3A 2BGKA 4FQ8A 1GADO 4ZRNA 4A5OA 1IHYA 4Y98A 3QVXA 4UVGA 4Z9FA 2BKAA 4YAIA 1E92A 3UKOA 1TVEA 2CDCA 4PVCA 1ZEJA 5JSFA 3OH8A 4FN4A 1NFFA 3JQAD 2EP7A 3EUWA 1YO6A 2AQIA 3ETEA 4UULA 1YVEI 4FB5A 3GMDA 2OXIA 2XOXA 4J7CA 2YZ7A 1D4FA 1BGVA 3CZMA 1E7SA 4A10A 3ASUA 4IDBA 1UXIA 4XR9A 3E9NA 5A3JA 3MTJA 1PSDA 3NDRA 3ZWXA 3VC7A 2WTBA 5EESA 1AE1A 5U4QA 5JYEA 1UR5A 5T8KA 2PTGA 1HYEA 3ZGYA 2PKQP 5AVOA 3JQBA 4PG6A 4JROA 1G0NA 1TT5A 2J5RA 5DP2A 2JL1A 4WNCA 4JCOA 2RBEA 5DOZA 3WSWA 4K9DA 4FJ1A 2GN4A 2NVUA 2OL4A 5AXAA 3JTMA 4KUHA 4N5LA 4XQEA 1QORA 2NWQA 3BMOB 3DTYA 4R5MA 4CMEA 4IDGA 1IZ0A 2OHXA 5CDUA 3BXXA 1ISHA 1K5HA 2EJWA 4BKRA 4EW6A 1HETA 3I3OA 3CEAA 1I5RA 3UCEA 4NFSA 4GH5A 4EUFA 3TOXA 5B12A 3K5PA 4BKQA 2HSDA 3BTSA 4AL4A 3FF4A 2NU8A 3ZWPA 5JW6A 4KQXA 5EL0A 3VDQA 2AEMA 2E6UX 2YDXA 3NKLA 4OOFA 1IPFA 1JWBB 2NU9A 3I9OA 3PYXA 1BHSA 3G3EA 3TFQA 5KTKA 3H8VA 3ADOA 1ZK2A 2Q45A 2YHIA 3GPDG 2E48A 3WDSA 5A5EA 4CUKA 1PU2A 2FSSA 1I01A 3PPIA 5A1TA 1JQBA 1E77A 5LC1A 1XEAA 3H5NA 5CEFA 2Z5LA 2DBVO 3BMQB 4TSKA 1SBYA 2OZPA 5CDSA 3KEOA 4FDAA 2FR8A 4LK3A 3HN7A 4WLOA 4Y67A 3TOZA 1BWSA 4E4YA 4L4RA 4PVDA 2R00A 2ZTVA 4R69A 1YB4A 1LLDA 4ZD6A 5JO9A 4OKNA 3WGIA 1PS8A 4IINA 2PY6A 4RVGA 4FIZA 4YJFA 1PZEA 2X0IA 3RUIA 3Q2KA 1RJWA 3QWHA 3WX0A 4CLRA 4AJIA 4X54A 4J7XA 5JXWA 3C85A 3O38A 4WCDA 5G0TA 1ZK3A 1SZJG 2V6MA 3DOCA 3L6EA 3H6KA 5KWEA 3U5TA 3RC7A 4UREA 5HS4A 1ZEMA 4BNZA 1QYXA 1LBEA 4BMVA
chains in the Genus database with same CATH superfamily
1Y82A 1Y6FA 4NCIA 2HB6A 1ZRSA 3OKCA 4FR0A 5CIWA 4F9TA 2PL9A 4R1TA 4HXEB 5JTUA 3IYLW 3PX7A 1ULUA 4FYPA 5JYDA 1OLXB 2HFKA 4UMFA 2FSVC 1V1MA 4FOLA 3BGSA 2BM9A 3H8SA 3KOWA 3PPXA 5L3VA 3WWPA 2O5RA 1BXGB 3H2ZA 1WSWA 2DWOA 3ETLA 1ZGCA 3OP4A 3ZG6A 4ESOA 1M54A 2G04A 1WUTA 3ZCRA 1K06A 2NSJA 1M2OA 3KPWA 4EQ6A 2QDKA 1JAYA 1KGSA 2PU5A 3A9RA 5ER6A 2BR3A 1KQFA 1HOTA 3IIKA 4WESA 2CDNA 2QN7A 3C39A 2N1BA 4XGKA 2ZREA 2F8LA 3AO0B 3GY0A 4H77A 3T0FA 1U0SY 2OK7A 3UXHA 2A35A 1DOZA 4RHTA 2R8OA 5B1IA 1KI6A 3HRHA 4PCAA 4ZV9A 2RKBA 3STHA 1NR7A 3D1JA 4OP2A 3T15A 4D8VA 5HW0A 4BVGA 5CMLA 5JAUA 2BUCA 3N3AC 4NHEA 1XRPA 2ZRDA 3K0KA 2J6CA 3QEJA 2ZUVA 3BDAA 2YYYA 3FVQA 2R1TA 4X97A 4Z4FA 1FYEA 1QJ4A 1XXHE 4DTCA 2BDTA 3LWZA 1SCIA 4FE3A 1YKGA 4JQOA 4TMKA 1NVMB 4UHDA 4WWHA 1RPJA 3BMCB 1ZBDA 2GF2A 1WB5A 3HLYA 3R41A 1Z3CA 2EJBA 3X1JA 1SKYB 3NTRA 4IQ4A 4W5HA 1UKVY 1OIXA 2VN8A 1QE0A 1SOUA 4XAQA 3KLMX 3JWGA 3K6JA 4LISA 4X64B 2IYWA 3MQ4A 2HJVA 4DDHA 3SY8A 1W1WA 3TLKA 4U9HS 1H94A 4J0IA 1NW9B 5BSVA 1ZESA 4EEKA 5FB3A 3H87A 1K9VF 2X14A 4CKEB 4ITVA 3ZN2A 1Z5WA 5KKCA 1ZIPA 3OMLA 3HADA 3K96A 1TQ8A 4NG4A 2E49A 4H15A 1KDTA 2FNAA 3GLSA 1OIVA 4FFRA 4G1BA 3EF1A 4D9GA 4HUTA 4ZYWA 1QGUA 4LNUB 1I1OA 1HLPA 2D7CA 1U2TA 1ECLA 3N8NA 2C9ZA 3IP3A 2QRUA 2QTRA 3LPLA 1IEWA 3F0TA 4W8OA 1LBQA 1RAHA 4JIGA 3OECA 3R3HA 2NZYA 2W9XA 4JUAA 3RS0A 2DCUA 1Q95A 5C5DA 1RRCA 4B3TB 5C7LO 3B20A 1YCFA 3BJMA 4PICA 3ZHQA 4RPHA 5KU1A 2NADA 4PZEA 2V3CC 1QG0A 2NZVG 5TRTA 3VR3A 1U1DA 3I62A 4JLNA 1GQOA 3LL7A 3AVTA 3EGXA 3C70A 1CJSA 3HXKA 1TAHA 4KV9A 2X2OA 2P2LA 3O47A 4EFKA 2P9EA 4WY8A 1J8YF 4KR0A 4AECA 1TA4A 4R3NA 2N9UA 3E3AA 2A1UB 1N2CB 1YRLA 2GNAA 1IC6A 3AL2A 2IVZA 3N1UA 3QXGA 2VQFB 4HYEA 5FPSA 2C3MA 2QQGA 2DKOA 1H1LB 2NSDA 3F9IA 3P9SA 4G4SO 1X2BA 2X23A 3U4HA 3USCS 5EEGA 3DDCA 1UXGA 4KREA 4IO0A 1ST2A 3BSSA 4GC9A 3KR9A 5EMHA 2GKOA 3NHAA 1XLTA 5DHRA 1RI4A 2B3TA 2WHRA 3DT9A 1VIAA 1EB8A 1C1YA 2BFCB 3EVGA 3HKCA 4OHPA 3UV6A 1FZQA 4D56A 3SFZA 1PG2A 3FZQA 4O4HB 4KVGA 4NDAA 4LV6A 3U13A 1B1AA 3EFEA 2XKBA 1JHVA 1FJHA 1ZG3A 4WCFC 1HDZA 4UU0A 5K6AC 3CIOA 4OI2A 1I10A 4E2XA 2JDID 3R6WA 3SVTA 1K63A 4C6TA 1JHYA 2M1XA 2IEYA 2PVCA 3HU1A 4B82A 4K9PA 4OQMA 4ESEA 3KYDA 1RIIA 3V3TA 1XWIA 2R751 3VTKA 2VKQA 2VOEA 4YIKA 3THYB 2OFPA 3ILSA 3FCAA 3OCYA 4E32A 3AJ8A 1WA5A 1DQYA 1N7GA 4ZC1A 4G56A 4MKZA 1RT9A 3X2FA 2P1RA 3M4YA 2OZLB 3RKSA 1C7ZA 3OTOB 2CL7X 1ZGAA 1UYJA 1HYHA 1KP2A 2AT1A 4RM3A 4RGBA 3GFGA 5ISMA 3EIHA 2VNKA 3ESZA 4YRGA 2FZKA 2J41A 1TD9A 1UDCA 3FHJA 3NXKA 3BGOS 5AXBA 4BU0A 4DNOA 2PIAA 5BSHA 3QKSB 4I2VA 2O1XA 1DVRA 1JXMA 2EKQA 1Z0KA 3TIGA 4BNDA 3NYQA 3T1TA 3S2FA 5I5EA 4E15A 3C3KA 2QTVB 5JSZB 1NYRA 4QRIA 3MMSA 5FI1B 3TOSA 4C6SA 1XCJA 2BT4A 5IK2D 2QTGA 1YBHA 2D13A 3IX7A 3OSUA 4RMIA 3RH0A 2G88A 4N9QA 1JS1X 4MW1A 2O5VA 4OM7A 1IN1A 1RRGA 4GMGA 4GZ6A 1R66A 4D6XA 2R8PA 2PRSA 1MC4A 7REQA 3IPLA 4ROSA 3R74A 5K0BA 5CB0A 5HKKD 3HDTA 4PPNA 1AMOA 3TVYA 3NUGA 4Y1FA 5CYGA 3KCNA 3PB3A 4IUYA 4RVCA 1BRTA 1EA5A 3FAZA 4A9AA 1V45E 3KJXA 4D3ZA 1RJGA 3GP8A 4XLLA 1QP7A 4MH0R 1MO6A 5C4GB 1T3TA 3FFWA 2GTIA 2H2GA 4CIYA 1CUXA 3TGLA 1DC3A 1FVHA 3A9UA 3AWIA 4KSYA 4ZVNA 1KC1A 2IZ7A 4DSUA 1EWRA 3AZQA 3ZWAA 4BNXA 1JLLB 3RC2A 1H6BA 2WU8A 2VTEA 5TQ0B 5IFLA 2CYAA 3Q2IA 1BD4A 2ZB7A 5AVUA 2I2AA 4R01A 5CNKA 4QATA 3T9DA 4TTQA 4EBBA 5EKTA 5JY1A 2ZSKA 4N76A 4UOZA 5F35A 2GB4A 3OPYA 3T9FA 4RF3A 2ZVQX 3LWBA 4JX8A 4ND1A 2YQ4A 2QXYA 1KAGA 2AMYA 4OAPA 4Y9UA 2Z83A 4AFNA 3KS9A 4LE1A 3MG9A 4GNRA 5JCOC 3B3FA 4GPZA 4A0SA 4J1SA 4TLAA 5BYKA 1G98A 3GRCA 4HKTA 5EZYA 2EQ5A 4ZVSA 4KV7A 4ZOQI 4CIBA 1LKZA 2F4VB 4OI1A 1RC1A 3BRCA 4DDMA 3WLSA 4ZANA 3GGDA 1UC5B 5TMDA 1LB1B 2HSJA 4GQAA 1S2LA 2IYSA 1CUCA 2DBYA 3VHLB 2QY6A 4FUQA 5C8VA 5CW2A 4C0JA 2OBMA 4QUKA 2Y1GA 2WHPB 2FZLA 5AJTA 4DV5B 1Q50A 1XT6A 3WGYA 4CTOA 3O8DA 1XBTA 3UJNA 5AKJA 4RTMA 1OH8A 1GU1A 2YRWA 3GB9A 1L5MA 3O83A 4C0QC 5KC9A 4AKIA 3GDGA 1WUHS 1ZMTA 2QSYA 3HN2A 2IJGX 2D0DA 1N2SA 2WUGA 4RLFA 3ESBA 2V7QA 5DTQA 4NF2A 4EYOA 4DG8A 5JISA 2EAUA 3L0OA 1NWCA 4URXR 2BVNA 4P3NA 1XX6A 2KWIA 1M1YE 4KIWA 2FGKA 1OREA 2OPHA 3CINA 3V1LA 2YV3A 4LRQA 2P4HX 2I1QA 4YMTA 5EERA 4L3VA 1G42A 3MQFA 4BVHA 2WMNB 1MABB 3C41J 3L92A 2QMZA 4YRFA 1N2EA 1VLZA 4GGPA 1YRHA 5DFAA 3UJ8A 3X1DA 3KT0A 1MW8X 1GFSA 2CVFA 10MHA 3OLXA 5AOAA 4EG6A 2EBFX 3ZE2B 2ZSJA 1LU9A 4IGFA 3ANMA 1QTNA 1EK2A 3CEHA 5J5AA 2QA5A 4LXIA 4XQCA 4GQIA 4N82A 2JAOA 4BNJA 5FOSA 1KYWA 1ZD5A 3BMQA 3IMEA 4IIJA 2ZANA 4OYYA 2AG8A 1L7PA 3BXPA 9ATCA 1ZI8A 2E87A 4AF6A 2HGZA 2P1ZA 3BD8A 4OAOA 2OOSA 1GFZA 4OGKA 2XBLA 3FPCA 1JEOA 3GA0A 3PXUA 3GPLA 2ZUUA 4F38A 4L85A 1I6WA 3BWDD 1ZJ5A 4GGMX 3IPRA 4TRJA 4DCVA 1WCYA 1CS0B 1I9CA 3H2JA 2G0NA 4OJMX 1NX9A 2GFQA 4WZBE 1DKQA 1GARA 3L1JA 3QEMB 5GZ1A 1YDMA 5ICEA 3F6EX 4HZUB 3UMRA 2J3MA 1L7MA 5J23A 1P0MA 3MCWA 5EQDA 4NQZA 4JC5A 1KO1A 1CT9A 1K8YB 1NKSA 2Y0BA 2EZUA 2HZ7A 1U7HA 3P9PA 4RTPA 2WA2A 3ZDDA 2OB2A 2UZIR 3LM8A 3LW8A 4OK5A 2EF0A 3HUFA 3ZLUA 1KYVA 1NTOA 5LQCA 1MXHA 1TRHA 2G1PA 3L7KA 3W4KA 5EJ4A 1CUUA 2DBRA 3NJ8A 4XD7D 4F3NA 3L43A 4IV8A 1TZKA 3C6QA 2B4QA 2D1SA 1WBDA 5E3IA 1U94A 2A7XA 3CBQA 2AZDA 4LY9A 1U98A 2HBQA 2VAXA 421PA 5AICA 3RU2A 5B7PA 3JYPA 3WXMA 4YRRA 1KK2A 4FZRA 3JRNA 2Z1DA 2EJVA 2X2PA 3DLIA 1Q44A 3FVRA 3C6ZA 4IZOA 4KU4A 4XVHA 3PV0A 1Z45A 2W00A 4Q1DA 1E2NA 2WTAA 5IUKC 2J4CA 3ASYA 3PFKA 1YQTA 4IJVA 3LLVA 1V6CA 1JNXX 2CFOA 3EZFA 4L3WA 2C54A 4MAMA 1DDOA 3CPEA 4WKPA 3S5UA 3STUA 4E5SA 1YE3A 2GJAA 5JNUA 1UFOA 1T91A 1G3RA 2HCTA 5CR9A 2J3LA 3KBBA 3L46A 3C97A 2HV9A 4CETA 3QVTA 2QN1A 4RY0A 2OYSA 3QJGA 3GPBA 2GSDA 2R65A 1CUZA 1UZLA 2QLTA 4O2AF 5F78A 3GWZA 5TF4A 5BN4A 1H22A 1T3LA 1W5FA 4KN9S 5DXAA 1T9DA 2ZE7A 4P3XA 1WU7A 3I92A 3DMGA 2XE8A 3RYFA 1D6JA 1DEHA 3DMFA 3M4JA 3SVZA 4YA6A 3VBEA 6ABPA 2B1QA 1JPJA 1TJ3A 1Y8RA 1NVKA 1DKUA 4P4SA 3ADBA 3AVUA 1EBBA 1ZUIA 2QM8A 3EAGA 3DMTC 2HTEA 3STWA 3VJLA 4J2TA 5ELLA 4ZPXA 3F6YA 4QIHA 3RYCA 3R7WB 4UBNA 1HE8B 4HF7A 5FFFA 5J5VA 3S81A 4QUGA 1N36B 2DF8A 1Q15A 3E0XA 4IMJB 4EUNA 3CRW1 2HLDD 4JR2A 2Q5JA 1FS5A 2EEPA 1XKXA 1SU7A 1UPAA 3GQBB 4TLLB 2B25A 4ND8A 4B2PA 1VG1A 3QNWA 3GZNB 3QFRA 1PWEA 1QO7A 5D1NA 3MGCA 3VTFA 1DZ3A 5SY9A 1XVAA 1Y8QB 3MAJA 2JARA 5LXTF 1MDFA 5ES4B 4WLNA 5FLKA 1NBME 5C52B 1I1HA 1WB6A 1KTIA 3PGXA 1G4AE 2GBCA 2IX3A 1AA9A 4G0WA 2HCJB 1SD1A 4I14A 4RVHA 4TQ9A 2NTVA 1QAMA 3E2PA 1G3UA 4JJGA 5EMLA 5HILA 3UK2A 3VPBA 1BA2A 1KBZA 1PAUA 1MO2A 4ZO9A 3WO0A 1INLA 4QASA 3CHYA 3DWIA 4REMA 5JBIA 5E6SA 3V42A 4PONA 3WFIA 4DCUA 5ITZA 2XR1A 3QA9A 3VTAA 3U1TA 1FS4A 2BGLA 1U7UA 3JZIA 5IN5A 5FXMA 4MTCA 5F1KA 4IDEA 4PSAA 3QZUA 2O3RA 3PKIA 3L8HA 3S2YA 3CKMA 2H1IA 3K0HA 1EWQA 2H0AA 3N2YA 1AO3A 3PFGA 1WQ1R 3MLEA 4RKRA 4W9RA 4WZAB 1Z8NA 3C3XA 5IEBA 1RXCA 2XNKA 3UNXA 2WJHA 2JLXA 1VLHA 2YZ2A 4KIUA 1BDBA 1G20A 4NECA 1CIVA 4V0OA 3JASA 4DMUB 2WTXA 4BO9A 5BQFA 5IC4A 3RS3A 1JDZA 1PJLA 1Z5GA 3DONA 5JFOA 2VJMB 1QU2A 4M9SA 5D8DA 3WXBA 1SPBS 4WECA 2GYWA 4PLFA 2HMAA 1C9EA 1LPBB 1M5TA 2N75A 2ZWMA 1S7GA 3F7MA 3HB1A 3MN1A 5FHQA 1N6HA 1JTVA 2HD4A 2JBAA 1KP3A 4HAOA 3RFUA 2PFGA 3K9LA 5KYNA 3JQCA 1CDZA 1BDJA 4RMGA 4DB4A 2WJIA 3TAXA 4D96A 3FG9A 3ZTYA 1ZR4A 1EK6A 1HQCA 1KMQA 2JCSA 1NF3A 2QE6A 4F4UA 1WUIS 4DBZA 3OFSA 5ULLA 4F3CA 1ZM7A 2R7NA 1L5LA 1Y9JA 2A1TR 3OZRA 4YRIA 5JS7A 3H19A 3RJTA 1OX4A 4F3TA 2VRBA 2YASA 1P2GA 4G86A 2W42A 3FY4A 3R0XA 3GNSA 3GLFE 4MVJG 1XAGA 2R79A 3KDSE 4CEJA 2QP4A 2IHYA 1U7XA 2BMJA 2PXXA 3IPAA 4J94A 4DF3A 2BFWA 4NPHA 1L5QA 2QMQA 3RC3A 3D8RA 1CLUA 3ACDA 4ZMSA 3QX3A 1BOFA 1FFBA 3MUNA 1R9JA 1D0VA 5CCEA 1ZJWA 3THWB 1PL0A 3B2NA 3TEFA 4NATA 1R0KA 5AVQA 2BFFA 1LWOA 2EU8A 3IIIA 3N2EA 1OE0A 4UBOA 4CL0A 1E96A 5BOSA 2IBMA 3WS7A 2BEWA 2DERA 3IWBB 4TQAA 3PUZA 1VJ5A 3DZFA 3TM4A 5C2JB 2HUNA 3WRWA 4B7UA 4BFSA 5BYBA 2J30A 1GNPA 2QYHA 1OAAA 2VYVD 2F43B 3N86A 3R0QA 1AQ6A 2C7VA 4Q1BA 3HCBA 3HHEA 3H8WA 3LYHA 6LDHA 4ZCMA 2PSEA 3DDWA 4D8TA 2WTEA 1S3FA 1V8DA 1U4OA 2JGJA 4HB3A 4XFKA 5EXXA 2OG1A 4XJVA 1EXDA 3RIEA 5HDQA 3KDPA 4CMJA 1LGYA 3CJTA 1N6OA 1BXZA 5TEVA 3DFKA 3B3GA 5H3HA 2QX7A 1VB3A 1WCIA 1QMHA 1FFXA 3WKBA 5IP5A 4F4DA 4ZHQB 4C2UA 3DW3X 2AOXA 5BUCA 4HWGA 2JIZA 4NK4A 3H2BA 3FVVA 5L4LA 1O9GA 2J7KA 2ZG6A 1UT8A 3G0GA 1Q7GA 3IDFA 1Z73A 4Z8XA 4AM8A 1OCEA 4BMYA 2Z2YA 3RBXA 2WZQA 4D4IA 2RBGA 3HRKA 2J09A 1Y3HA 4H60A 3LFTA 1IHXA 3AV0B 4B47A 2P5YA 3JQRA 4PQFA 4DKJA 2XTZA 4QT0A 4ZVQA 1L5KA 4AXXA 4BV3A 1O9BA 1W88B 2YY5A 4RM2A 4LGMA 1C0IA 1MX9A 5JSHA 2Y99A 3PE3A 1U8TA 4DJTA 4R71A 4AYXA 2JI9A 1P0IA 3PPWA 1ECJA 4LC1A 5JIBA 5KWIA 3NAZA 1I0IA 4J2HA 4M21A 3G0DA 3PJRA 1SU8A 4XIGS 5IWAB 3DZ6B 3RVJA 2I2XB 4P53A 5SY4A 3VR5H 2R6DA 4ETNA 2XDWA 1GN9A 4B4UA 4PXAA 1ZNYA 3BIXA 3IPXA 3Q40A 3QQPA 1FW8A 2BMEA 3ANSA 1XLUA 2P2ZA 4JJ4A 4L07A 2NTJA 4C7BA 4J1QA 2DPMA 2QRZA 3NPMA 4A73A 4P08A 3SR0A 4ZGBA 1XR3A 2J0VA 5AKIA 5BSGA 5KTYA 4XIFA 4YRDA 1R10A 2QMEA 3UXEA 5A7HA 1X1TA 5HSGA 2HJ9A 2Q4DA 4KITB 4QVIA 2Q41A 4RPKA 3AP3A 2IIPA 4RENA 3KQTA 4KLZA 3ZOZA 1JMYA 2VDLB 3M6VA 1D9XA 2WWRA 2YMMA 4X85A 4F4CA 3ZHXA 3T3NA 4B43A 2WF5A 4WJKB 2XA1A 1NUSA 2JLUA 8AT1A 1J23A 2FSHA 2BF4A 4TS1A 1QK3A 1WPXA 2X2EA 3K1AB 5GWXA 4DLVA 5KWJA 221PA 2J48A 2Q3BA 3MWEB 5FNVA 2IYAA 3RKRA 3GUHA 4LZJA 4UUPA 5F1PA 1L1FA 4RA9A 2ZB3A 2C8KA 3THXA 4KWEA 1XTBA 1JKIA 3L1KA 1DEOA 3ZY4A 3NTXA 4W1QA 4J4TA 2QJTA 4ZO7A 4UFPA 1YU6A 5TV2A 5HYVA 5I7UA 4GT1A 2OUKA 1QIFA 2D5BA 3NBMA 4GOND 3UMVA 2UUPA 3UB2A 3L4BA 4A82A 4HVCA 4B75A 1QC5B 4Q1AA 2ZJOA 2P1DA 3O4JA 1VGRA 3PI7A 1XZ8A 3B53X 1RYYA 2HWUA 3GVPA 3HZHA 4ENQA 3OJOA 3QTBA 4RVNA 5F9FA 3JATB 1Q22A 1XALA 2VNHA 3PJFA 3VO9A 3WLOA 4B33A 1PV4A 1WV0A 4CCWA 4Y8VA 4ARZA 3OO0A 3QA3E 2POCA 4PHGA 4P32A 1ZIYA 2VK2A 2PUFA 3BTUA 2B4AA 4ZJYA 2EVWX 1Z0IA 4J0JA 4OU4A 2C2OA 3Q3GE 4S2EA 4CQLA 3LKDA 1B6TA 4MI6A 3FSEA 3BDVA 5GOTA 1M2NA 3WJ2A 1Y4AE 5IG2A 4GWKA 5TIIA 3P9CA 1YVUA 2XE4A 5CTAA 3PUWA 3CSDA 3WWEA 4CT0A 2W6CX 1IY0A 4FOSA 1EUYA 2V55B 2BHTA 3MZ0A 2BGRA 1SMKA 4KQWA 1NQAO 4JR0A 1A8UA 3C3JA 4EEXA 1W29A 4NTZA 2X58A 1DG1G 3IQXA 2H5LA 3DTVB 3KVOA 3FTDA 2VPQA 2RGEA 4TPKA 3SZGA 3IAS6 4MKIA 4DDTA 4CMIA 4HD8A 2C77A 2GVNA 2C92A 4RFSB 3CONA 5JCJA 5THQA 1H2BA 1P2BA 1CEXA 4JLDA 3D8BA 4OQEA 4F2WA 5JPIA 4EF5A 1DTSA 2HIHA 1II0A 1KY3A 4M1WA 5C1IA 1Z26A 3ONDA 3T0GA 3T3MB 1ORTA 4COKA 5M6DA 1I3MA 1W59A 5HGXA 1PR6A 3TLZA 5HUJA 4LAFA 2SCUB 1AN9A 1S02A 3EQ2A 1DRJA 3TPFA 5KNBA 4JDUA 2UYYA 3EFOA 2ONKA 4ZYZA 2WZCA 3IV9A 3GRFA 3HU3A 3OOYA 2PS1A 1ICIA 2O07A 3FTNA 1Q91A 4KLAA 5DXFA 3M5DA 4NCXA 3UHFA 4ETWA 2QW0X 2XCIA 3AHJA 1CCWA 1HFKA 2I91A 1C9NA 2C59A 4GMKA 1JPNA 4HT3B 3I2JA 2CLKB 5E6RB 1AKMA 3O8NA 2WHQA 4OV6B 1ZXXA 4MNTA 4FYWA 3THRA 1YHZA 3NBZC 5DHTA 4AG6A 4Z4QA 1DC6A 1KOFA 3L4EA 1TYDE 4XYBA 1TECE 3W7BA 4YDSA 3CXRA 1NUHA 3KG2A 1WLSA 2WJJA 3R75A 2O0LA 3HZZA 1I4LD 4JWTA 2GEBA 5K4GA 4EZIA 3P0IA 5B1DA 2QG6A 1ACJA 2J3JA 5E0KB 1CULC 4P4TA 1XF1A 2C31A 1L5NA 2IZZA 2ZUBA 4TL9A 4Y9DA 3ZK7A 1T8UA 2RAUA 3C8HA 1M1ZA 3N8GA 2Q9UA 5EZYF 1IXKA 2BFOA 4CODB 4DLYA 3DC2A 4R1UA 2CB0A 3HPQA 4XA8A 1UBTS 3AVPA 3OFJA 1EX9A 4HEQA 4CG1A 1N7IA 4GPAA 3CKKA 1A0OA 4JLJA 4UARA 3WLLA 1C1HA 5BSEA 2OTCA 3REQB 1UMCA 3ZGLA 4DNPA 1KEZA 1SFRA 2BZ0A 2VTBB 3G0OA 2Z9DA 1ECFA 1T9GS 2AXNA 2WYVA 2WP8J 2DPHA 1PKXA 3QVUA 3F9RA 3JZMA 1K66A 4BTVA 2FHSA 4GL2A 5GMOA 4XGRA 1MORA 1GGJA 1GR0A 3SBOA 3U7QA 4DC0A 3QVJA 1ZOOA 3NYWA 2DWCA 1BW9A 3E7XA 4DA0A 3MTQA 3H7AA 1U7PA 4LV8B 5EQFA 6YASA 5EP3A 3TD6A 5CVJA 3UHPA 3WWOA 1JHQA 1NUTA 2WU4A 1I79B 3HN6A 3NHPA 4IJQA 5K2MA 3IBSA 1CUAA 4GX2A 1T4DA 2J9ZB 5JLJA 3J7AC 4KYUA 1VL6A 2MINB 4P2GA 4M1MA 4E46A 1Z74A 2W2KA 1E6EA 2PLWA 4G5QA 2PH3A 1CHDA 4LXHA 2Y05A 4RKFA 2VXCA 3PU6A 3WBFA 4XGQA 2FP4A 3AJ9A 2HCBA 5EKXA 3UC5A 5CK4A 1I7BB 2VTDA 5SZKB 4KRFA 1U2EA 2JBWA 3KQNA 3UM9A 4G85A 1QDEA 3U3DA 4LXYA 2LRHA 3TQCA 4E12A 4IIXA 2CFCA 5HVNA 3CZ4A 3QIVA 4H16A 1M1NA 4IIJF 4WK6A 3TSCA 2J0UA 3CLUC 4WY2A 1RKXA 3SZOA 3HVRA 4KGVA 4HZGA 1BEUB 2DQSA 3TB6A 2VWQA 3NFRA 4ZXPA 5JS1A 4II7A 2IE0A 4W6ZA 4L5BA 3RUFA 2C4NA 1ZWKA 3RU3A 3N2NA 5KOYA 1TZBA 1L5OA 2EF1A 3A06A 5DHAA 4QDJA 4Q9LA 3JARB 5CVVA 4REOA 5CFLA 2Z3ZA 4EUKA 4ALJA 4CKWB 3HO6A 1B23P 1JIUA 4O5OA 1R0WA 4FLEA 4F1WA 2JFQA 2OB1A 3B9PA 2E4ZA 2X4GA 3EXHB 4J7UA 2W6ID 5IHPA 5DCWA 4QTYA 1U2GC 3INTA 4JS0A 4UHKA 1C29B 1KBOA 4GEKA 2O0KA 2FN8A 1JDPA 1QFXA 2ZSBA 3FYUC 4IDFA 1ORIA 4RD1A 4M7PA 1GRVA 4NZNA 3F3MA 5KIAA 3N2KB 3EGVA 1RXUA 4D82A 1ZUNA 4KQ9A 4UEJA 1AGXA 1SK9A 3MTEA 5EWLA 1G5QA 1XQ1A 4RVSA 1GKUB 3CCCA 1P5HA 1T5HX 3D7NA 3WNZA 4ENWA 4ZOAA 5ADWA 3K92A 1DAMA 2VF4X 5TPWA 1LUAA 3OE5A 4MS3A 3CR8A 3DYBA 1BROA 3O93A 5FBHA 5BRNA 1T25A 1OKKD 2PS9A 2I3DA 3ZGNA 3URKA 2A8YA 2QTWB 1I1QB 4IQGA 4JJ7A 4OCZA 3UANA 5L6MB 5LIRA 3TSZA 4H18A 2RJOA 3C3CA 4YP0A 3RGWS 4OIFA 4YAWA 5IJ0A 3B1JA 4MWGA 5LP6C 4BMOB 1TUBB 1YR7A 5JYAA 4DXAA 2GRUA 4B7XA 2QY9A 1NHGA 3FAKA 4JVNA 4NJMA 3K0EA 3TEJA 3RVDA 1PK9A 4GGOA 4JODA 5LYJF 1CZHA 1MB4A 3AXSA 5G40A 4KQJA 1RTKA 2J8ZA 4ROTA 3SSAA 2AJCA 1Y1SA 1T35A 2XNHA 1I30A 3NKFA 4CI0B 1ZM9A 2FW8A 4OLJA 1GTZA 4IP0A 1J39A 1MOSA 1FC0A 1FNSA 2OILA 3N8IA 4TRMA 2P2CA 2DBZA 4YCSA 4GXNA 2FFQA 2G4CA 3AONB 3CEPB 1CZKA 2VAMA 4R3UC 3IIEA 4AP6A 5C5IA 3LUHA 3S29A 1ZH6A 3HGMA 3IA2A 2H4YA 1YZGA 5K0ZA 1DEXA 4RA6B 1Q17A 1JE0A 1KY2A 2W2LD 3B1FA 1MVLA 5K8LA 3BE4A 3IUNA 1N8KA 4HJRA 4PPGA 4X24A 1FUYB 2ZETA 4IR7A 1KK1A 2PKQO 1ZK0A 3TPCA 4MGZR 3NC0C 5FYQA 4X63A 3TQHA 1Z34A 3Q4GA 4AMGA 5KVVA 5LQRA 3BZWA 5EJ9A 3QUBA 4HQRA 4WAUA 3DLBA 3AEUA 3MWKA 5B2ZA 3I9LA 5ICGA 4L4SA 4NRDA 3W04A 3ZNNA 1Y3FE 4PLGA 4RSGA 3HP7A 1CY8A 1E3LA 1NT2A 2Q5HA 3AEKA 3HR4A 3P9YA 1G16A 5D87A 3CVYA 3OE7A 1SH7A 2PSHA 1X92A 3ZE0B 5IJ9B 1ZM4A 5LB2A 1YRQA 5CDGA 2QG9A 3VH1A 4BGUA 4JQCA 3IOYA 1QK5A 1S01A 1AVTA 1XZKA 3LQQA 4ZEWA 1AHPA 4F6LA 4ZIRA 4Q4JA 3BIOA 1BWQA 1ZO8A 2OD2A 3AI1A 3KO8A 4KX5A 4KPYA 3W5BA 4LXTA 1SCUB 2YVUA 2Z2ZA 3ZXSA 2JKZA 2ZRQA 4AYTA 4UQOA 4BGVA 3WK8A 1KIAA 5ALFA 3FH0A 4K8OA 2DSNA 1E2MA 2BCEA 4JT8A 1CUWA 2CFRA 1E9DA 4JJKA 1NONA 5HCNA 1TVKA 3NTOA 3EPRA 2HQBA 4PQEA 1PR1A 4F7WA 1DC4A 3KE8A 1M8FA 4LC0A 3ZV6A 1JFVA 1RI3A 1VM6A 2BMFA 1QF6A 2J4DA 3ZY2A 2P90A 4DLBA 3M1YA 2GYUA 4XDZA 2ZJ1A 2ZM6B 4RF4A 1D1QA 1T15A 4FFNA 4R8RA 1JAIA 5TQ2B 3ZVRA 3VU3A 4B5KA 4RZQA 2JLRA 1WD7A 2I62A 4QBGB 5M29A 2QRHA 1KPGA 1LLCA 4RQBA 1NMZA 2H1WA 4AMZA 2HA6A 3SICE 4X8MA 1VE6A 1YDGA 2W4MA 3GJ8A 4RELA 1V9SA 3AI2A 3RVPA 1GZ5A 3HM9A 1D7OA 4AUNA 1P2DA 4URUR 4ENSA 3I01M 3OEHD 1P18A 3COYA 2QR3A 1LV7A 1ZZGA 3F7OA 2JBHA 2NU8B 1X86B 4J7AA 1QFMA 2BONA 4AP5A 1KSJA 4NU0A 3RFVA 5I7WA 1OLUA 2O50A 3HYTA 5EZQA 4JBWA 3RASA 1Z33A 1L7XA 2CMKA 2PZLA 1QH0A 4TV9A 4OHBA 4XX0A 2M6KA 2CZGA 3VAAA 3ITEA 4YDRA 5KTNA 3HSSA 1SQFA 2WSBA 4LYYA 5KJFA 4B6FA 4E07A 1ODJA 1P39A 1QIKA 4H6PA 1J25A 4G4JA 4NBUA 2PS3A 1M2GA 3V1TC 4WVLA 5KYWA 1G19A 1ZXBA 1WEKA 3GJRA 3RBZA 3U61B 1H1DA 3KQYA 4MZXA 1QGOA 2FETA 4UTXA 1B16A 4TYYA 1A8SA 1VLJA 3OBBA 3R4VA 5IVDA 1N25A 1O6FA 2PQ0A 4U6SA 3A2KA 3T52A 4B35A 3GRKA 1P0QA 3L7LA 4LSGA 4JI1B 1XEXA 2R4QA 1R6XA 7YASA 2Q2OA 1A9ZA 8MHTA 2VHCA 1BVRA 4WOJA 3KB1A 3EP5B 3D6JA 3G2JA 4B2IA 4QG3A 1EZ1A 3TGPA 4HN9A 2DM6A 2G9QA 3EZ2A 3E9ZA 5B58C 2FEPA 4OUDB 5L3QB 1UJNA 5AK3A 3WFJA 5BMVA 3H1GA 1J5PA 3P97A 2J45A 1GLNA 4O4JB 1KMNA 3KAQA 4JL6A 3EDMA 5CH5A 4YJFB 3X0DA 4W5TA 3M4XA 1AZWA 1CP3A 3CZPA 4L2IA 1SUSA 4LOJA 4OXYA 3HY6A 4Q34A 1ZFNA 4OA8A 3FCUB 4IBOA 5L45A 2DB3A 4TKLA 4P0PB 3B9BA 3A1EA 5FL7D 3MS7A 1XVTA 3TCXB 4QBKA 3VYVA 5CEJA 5B5SA 2BW0A 2R1UA 1CYDA 2H63A 1N0HA 2XMQA 4PR3A 1TK3A 1HL7A 1KE1A 1RM5A 2VDOB 4ZKEA 4DWWA 1D9ZA 2W2OA 4Z1MA 1YTLA 3MGAA 3CX7A 4L6CA 2P3QA 4B44A 3H11A 1VQ1A 2J7PD 3TAHA 1G291 3L01A 2F67A 3GGCA 4RQUA 1DCKA 4YI3A 1UAGA 1L5SA 5CDFE 4KHZA 3WNVA 1QFYA 4UM9D 3GMTA 4MVWA 3B5IA 4QLBA 4AI6A 4KQ2A 4GE0A 1NP6A 2V6JA 3LDUA 3R5HA 5FBWB 5AM3A 3LTNC 4I1YA 5IBCA 2YMLA 1M2OB 1RBQA 2OHOA 4DM7A 2I7VA 5D3KA 3N8KA 4EQ6B 3JAWA 1JA1A 4QBTA 3NOVA 5J4VA 1VFPA 2H6EA 2WZBA 2A92A 1MRZA 3WZLA 9GPBA 3VVLA 1I7QB 2MDTA 4G1UC 2X15A 1QQTA 1UDXA 1Y9DA 3FNFA 5FWYA 2I34A 3FHLA 2X2FA 2EFGA 4PLHA 5AKGA 2X5KO 1ISIA 3P45A 1KI6B 2B20A 1YFLA 5BPHA 3HR8A 3VKFA 4YROA 3L7YA 4DRYA 2C98A 4GSYA 5L9AA 3I2YX 2AF3C 5DGTA 5KTMA 3VA7A 1QDLB 1ENPA 1ZCAA 1WPQA 2R1TB 3FUVA 2I9KA 3HB4X 2EZ8A 3LP6A 1B74A 5EOVA 3G5MA 1A04A 1KIFA 4ZJUA 4G24A 1RSZA 4MCIA 4LX0A 2V5VA 1E2DA 3MSXA 4NE7A 3AUXA 1VPVA 3G6WA 1JTEA 3EFBA 3PHBE 2XH8A 4P98A 2WKWA 1RHKA 1XDUA 1ZJ4A 2I4NA 5A4DA 5ICMA 3KB6A 2G4VA 3MAGA 3SQWA 4LS3A 5KVSA 4F86A 1HM5A 3U3MA 1KNXA 2YZMA 1P33A 3HCEA 1N5IA 3N0TA 5K6RA 5IAGA 3H1AA 4B5LA 3Q85A 3PWSA 3TR5A 4EI2A 3E6AA 1DQNA 2DKNA 5AKZA 2QYTA 1GUDA 5HEKA 1HV8A 4G01B 4C3VA 2NGRA 4RADA 3DPSA 3PT9A 3QEOA 4F1KA 1QPBA 4JP2A 3U81A 1LVGA 2G76A 3R7SA 2OC9A 3DG9A 1DJNA 4MRAA 3GT7A 3WMWA 1FTQA 4EUHA 1HNNA 4UNRA 3DL2A 1Q77A 3DLHA 3EJ6A 4M0FA 4I0WB 3HO1A 5FPKA 3KUCA 1TF7A 4H17A 1QGUB 4KNWA 2CLMB 4HJXA 3AJDA 5LLSA 2F8TA 2VJYA 4FX2A 4ZEVA 1XFDA 3UQYS 4C76A 1KI2A 4GS5A 5F21A 1YA6A 2VNIA 3GLIB 5F5LA 1OFTA 5H02A 2W2PA 2AMVA 3WK9A 2A88A 5ERYA 4XM0A 2PRYA 4N9WA 3L49A 3NJRA 1A8PA 1U3VA 3CVOA 3KELA 3M0EA 4JXKA 4B8ZA 5ECGC 3E61A 4G41A 1FF9A 3LTEA 2OT3B 5IVIA 4POOA 4LV5B 4I9HA 2J1LA 3EP9B 3G5TA 5KYGA 2GZAA 2FPOA 4XZ3A 1XRMA 4MJXA 3WL8A 1GPWB 4BNMA 5F7ZA 5CCXA 2C2GA 4JIMA 3ZZMA 4YUYA 4Q9JA 2IU4A 2GM9A 4BNTA 2ZWVA 1MHPA 1IMOA 2JRLA 2P7HA 3NHWA 3TLJA 5CJJA 5A0VA 4PLWA 1ZUWA 4EOGA 1OBFO 4EL5A 3SSMA 3KXKA 2EX0A 1VP9A 1ZGHA 4E5PA 5HJ7A 3K9HA 2H59A 1JEEA 1LF0A 2ZJ2A 4O1MA 1NA5A 3I0MA 2RGCA 6PFKA 4QDUA 2GZRA 1A7JA 2VHVA 4ZQCB 2WIGA 2ZUEA 4W7IA 3WNDA 4PGGA 1MAAA 4IIUA 2VF2A 1JYFA 2XTJA 3CR7A 3N0VA 4M37A 1E79A 3V46A 3W8DA 3ZHSA 1MQ9A 3GL9A 3OX3A 5KOHB 1PJZA 4Z0PA 3ZCSA 3KPJA 4WOCA 4YUVA 5SICE 4DJFC 3D0QA 4LYJA 1HTTA 4P2BA 5LOVA 1XU9A 3BHNA 2DWUA 1MT3A 2IHUA 4CKYA 3NBQA 1IZZA 4G4IA 3IJRA 3RS5A 1M75A 3ZH9B 4C6TB 1FDWA 1UP6A 2Z5FA 3QI7A 1Q21A 1VBKA 3PA8A 5ALSA 1UKAA 1GAQA 1TMGE 2FJUA 3E3NA 4FKBA 5EE9A 4ZCLA 4GKJB 3JQ7B 5A03A 1P1IA 2EJCA 1ISJA 3VU9A 3A4TA 3KIPA 3RTAA 1T8PA 4GMFA 2WQZA 3M82A 4IWNA 4UDOA 1LRLA 1ZIXA 1BE6A 2CBZA 4P7JA 4C20A 1PQ4A 5CPFA 3EH1A 3LBIA 4DEXA 3TL6A 3L40A 3GH3A 4F85A 1RRKA 4L16A 2ODQA 3CVJA 4PRKA 5DI3B 2JVKA 1G9XA 2HX1A 4AMBA 2QSUA 2JIBA 4MKHA 1J09A 4PC6A 5TGDA 3W2HA 3ABSB 4FWTA 2RI6A 1NLYA 4NV0A 4OP3A 4Z4IA 4ZI7A 2GPNA 4HSGA 1IN7A 5JROA 4CEHB 4MYRA 2VBFA 2Z43A 2H7YA 1BAPA 2QQ5A 3E3LA 1GRNA 2GEVA 1Y4UA 3G85A 3IHLA 3KR2A 5FKJA 1XRLA 3H6HA 1SA0B 4N4AA 4IFEA 1Q7CA 4J0GA 1CVIA 4R41A 1GKYA 1L4KA 4J0QA 1ZD8A 4JV5B 3QW2A 1TX4B 4MQMA 2XQKA 5DNCA 3ZDFA 4X61A 1XNJA 2CNKA 2C0CA 1LI7A 1T8SA 4M8KA 3IKLA 1I5EA 2HT1A 4IKEA 1W6UA 2MYNA 2HPHA 3EVCA 2AI2A 1WWKA 3L0CA 4H4EA 3TWOA 3QU7A 4BV9A 3KFLA 3A32A 1T1SA 4GSKA 2P2SA 2FLKA 3NHKA 3HEAA 4IZHA 4Y2HA 4OOEA 5ALNA 1IY2A 3F96A 2XMGA 4R83A 1UBNA 3ZCQA 4ZVOA 2ODEA 4N47A 1T43A 2PH7A 3C15C 3TIXB 5T6BA 1RYHA 3WO1A 1FIUA 3E3MA 3VMFA 4I6GA 4MWOA 1I3OA 3KFXA 1O3YA 3O7WA 4H7HA 3PYLA 2BGJA 2GJ8A 2WJWA 2XMBA 3MYRA 2WAAA 1KJJA 4P3YA 3LQFA 3DMRA 4RTQA 5JJCA 2UZ4A 1ZK4A 1ZLYA 3KJIA 2PMEA 4B81A 2PM8A 2UUCB 1LK0A 5MN5A 1NWHA 2G5PA 3LPAA 2X0JA 4K6FA 1PS0A 2IZ1A 3I9NA 2JGDA 3IAS1 4UNPA 2O8EB 3BFPA 3CV3A 2VLIA 4ZT7A 3ZKWB 1F60A 3IKTA 2JLWA 2ZQZA 4F96A 2HO4A 1XZHA 3QYPA 5JCXA 4I81A 4R3WA 2H7CA 2JFFA 3LXUX 3GEPA 2ZIGA 4W7SA 3S55A 3LXXA 1ZD2P 2UVDA 1J56A 5B7GA 1M83A 5AW8A 5JMPA 3WDKA