3E6AA

Crystal structure and functional analysis of glyceraldehyde-3-phosphate dehydrogenase from oryza sativa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
334
Chain Sequence
KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and Functional Analysis of Glyceraldehyde-3-phosphate Dehydrogenase from Oryza Sativa
rcsb
source organism Oryza sativa japonica group
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
total genus 84
structure length 334
sequence length 334
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3e6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e6aA01
4XQGA 4YDRA 3WGYA 2GYYA 1WVGA 2H9IA 2JL1A 4FOOA 5A5FA 1U1IA 1E7YA 2DUUA 5A05A 4LRTB 2AEFA 2VWQA 1B8PA 3CMMA 2ZB7A 3QHAA 4IJWA 4WOKA 1L1FA 2DBRA 3QY9A 2O2SA 5BNIA 2WE7A 1SB9A 1ISIA 4R9SA 5A9TA 3GHHA 3JQ7A 1P1KA 3H65A 4E12A 4XJSA 5JPIA 3WJAA 3E1KA 3Q6IA 4UUPA 1E3SA 2BFAA 3KVOA 2YV3A 1GL3A 2VNAA 5CP8A 5U1PA 1JDJA 3QRWA 4L9RA 1FDWA 3INTA 4UAGA 4HY3A 1X0VA 1OFGA 1I2BA 1CEQA 1KY4A 3PHJA 3QP9A 3WIEA 1PGNA 1UDBA 3EGOA 2W98A 5DNAA 1AHHA 1ZH8A 2JFHA 2R6JA 4FGWA 4R16A 4DYDA 2FR0A 1I3KA 1P44A 4YRAA 1JVSA 4UEKA 5B4VA 1KBZA 4F45A 4IY1A 1PS9A 4D46A 2BLLA 2O3QA 4R01A 3RU7A 4KZPA 4GGOA 1SAYA 3JQGB 3UOGA 4MKZA 2VT3A 4YAGA 4XRRA 4BNUA 3AY6A 3BHJA 2WSBA 5KVVA 3HFSA 1SEVA 1CJCA 1DLJA 3E9MA 2ZJ1A 3PDUA 3A4VA 1Z82A 3NRCA 4J9UE 1BSVA 2CDCA 3U62A 1C0LA 3ZWOA 2ZQYA 1YQDA 3S1LA 2QHXA 5EERA 2CD9A 3RC1A 3AU8A 1GZ3A 3E48A 2JHFA 3R0IA 3VVBA 4C7JA 4PLCA 4K6CA 2CVQA 4YB8A 2HAEA 3SEFA 3WGHA 3CIFA 1MX3A 4EJMA 5T5QA 4Y6RA 3CH6A 3DZFA 3DBRB 1LEHA 1RKXA 3TQHA 1JQBA 5KNLA 3MJ4A 4HUJA 5DULA 4NH4A 1UZNA 4R1SA 3DO5A 3I9JA 2DU8A 2OO5A 5IJZA 4FDAA 1ZBQA 1GU7A 4KMSA 4QQRA 2A94A 3GF4A 4JN6B 4PN3A 1I3LA 5L40A 1H6CA 3AI3A 3WIDA 3ZN2A 1DHTA 1JLLA 5F5NA 3T4EA 1AXEA 1Q7GA 2WEKA 4OAQA 4GL4A 4MVJF 3AK4A 4Y6SA 1KEWA 4AJ2A 4N5LA 2YHIA 4MVJE 4OQYA 1ENZA 1F0YA 4JGBA 5F3RA 4CMHA 9LDTA 5HS4A 1XHLA 2OHXA 4I1IA 4XGIA 4EUFA 1FK8A 3OSUA 3ZU4A 4LGVA 1XYGA 4Q3EA 5DBGA 1FXSA 4O6VA 4Z6KA 3MCVA 3DFZA 2NU6A 3W4KA 4BB5A 1Y5RA 1DAPA 4RVFA 3HZZA 3RROA 3GUYA 3UKOA 4S1VA 5HWSA 1F17A 4JIGA 3W1VA 4DGSA 3GAFA 4B4OA 3KRTA 4CQMD 3EHEA 4LMRA 1MXHA 2EKQA 2B69A 4B7XA 2C07A 4WASA 3GNTA 3TFOA 2Q49A 1QYVA 2Z1NA 5JFOA 4E5NA 5EESA 1T2DA 1U3VA 3FRJA 2D8AA 2Q99A 4E5MA 1A9YA 4Q9NA 3FR8A 4YJDA 1ADFA 1R0LA 1Z74A 3PHLA 5EINA 1HSZA 1R0SA 1KYQA 2NUAA 3C7DB 2D0IA 2AEMA 3BXXA 5CPFA 4NK4A 4N18A 3ZWMA 1MP0A 4A5OA 1IUKA 4HNGA 1ZCJA 3GMSA 3ZU5A 3I4FA 4II2A 1Z45A 3W6UA 3RAJA 3BIOA 3GEGA 1ARZA 2BI8A 4PVDA 1E5QA 2AA3A 2FY8A 5JDCA 2ZJ0A 2NU8A 3QWFA 3G0OA 1E1KA 4RPLA 3DZJA 2BFPA 4U6SA 1MG5A 3WLFA 4RZHA 2W90A 3UN1A 1E7MA 4TZTA 3ZZNA 3Q3CA 4DIOA 5J23A 2NTVA 1PJ3A 4K26A 4FFPA 4WLOA 2DKNA 4CM3A 4C4OA 3C85A 3Q2KA 2BKAA 3RUEA 4IJUA 4ILKA 5BNFA 4NBVA 2Q4BA 1I01A 4K9DA 4I9UA 1Z6ZA 2BGLA 1ISMA 2OXIA 4ZICA 4MPDA 3C3XA 3VZRA 4BNJA 3ZU2A 4BMNA 4XYEA 3F5SA 1U7HA 2C2YA 3GVXA 3I3OA 3UW3A 3WMXA 2BHLA 3BTUA 4OO3A 1VJTA 1WXDA 5I7VA 4Z0PA 4ZGWA 1ISGA 1Y81A 3DBHA 3GVIA 1ZFNA 2PH5A 1ZK1A 4JBHA 4U6QA 2BGMA 2WJPA 4WEQA 3SX2A 2PZLA 4RJTA 1KEPA 4B79A 1ZK0A 3ZNPA 1ADGA 4MP6A 5G4LA 3L0DA 1IZ0A 4HP8A 5CPBA 2PGJA 1MFPA 5F1PA 4H16A 2ZIZA 4H3VA 4XEHA 3AM4A 1F14A 2Q46A 2XAAA 4Q3BA 4ONEA 3ITKA 5CDYA 4JXKA 4J7CA 3RUIA 3GUCA 2DFVA 3I52A 3DZBA 3AUUA 3QWBA 1XU9A 4A26A 4XDYA 2X5KO 1K6IA 3E6AA 1SBYA 3OETA 2E82A 4UUOA 2X1HA 4B3IA 3I9OA 3SBOA 3KEOA 4PCVA 5ER6A 3PRJA 3VC7A 4PG7A 4BO3A 4D79A 2ZB4A 1PEDA 4NI5A 3JYPA 2C7VA 2X86A 3KYDB 5DZSA 1UXIA 1U28A 5C5IA 5L9AA 1ENYA 4B7CA 2FSSA 4BO8A 4RZIA 4URFA 2XPCA 2OFPA 5DF1A 3GDFA 3RASA 1NNUA 4Z3KA 1EE2A 2PK3A 4PLYA 4CLRB 3HQ4O 3WR5A 4H15A 2DC1A 2YQ5A 1LI4A 3DMTA 1O9BA 3GRPA 3PK0A 1M6HA 4CV2A 4J91A 4TVOA 3DB2A 3K8ZA 1A27A 1H6BA 1FDUA 1WP4A 2IYPA 4HWKA 4R1TA 1J0XO 2OL4A 3B1FA 4BNGA 3TF5A 1IHXA 3HSKA 4L75A 4PZCA 2HU2A 4CM1A 2R00A 3NTQA 4CUKA 3L4BC 4YXFA 1IL0A 5TLSA 1AGNA 3G1TA 1M2WA 3KV3O 2B35A 3MJEA 4IGEA 4NPCA 3PZBA 3ZW9A 4DL9A 4DVJA 5G0VA 3TFQA 3WNQA 4PIVA 4AJJA 1W8DA 1QSGA 2HSDA 3GN1A 2O3UA 3KO8A 5F1KA 2EKPA 3I6QA 3JQCA 1PL8A 4MVJM 2RH4A 3PYLA 2PZKA 2VQ3A 3JYNA 1X7HA 1ZMTA 4TZKA 3UF0A 4CUZA 3KZVA 1PL6A 5DBIA 1ZKMA 4ALMA 2A9FA 4CLOB 1W73A 3HDQA 2CVZA 4W7IA 2AQ8A 4P4NA 4GLLA 3QVXA 4BNXA 2CFCA 2ZATA 1PJSA 4AJEA 3BTVA 1BXGB 4RQTA 3NTOA 1EDZA 1ZUD1 4CLHA 2W4QA 3H3JA 2RBEA 4NFHA 5BQFA 3QJ5A 4DQVA 1P45A 3LC1O 2ET6A 5IDXA 5ER9A 4MVJD 3AI2A 4UREA 3L6OO 3RVDA 3OJ0A 3PPIA 2A92A 2Q45A 3ZGYA 4E31A 3KXDA 5IXSA 3OIGA 4GH5A 5T57A 1GYPA 3WGTA 1R66A 4GKBA 4F6CA 4YQZA 2ZTLA 2IEDA 4WPGA 4DBVO 1WZEA 5KJ6A 1SOVA 2GNAA 1K6JA 5C3MA 3F4LA 2TMGA 5ICSA 3K9QO 1CQJA 4XGKA 5IXYA 4NBTA 2YV2A 4RVGA 4JQCA 1XQ1A 3ZI0A 3KYBA 3FCOA 4M87A 1B8UA 4CMIB 3WWYA 4BNLA 4M86A 2VZ8A 4EUHA 1FF9A 1H6AA 1ML3A 3EYWA 2X8LA 3AFNA 2EERA 2FPPA 1PR9A 3N7UA 2YW9A 3ZHBA 2CNBA 2X4GA 2EG9A 3V2GA 2I76A 1JWBB 1Y6JA 4YRDA 4FSHA 4IJVA 1YB5A 4EW6A 1MC4A 2G1UA 3JQBA 4MP8A 5CDUA 3U4CA 2C7GA 4QX6A 4QXMA 5JSFA 4DQXA 4N54A 1E1NA 2HRBA 4BV8A 4GWKA 4DPMA 4CM4B 3DHEA 1QV7A 1ZMOA 1X0XA 1PR3A 3MEQA 3GFBA 4YTEA 4YJHB 1FDVA 4J2OA 3WTBA 4FS3A 3RKRA 3GHYA 5BSEA 2QZ9A 1QR6A 3F46A 2B5VA 2PD6A 3O8QA 4YAEA 3U3XA 1MV8A 3TZKA 3HB4X 3LDHA 4AJOA 5CG1A 4WUVA 1B7GO 5EQFA 3VDRA 3E03A 1PIWA 3GVCA 1LDBA 1J5PA 4NJMB 2Y0DA 1DFIA 3FD8A 3PWZA 4YR9A 5ITVA 3SLKA 3GA0A 2C5EA 5CDGA 3QWAA 1UXKA 2PA3A 1HDYA 2B4QA 4KWIA 1U3UA 4YT4A 5JC8A 1TVEA 2GCGA 2AEJA 4BNFA 3HADA 3C1TA 5ENVA 1KETA 2F1KA 3RC7A 5A03A 2VTEA 4GVLA 3G49A 4EEZA 5I8WA 2DLDA 4IDBA 5F1OA 4E30A 1PU2A 3HE3A 3LC7O 2JKVA 4PLHA 1B15A 1KEVA 3DZGA 4IXTA 4Z9YA 5JAZA 5IZ4A 1N7HA 2P2SA 2IRWA 3JTMA 1LSOA 2IDZA 2Y0CA 3P2OA 4MVJP 2CF6A 4BUCA 2NLOA 3QVSA 2C54A 3PYMA 2NWQA 2YHUA 2CSUA 4U5QA 1I30A 3HNPA 5CEEA 2DBZA 5T67A 1W4ZA 1TB4A 4IDGA 4OH1A 4NBWA 1JAXA 4RQUA 3MOGA 1OAAA 2J3KA 3LVFO 3QV1A 3HB5X 4E21A 3PDJA 3AOGA 4DBZA 2O3JA 3WFIA 4M89A 2HCTA 4KOAA 3WJ7A 3ZV5A 4I9HA 4ZQGA 3INRA 1Q7BA 4GQAA 5U4QA 4Q39A 1NHGA 4RCVA 1PJ4A 1I36A 5BSGA 3H9UA 1TT7A 1B14A 1PQPA 1Y8RA 4NBRA 4UVGA 5ADHA 3OBBA 3JD0A 1LSUA 4OL9A 4PLPA 4ESOA 3UGKA 1XU7A 1GUYA 2EGHA 3CMCO 3QVWA 4PLZA 2VWPA 1LA2A 4BIIA 3E9QA 4XQ9A 2V6BA 1C3VA 2CDAA 1G6KA 2GO1A 3DL2A 3HFGA 1QKIA 4CQMA 1X15A 2E48A 1YXMA 3GC6A 3V8BA 2J8ZA 2AW5A 5K9ZA 5B4TA 4WNIA 1ONNA 4CQMB 3CE6A 1JU9A 4JJFA 1MUUA 1HL3A 1A71A 2UYYA 3H5AA 3WX0A 5KWEA 2QQ5A 3IS3A 1DDOA 1VLLA 1EK6A 3RKUA 4NHEA 4PGFA 3L77A 3HDJA 4GMFA 3L6EA 4UEOA 1VI2A 4OQZA 4BKPA 1E1LA 1C14A 2IYOA 2Q3EA 3G1UA 5KVQA 1DFHA 3DFUA 1VL8A 2QRJA 3AM5A 1EUDA 1KY5A 3AM3A 4J6FA 5I7FA 2GASA 1PQUA 2HK9A 1Q0HA 2AHRA 1RWBA 4E5KA 2AXQA 2UVDA 4NIMA 4D44A 1UR5A 1XGKA 1YQXA 1XG5A 3ZU3A 4BNMA 3VTZA 2Y0EA 4PLGA 4XIJA 1GQYA 4YAIA 1D3AA 1H2HA 4Z0TA 4BGEA 1RM0A 3GZNA 3B70A 1V3VA 4CLDA 1GAEO 3DHNA 3SJUA 4L4XA 2HMWA 3A9WA 3OECA 3AU9A 4TMFA 1DC3A 3OIDA 4ID9A 4MKXA 1YONA 3PFFA 3TN7A 4UVDA 3GNQA 3JQAD 1UAGA 3C1AA 1Y9EA 5G2OA 1QXSA 3D3WA 4KQWA 3PLRA 1IPFA 4P4LA 3L4SO 1I33A 1VJ1A 4BV9A 1NPDA 1T2AA 5FWNA 3VPGA 5IFLA 2VHYA 3E5RA 4YT2A 4R3NA 3H9JA 4JCOA 4OIMA 1EZ4A 5G4KB 2G0TA 4Q3NA 1NXQA 1B0AA 3PGXA 4D45A 1BDMA 1BXGA 3ROMA 3H5NA 1DC4A 1LRLA 2I67A 4CMBA 1BMDA 3TJRA 3UFXA 3ONDA 4GX5A 3SXPA 4OXNA 1SZJG 4TRMA 4A03A 4XYMA 3R1IA 4ZD6A 3U4IA 1GUZA 2IZ0A 3WYCA 2BELA 2I6TA 1N92A 1M67A 3CTMA 4E2XA 1XR3A 1YJ8A 2JCVA 2I5PO 3EVNA 3OQ1A 3P7MA 1P0FA 1DEHA 1HZJA 3K30A 1YB4A 3DDNA 4R1UA 2WTBA 4ZVVA 4IDEA 1GV0A 1PWZA 4L8VA 4MIYA 1HLDA 2W2KB 1NQ5A 1LSJA 2J3IA 4G2NA 4ND1A 1NFFA 3FNHA 3GGGA 4LSMA 2EWMA 5I8ZA 4M8SA 3F1KA 1YS4A 4ZQBA 4WK6A 4LN1A 1XLTA 1HDCA 4GGPA 2NU9A 4JNKA 1I3NA 2HK8A 2X5OA 5KJ1A 3S2EA 5DOZA 3OHSX 2AG5A 3BA1A 5JE8A 5A04A 3ZWCA 1LLCA 5HM8A 2JAHA 5M6DA 1X1TA 1XSEA 4ND4A 3WICA 1U3TA 4WEOA 3ORFA 1E6UA 4EYEA 4ZQEA 2VRBA 2O4UX 4PZEA 1F8GA 4E2YA 4J1NA 2Z95A 1DRUA 3TOZA 1KC1A 2R2GA 2YQ4A 2VTDA 3PP8A 1HETA 5KJFA 4NR0A 4AJKA 1E6EA 2VHWA 4AL4A 4QO7A 3DZIA 3GOHA 5JO9A 1ZNQO 3DBHB 4JBGA 5EQDA 5CEJA 2X58A 4D41A 1DB3A 4BNKA 1B26A 1LSSA 4IDCA 4A27A 4JJGA 1P77A 2AQIA 2CMDA 4AJIA 4BKUA 4CUJA 2FPGA 1ZXBA 3WS7A 3B6ZA 1VL6A 1ADBA 1PGQA 5JMPA 2ZYAA 1ISJA 5C7OO 1H2BA 3GN2A 4JBIA 4R5HA 3LLSA 4B3JA 3I1JA 4DREA 4IM7A 1TT5B 3H6KA 1MXFA 4DLBA 4D42A 1PJBA 1M66A 3D4NA 1WDKA 3DBRA 4BNTA 4HV4A 5EN4A 1DBVO 1BG6A 3GAZA 3LT2A 2V6GA 1RM5A 3D4PA 4WGGA 3DTYA 3WSVA 1IPEA 4CJXA 2EIHA 3V2UA 1HRDA 1LDMA 2I65A 3ROKA 4E6PA 4YAKA 5KJCA 4J1SA 4KTVE 1DOHA 3PHGA 5ILGA 3PIIA 4LMPA 1P1FA 5AOVA 4YVFA 1QP8A 2O2YA 1WAMA 3H3FA 1X7DA 2X0JA 5JCXA 4ZRNA 3ST7A 3BZUA 2EJVA 3OJOA 4QT0A 4GKVA 3JQEA 1RM4A 1I10A 3Q9NA 3PFWO 2D3TA 4U0KA 4K1LA 3V1UA 4CLRA 4IDDA 4JROA 3JQAA 5I9MA 2PKQO 3RD5A 4GX0A 1M76A 1UP4A 4RO0A 5BNTA 3DAGA 5KJEA 3RFXA 5L45A 4N5MA 1WDMA 5A02A 3BMQB 4P4GA 5GY7A 4CR6A 1ENPA 3R3JA 2Q2VA 1O6ZA 1ORRA 2OZPA 1PJCA 3KLMX 4L4RA 1HLPA 9LDBA 4CMEC 1ZZEA 1LQTA 2BRUA 3DOJA 3BMQA 4OXYA 3CEAA 1PZFA 4FQ8A 4IUYA 1RM3A 3RBVA 4I5DA 3U4DA 5JYEA 3A06A 5EJ2A 5I9NA 2ILTA 1KVTA 4BGIA 1CIVA 4KDFA 1XQ6A 2C2XA 2PZMA 3CZRA 4Y98A 4DUPA 1LRKA 2B36A 3OEWA 4W6ZA 5JLAA 5GZ3A 4GX2A 4ZQFA 1DRWA 3ZDFA 1NHWA 2C0CA 4OHUA 2B4TO 1U7TA 3GT0A 1K0UA 5JY1A 4W9NC 3ETGA 3AY7A 4CM9A 4Z9FA 4GI2A 4YAJA 4CLOA 3NX4A 3OFSA 4JLWA 4CPDA 1GV1A 2O3TA 3FBGA 4FOSA 1ZEMA 2ZTVA 3JQBC 4DXHA 4DPKA 2ZB8A 4KUGA 1ONPA 1EVYA 3V2HA 1TLTA 4RF2A 1PJLA 2E37A 2YYYA 2NVBA 4GVXA 4QEDA 2DT5A 3RUHA 3SLGA 2ZQZA 3UCEA 3ONFA 3GFGA 1U5AA 5JW6A 3NDJA 4BOYA 7MDHA 1A4UA 3V1YA 4QECA 4XYBA 3W4IA 1DJQA 1PZGA 4O5OA 3TL3A 3MJVA 3NJ4A 1AN9A 4CMJA 1E3EA 6LDHA 5TS3A 3NEPX 2G76A 4JP3A 1B3RA 4ZRMA 2VUSA 1LNQA 3FNEA 4PLWA 1I5RA 1U5CA 2OP0A 2C20A 4NQZA 1DPGA 2D1YA 3AWDA 1G1AA 3UUWA 1Q2XA 3KB6A 2O7QA 3U09A 1HZZA 1UH5A 3I9KA 4Q3AA 4MDHA 5T8KA 2HJRA 3O03A 1GYQA 2I99A 3H9GA 5ES3A 3HJAA 3FPLA 4ALJA 4XB1A 5JO0A 1C1XB 4YJHA 3AUTA 1CRWG 3JV7A 4A0SA 3WGGA 4XR4A 1I2CA 1PWXA 5H82A 2EW2A 3UCFA 3M1LA 2VT2A 4YJFA 1A7KA 4B8WA 1LDEA 1C1XA 4BQRA 3S2GA 4H7PA 1PJ2A 2JCXA 4UUNA 1QMGA 1RYEA 1YL6A 2X6TA 4IPTA 1HXHA 4KUHA 4CMAA 4E2ZA 1P3DA 4FPXA 4BNWA 2UUPA 5C7IO 5AXAA 1N1GA 3ASUA 1PL7A 4D43A 3D64A 3OQ6A 4LVCA 3NYWA 3JQDA 1EDOA 4A7PA 4GWGA 3DZKA 1U8XX 1QYWA 2JD2A 3BHIA 4F46A 1UZLA 3PQFA 5IF3A 3D5QA 4RVDA 1QYCA 3DQPA 2PKQP 1PSDA 3MZ0A 1NFQA 1Q0LA 1UP6A 2G5CA 2P9GA 1WLYA 4GLOA 3E5MA 4I5EA 3OJFA 1WNTA 5G0WA 4YRBA 1J49A 1DJNA 3VPFA 1T4BA 4XDZA 1SC6A 1E7WA 3W8EA 5C37A 1Z75A 3AOEA 1GCUA 2JFFA 4WECA 1E3WA 3V5NA 3ZNQA 1GUFA 4PRLA 1ZEJA 1NTOA 1CF2O 5TRTA 1T2CA 3ZWWA 5JDIC 3KSUA 4CV3A 1NM5A 3T7CA 4R69A 1L7EA 1HYHA 4E32A 1XEAA 4BNIA 2O23A 4UVIA 4NFYA 5TT1A 4YACA 3LZ6A 3C24A 3NAQA 2WYUA 3VZQA 1JW9B 4W4TA 3IDSA 1JKIA 1EFKA 3RUFA 1D4FA 2RHCA 1E3LA 2P4QA 3EZYA 1V3UA 3PLNA 1GTMA 3ZV4A 5I9LA 1E92A 3S55A 3EDMA 3I6IA 4UEJA 1K6XA 1D1TA 4TRRA 5JS6A 4KQXA 3Q2IA 3RQSA 3FHLA 2EEZA 3IKVA 3WXBA 4ALLA 3GPIA 4LVUA 4PLTA 4A73A 4NU6A 4RF5A 2YFQA 2SCUA 4RVHA 1GQ2A 1E6WA 2V7PA 4E3ZA 2EV9A 3P2YA 5K6AA 2V65A 4JK3A 5KCZA 1J6UA 1DIBA 4IQGA 1LDGA 4CL8A 4JP2A 4WKGA 1W6UA 4LCJA 2HK7A 4R9RA 3ABIA 4DTIA 1OC4A 2NNLD 5A9SB 4I9NA 3RWBA 3STHA 4O63O 4PG4A 4UULA 1T26A 4IZIA 2AE2A 3TPCA 1A72A 1KVQA 1O94A 3TL2A 3M2PA 2X5JO 5IDQA 2ZYDA 1MC5A 4DQUA 1UJMA 4OOFA 2YY7A 2IXAA 1EUCA 3B1JA 1NP3A 4R51A 1YGYA 4O1MA 3RUDA 1C1DB 3ONEA 4CR7A 4I5FA 1BRMA 4B8ZA 2V6FA 3T4XA 3NT4A 3UH1A 2I66A 3DBVO 3QSGA 3KETA 3WQQA 4FFMA 3KYDA 1Y8QA 4HFNA 4PZDA 4BNZA 5JYAA 5GMOA 3ZWNA 2O48X 2X22A 4KTTE 5JYDA 2DBVO 3W4JA 1YWGO 3ASVA 4ZQHA 3LU1A 3SVTA 1NVMB 3C7CB 2J5QA 1NR7A 1GFSA 2AG8A 4NZ9A 1HEUA 4HADA 1SPXA 1FDTA 3I23A 1BVUA 3H7AA 1YL7A 3JQAB 4CMCA 2VOJA 4PRKA 3JD1A 1N9GA 3F3SA 1ADCA 3PJEA 1PS8A 1PJTA 4TRJA 5CHEA 2FPIA 3EMKA 2CVOA 4D0SA 4FCCA 4FFLA 4MINA 4J4HA 1JTVA 3BYZA 3ENKA 2GGSA 1YBMA 1GPDG 1EBUA 2JCYA 2OBYA 1WPQA 4MJLA 2YHIB 3DONA 2WD7A 5T64A 4YBZA 1NR1A 4OYRA 2PGLA 5L4LA 3PJFA 2NADA 2P91A 5COAA 4CM4A 4FBGA 2HMUA 2B0JA 2CY0A 3OJLA 3RJ9A 1LBEA 1FDSA 4YT5A 3JQFC 2OOSA 3KSZO 3K5PA 3LK7A 5BSHA 4IS2A 4TWRA 2EW8A 5HRUA 4HX5A 3KHUA 1ZXLA 1QLHA 3PTZA 3WSWA 4CV0A 4RLSA 3ZHYA 5AYVA 4W82A 3ZWXA 4NG5A 4CM6A 2GN9A 4IMPA 3HDYA 5A4DA 3K2BA 1DHRA 4CR8A 4MVJH 2RH8A 4NJMA 3ZHZA 2PLAA 1P9LA 3FI9A 8LDHA 1I8TA 1I2ZA 5CFZA 4PG6A 1NPYA 2IZZA 5KIAA 1Q7CA 2NQTA 1YOVA 1ZVMA 2PR2A 2JD1A 2Q50A 2EP5A 3L07A 4LRSB 3KUXA 4WLVA 4R4JA 1LC0A 2W8ZA 3NTRA 4HNHA 1GYRA 1IHYA 2FP4A 3WQSB 4A10A 3IL2A 3E8XA 1J4AA 3MJSA 2NV6A 5L3ZA 2X0RA 2Q1SA 1E3WB 3RI3A 1EVZA 1HYEA 4EDFA 1K5HA 3JQ8A 3EUWA 2BFMA 4J9VA 3L9XA 1GZ4A 3OM9A 3K6JA 4FGSA 5B4UA 2Q2WA 3VPSA 3I9NA 5DCWA 3UICA 1UAYA 3A14A 4WLEA 4AVYA 4BO4A 4E0BA 3BMNA 4FIZA 4CQLB 1CQIA 4XD2A 3H5RA 4YQYA 2FR1A 2GRAA 1YQGA 1BGVA 1Z7BA 1GADO 1VKNA 3PVZA 4CM9D 3SJ7A 3GGOA 4BO5A 4TQGA 4J1TA 4FC6A 4TKLA 4LCEA 3GRKA 3PHHA 3N74A 1H5QA 1EE9A 4QUKA 5MGBA 2NVWA 4BHTA 1Y8RB 2NSDA 4BO7A 1VPDA 4L4SA 1H9AA 2QX7A 1DXYA 4YJGB 2B4RO 4AJLA 4BQPA 5K6AC 1VJ0A 4FFNA 2FHSA 4XGNA 3ZV3A 1VKOA 1U8FO 4HKTA 5ILOA 3GZNB 2RIRA 1Q1NA 4L74A 1NYTA 1LXCA 4OKIA 5L53A 2GZ2A 3P19A 3LT4A 2H6EA 4AJ4A 2ZCUA 1SOWA 1AUPA 4CMEA 3JYOA 2R00C 2Y67A 1IE3A 3EW7A 3H4VA 4IDAA 5IDWA 4FFRA 4FC7A 2QYTA 3F1LA 1O0SA 1I24A 1NAIA 2GR9A 2G17A 1ZJYA 3K92A 4AICA 1YBAA 1KEUA 2QYSA 3EAGA 4D7AA 2IE0A 3ON5A 4M55A 5EMHA 1B8VA 2GDZA 4J49A 3I83A 5FI3A 4XWYA 2Y1DA 3ROPA 1VM6A 3ZW8A 3M1AA 3E82A 5DN9A 3ETDA 4TRNA 4J43A 3MJCA 2NU7A 4P38A 5I7SA 2CF5A 4RF4A 1T25A 4E13A 2WDZA 1N8KA 5KVCA 2E49A 1DO8A 4K6FA 4E33A 1S7CA 3DAFA 5CDSA 1H93A 4WCFC 1GY8A 4HFJA 1UXHA 4ALKA 3BMOA 4ALIA 4MOWA 1MB4A 2DAPA 4RGBA 8ADHA 1NQAO 4PG8A 4WE3A 4CM7A 4RV9A 2PFGA 1HE5A 3CKYA 2D5CA 1K3TA 1P1IA 1N5DA 2UDPA 3HN2A 3C8MA 3BTSA 1DRVA 1AHIA 2PD4A 3DHYA 3GK3A 1N1EA 2Y1GA 4BKRA 4TKMA 2NTNA 1R4MB 5CEFA 4WNCA 1DIAA 4O59O 1RJWA 2YFHA 2X23A 5MDHA 1LRJA 3ANNA 2QIOA 5TQVA 1NFRA 4IINA 4DRYA 1N9GB 1KOLA 2Z5LA 2C82A 4IIUA 1EK5A 3VKUA 4L76A 3DOCA 4RL6A 1Z7EA 4WCFB 3V1TC 1E7QA 1NWCA 4J90A 1XELA 4OSPA 1WWKA 2VCYA 3TZHA 1ZK2A 4XQEA 3OEYA 5I7EA 1H6DA 4B4VA 3FWZA 1OZAA 2Y66A 5L7YA 3WOHA 4I08A 1ZJZA 5BR7A 5JMWA 4M49A 5CAEA 2PWZA 4E5PA 4E4YA 3U49A 3S8MA 1VSVA 1MGOA 2Z1MA 1GPJA 1JVBA 2CUKA 1C0IA 4MKRA 1CERA 3GPDG 2AE1A 2GERA 5AXDA 1ULUA 1PS0A 2P68A 4IXWA 3PQEA 2DM6A 2BI7A 4INAA 5G0SA 1HDOA 3JYLA 5FF9A 4RVSA 1C1DA 3GH3A 2P5UA 4GMGA 1UP7A 2YZ7A 4PVCA 1HDZA 4NK5A 3NDRA 3HG7A 5T6BA 3C1OA 1ONOA 4TVBA 1DIGA 5THQA 2ZKLA 4AJNA 2IZ1A 2AQHA 4I5GA 3JQ9C 5JBIA 5DDIP 1O8CA 3OA0A 1R0KA 2J3HA 3KLPX 5JAIA 5FFFA 2Y1CA 1PGPA 4MVJI 1UXJA 2PH3A 5ENDA 3PYXA 1P33A 3DBLB 1GDHA 3ZWYA 3BAZA 1KIFA 3ETEA 3TDKA 5GZ6A 4R54A 2QG4A 3HUDA 1FMCA 2JJYA 3CUKA 4GSLA 4IQ0A 4A2CA 3G79A 3BHMA 3BMOB 4RLHA 4EUEA 4EEXA 5DP1A 3TZQA 3ITDA 5COBA 1ZSNA 1NBOA 3DAPA 2YDYA 3IC5A 1B2LA 3R6DA 2J3JA 3EVTA 5IN4A 3WNVA 1UXGA 3FTPA 4CLXA 5EIOA 1TXGA 3I4CA 2PZJA 1T4DA 1V0JA 5TT0A 4BS9A 4J4TA 2YDXA 5L7TA 4ZJUA 1YDEA 3W8DA 2H5LA 2WD7B 3VPXA 3PEFA 3Q11A 4FW8A 4EJ0A 4AJ1A 1BW9B 5BT9A 3ADOA 1DSSG 1UUFA 1N2SA 4LISA 4ZU3A 5THKA 3U0BA 3BMCB 4J7XA 4FJ1A 1ZK4A 4IMRA 1R12A 4II3A 2QRLA 3D0OA 3DEYX 3WGIA 2GUGA 5F5LA 2O3SA 1I32A 4CMKA 5CG2A 1IY8A 3FSRA 3O8QB 5IDYA 2QRKA 1HSOA 1T1RA 2WMDA 2EXXA 1LUAA 1U4OA 3N58A 1DLIA 3DMTC 2FSVA 2DQ4A 1YVEI 2GN4A 3WTCA 1ZSYA 4CM8A 1XA0A 3HHPA 4CMGA 3TZ6A 4B4UA 2NM0A 3F9IA 5CDTA 2EJWA 1T1SA 3ROQA 2AMFA 3WWZA 2J5RA 2BD0A 3KM0A 3HN7A 4DLLA 2DFDA 2VRCA 4JJIA 5B37A 3AW9A 2HKIA 1P1JA 4ALNA 4B4WA 4YEDA 4CL3A 4NU5A 3E9NA 4DMLA 3JD4A 4G81A 4BGUA 1VE9A 4KUEA 4XYGA 4BKOA 4TSKA 1OBFO 4ND3A 5AXCA 1BXZA 3WLEA 2XF8A 1QYXA 4FR5A 4OMUA 4OSOA 4N5NA 3Q0EA 1T24A 3RFTA 1EQUA 1XCBA 1LDYA 4J0FA 1V8BA 1EEHA 3EC7A 1P1RA 1YB1A 2XXBA 3VH1A 5A06A 3KEQA 1E77A 1A4IA 1BXKA 1H9BA 1LLDA 2BF7A 2G82A 1NAHA 3MWEB 4DYVA 1ZSVA 2GZ1A 3VZPA 4E5YA 2GLXA 2I3AA 4BGVA 1EBFA 3LF2A 4D0RA 2P5YA 4ITUA 3FF4A 2DTXA 3ADPA 5JAMA 3M6IA 1LU9A 1ZO8A 3IJRA 4IIVA 1EVIA 3W6ZA 2EHDA 2FZWA 2FMUA 3RC9A 3RU9A 1GQQA 3WG9A 4DIBA 3D5TA 4MP3A 2WYWA 3PJGA 3DR3A 3IJPA 4P8RA 2VHZA 3VKVA 3IMFA 3OF2A 1P74A 4NMHA 1EVJA 4BNHA 2VNSA 5JCJA 2PGDA 1F06A 2GN8A 2PTGA 4YJFB 4MVJG 2GF2A 4YA6A 3PIDA 4HBGA 2PKRA 2B37A 3BMCA 3ZWAA 3IKTA 4UVHA 2D2IA 1O5IA 2XOXA 2H1SA 2WWRA 3ZWPA 1V35A 3MTGA 3NKLA 3OJEA 3GQVA 4S3MA 1C0KA 3R3SA 1R6DA 3LQFA 1PGOA 2P9CA 3RUAA 2DPGA 5TJ9A 1HDRA 1ZW1A 1LLUA 1YDWA 3VAZA 1X7GA 3D7LA 3H8VA 3RJ5A 3PZRA 1P1HA 1ZK3A 1H94A 1T2FA 3OP4A 3VOSA 1QRRA 3NGXA 4K28A 4RDHA 5H83A 4XX0A 3JQFA 2X9GA 2ZTMA 5LDGA 4CM8B 2CZCA 1H0KA 2NTJA 3GG2A 1GCOA 4EZBA 1MA0A 4J1QA 4ND5A 3DOOA 3COSA 3ICCA 4XYLA 1JWAB 1OC2A 1SO8A 4CM5A 1JKJA 5TGDA 4Y9DA 1Y1PA 1WMAA 5HA5A 3Q1LA 4ROSA 1Y8QB 3JQ9A 1EQ2A 2VYND 3H9EO 1B3BA 3H2SA 3TZCA 5L7WA 2NQ8A 1A7AA 4TROA 3VH2A 1M75A 4J2HA 2HO5A 5G0UA 1YO6A 3FWNA 3IQDB 3LYLA 2DBQA 3TWOA 3FPCA 1JA9A 1UZMA 1CWUA 3AJRA 1ENOA 4J0EA 3KSDO 1E3JA 4YCAA 1IOLA 1DAOA 5JAQA 1VL0A 1A5ZA 3UCXA 5FYDA 3ZNOA 2VWHA 1WZIA 3WB9A 5J9GA 2WD8A 5L4NA 1V3TA 4XCVA 2GPTA 3ICPA 4N7RA 3ZCXA 1R15A 4HFRA 4KWHA 5TJHA 3VZSA 1N7GA 1R37A 5C7LO 4YWJA 2DTEA 2XXJA 1OI7A 3LSYA 1PZHA 4LK3A 1FJHA 4R41A 1HYGA 1CDOA 1E0DA 2B5WA 1M6WA 2VYVA 4KDEA 3GY0A 3W8FA 2JD0A 3HWRA 2Q22A 1AE1A 3IP3A 1HDGO 2POQX 5KVSA 3O9ZA 1DFGA 1QG6A 2E6UX 3KYCB 5JC1A 2VUUA 1XDWA 4UVEA 2UV8A 3QVOA 1IZ9A 4U7WA 1D1SA 4IJKA 4DIFA 4J4BA 1S6YA 1YOVB 3NT5A 4PLFA 4W7HA 1DC6A 2HDHA 4B3HA 4Z9XA 2VUTA 4XJTA 4GAEA 1QORA 2OP1A 3E18A 5TNXA 3RC2A 1SNYA 2RAFA 3A1NA 2Y68A 4O0LA 2TMDA 4IZHA 4UUMA 3GDOA 2VOEA 5TSDA 1YBVA 1R4NB 1HE3A 4DA9A 1KVUA 3G17A 4QSMA 5DCYA 5IZCA 2BGKA 4CV1A 2ZK7A 1NPTO 1X1EA 3L9WA 2LDXA 3OQBA 2W2KA 4OOEA 3NUGA 5KKCA 2HJSA 1I0ZA 2WM3A 1GZ6A 4AFNA 1BTOA 3VHRA 4EI2A 1V6AA 2HMVA 1B16A 3DBLA 4BB6A 2OORA 1A9ZA 1JN0A 1NVTA 1EUZA 1OOEA 3EZLA 4U8GA 4BNNA 4G65A 1UDCA 2HMTA 4WOJA 2ZCVA 2JFGA 3VH3A 1IYZA 2OUIA 1CYDA 4FJ2A 4RORA 4L73A 4NJOA 1AXGA 2OMEA 4YT8A 3VPHA 1BDBA 5F21A 3H2ZA 3A28A 5DT9A 4YJGA 1ID1A 2EF1A 4XZ3A 2W2LA 2VHXA 1HE4A 5JY6A 4J7UA 4X54A 4EJ6A 1G0NA 1RPNA 2GZ3A 1SMKA 1GD1O 3U9LA 2HLPA 1NVGA 4IDFA 4XRGA 2A4KA 3OMLA 3VH4A 4C7KA 4AJPA 1LX6A 3PWKA 4F3YA 1U2DA 1U2GA 4IS3A 2DPHA 1ZIDA 4BL5A 3AOEC 2O4CA 1LDNA 2BMAA 3FNFA 3QVTA 1PZEA 3DZHA 3GNSA 1YL5A 5G4KA 5HS6A 3TOXA 4XR9A 2DUWA 1F8FA 3WMWA 1I3MA 5AVOA 2PD3A 5U9CA 3DTTA 1KERA 2YV1A 3QLJA 3K73O 4AJHA 3H9QA 4ZHSA 3RFVA 2WYVA 5A5EA 3AFMA 1W0CA 3WBBA 2VZ0A 2LDBA 2J6IA 4EGFA 4FB5A 2Y99A 2HQ1A 1R16A 1SCUA 5L95A 3DXFA 4FJ0A 5AQ1A 1TI7A 3AY3A 1XIVA 1VSUA 3IAHA 1X14A 1LLQA 1YJQA 4EBFA 1WW8A 4RPJA 2UUOA 3ENNA 4GX1A 3IP1A 5LC1A 2FN7A 1ULSA 4BVAA 2X0IA 5JYFA 1LQUA 4BO1A 3JQ6A 4R3WA 3GVHA 4OKNA 4ND2A 4BNVA 5JCJD 3Q9UA 5IZCC 1D7OA 4J3FA 4RPHA 4BO2A 2VRCD 4QO8A 4BMVA 3ZNNA 1D8AA 3LT1A 2UAGA 2RHRA 2NACA 3F4BA 2ZB3A 4RPKA 3OH8A 2PY6A 4BO6A 3AI1A 3KTDA 3ANLA 2HRZA 2DTDA 1IULA 1MG0A 5IN5A 3WFJA 1R4MA 4M54A 3NGLA 4D3FA 1U4SA 2Y1FA 4NBUA 1GEGA 3SC4A 2ZYGA 4MIEA 1NX6A 3B20A 2JAPA 5LCXA 5DCUA 4NFSA 2OGUA 2O7SA 4CQLA 1EFLA 3GLQA 2HUNA 3RSHA 2QZZA 1PJQA 1G0OA 1JAYA 3ZV6A 5JDIA 4BNYA 1E7RA 2FOIA 4FN4A 5FI5A 5T8KC 5L4SA 3UAGA 3D1LA 4IQ8A 1HT0A 3OICA 2Q4EA 2EP7A 3PGJA 3DWFA 1VRWA 2QW8A 3F47A 2VHVA 3OIFA 1NQOA 5T73A 4MVJA 3AUSA 4M1QA 4AG3A 2AQKA 4GBJA 3JD2A 3L6DA 3X2EA 3GG9A 2Y05A 3IUPA 5A9RA 1XWFA 4R1NA 3WDSA 2GD1O 5AXBA 1QYDA 3GDGA 5GZ1A 1WDLA 2D4AA 1GR0A 4PG5A 1BWSA 1VC2A 5IAAA 4HFMA 3LLVA 3S2IA 1IB6A 1JKFA 3GR6A 4OM8A 1XKQA 1HE2A 4MIOA 1GEEA 4Y67A 4BMSA 2BFOA 4BO9A 1NASA 2F00A 3ZHXA 5JNLA 2J5KA 2B83A 1KVSA 3I5MA 1P0CA 3MWDB 3ZWBA 4DPLA 2VYNA 3EY4A 2X9NA 3WYBA 1MFZA 2FZEA 1T2EA 2P9EA 5TC4A 2HMSA 2YJZA 3I9LA 3FN4A 2PV7A 4I8XA 4WLFA 3NJ8A 2A35A 4R5MA 4WCDA 5FEUA 3AUAA 3UXYA 5H81A 5TF4A 3KBOA 4W9NA 6ADHA 3DMYA 1Q0QA 2W2LD 2GN6A 5ICMA 4RF3A 1PX0A 3X2FA 1PGJA 1WMBA 4NDNE 3C7AA 5HBRA 1Y9AA 1SEPA 3GVPA 1V9LA 5KTKA 4FFOA 1QV6A 1HKUA 1BW9A 3IIEA 4MO2A 1HDXA 3M2TA 3GEDA 4CODB 3SC6A 4RPGA 2Q1TA 4Z0HO 3WGZA 2WE8A 2Y1EA 3K31A 1Y7TA 3B1KA 5G0TA 4F6LA 4QTZA 3PI7A 4YYZA 3QWHA 1RYDA 1SB8A 2IXBA 1NQTA 2E4AA 3ULKA 2JHGA 3RBXA 3WQRA 2I9PA 3D3WB 4D3DA 4XQCA 1U3WA 4WLNA 1K89A 3IOYA 3NDIA 3GMDA 1HWYA 5K0ZA 1P31A 1YH3A 3ZWVA 1BHSA 5EPOA 1DC5A 2EGGA 4HXYA 3WGQA 3LC2O 2NVUB 3QIVA 3TSCA 5BSFA 3QA9A 5A3JA 3NT2A 1YRLA 4DLAA 1PTJA 3KYCA 1NWHA 3RUCA 2X7HA 1Y5MA 3T7EA 3U5TA 4GSKA 2IEBA 2C59A 2Y1OA 3CPSA 1C0PA 3PQDA 1TEHA 3TNLA 3GZ4A 4W99A 5L51A 1O95A 2I3GA 2PNFA 3P5SA 3RCBA 4WLUA 3O38A 3K96A 1HTBA 2Y93A 4Z3DA 3RBZA 1O89A 3PHIA 3CXRA 3CZMA 2IODA 3O26A 2CDBA 4XKJA 4LW8A 4IGFA 5DP2A 4Y8VA 2GSDA 3FR7A 3JD3A 1F12A 5DBFA 2YUTA 1R4NA 3U4HA 1KS9A 3INGA 4B7UA 7ADHA 2P4HX 2OBNA 3MJTA 2ZTUA 1Z73A 3WBFA 3RIHA 3TRIA 3GEMA 2EKLA 2BH9A 1LJ8A 2FRDA 5DOVA 3UVEA 3DC2A 3WYEA 1E3IA 1BVRA 2H63A 5KKAA 1ISHA 3VVCA 5B12A 1ISFA 2RCYA 3FTNA 2Q1UA 4R68A 3JQ7B 1KC3A 2VN8A 3L4BA 4ZA2A 1E7SA 3HDHA 3WGOA 3VTFA 1LTHR 3JQ8B 4BO0A 3JYQA 3QQPA 4EITA 2X9VA 3BMNB 4IBOA 3MTJA 3QW2A 4ZN6A 5IG2A 2D59A 3F5QA 1LC3A 4OJNA 3QWIA 1DIHA 4QFDA 5LDHA 4DMMA 3I9MA 4WCFA 2O50A 2FR8A 3K2EA 5ITWA 4Q3CA 3KOUA 4JX8A 2DVMA 3UHAA 4PFJA 3S2FA 4J16A 4Y6PA 1YKFA 3CSDA 3O4RA 3FNGA 1E1MA 4CMIA 3D4OA 4L0QA 1U9JA 3LF1A 4D3SA 5EL0A 2VYVD 3IUSA 4OGWA 2O3RA 4YPOA 4U0JA 5A9SA 1E5LA 5KOIA 3JQGA 1TT5A 2V6MA 3PWSA 3LT0A 2D5AA 2VWGA 3BTOA 1CETA 4XIYA 1KVRA 3PJDA 4QFCA 4FD3A 4WJZA 3QE3A 3F6YA 4XB2A 3GGPA 4DC0A 5B1YA 3PXXA 5A3VA 4NNJA 3D3EA 3JSAA 1K2WA 3G3EA 1MLDA 2Q2QA 5TIIA 4DC1A 4DWVA 2NVUA 4BKQA 4E2WA 4G5HA 5JDCC 3ZH2A 5COQA 5TX7A 4KP7A 4RVUA 4Q3DA 2C29D 4LSWA 1HF3A 1UDAA 2FWMX 1YE3A 3NV9A 1DIRA 3OA2A 1PQWA 4OXKA 2VZ9A 4CLEA 4RDIA 1OMOA 1X13A 5A1TA 4PLVA 4P22A 4XA8A 4GPD1 5JXWA 2Q1WA 1QLJA 3ANMA 3MOIA 3FBTA 1L7DA 1TA4A 3VDQA 3EK2A 3CINA 3JCZA 5HTOA 2X0NA 2C5AA 1EMDA
chains in the Genus database with same CATH superfamily
1JXQA 4YDRA 3WGYA 2GYYA 4ZAWA 4BYMA 2I2BA 2ZT5A 4FT4A 1KK0A 1CR0A 1M2OB 1YZQA 2G07A 1NULA 2X19A 3VX3A 1Z13A 1TYZA 3ESZA 4HLNA 4LRTB 3WMGA 5HIJA 4N8DA 2DWPA 2DBRA 3QY9A 1TEZA 2VXCA 3QQ5A 3IVRA 4E7PA 4DBLE 4E07A 2PUBA 4ADSG 1DWOA 1RD4A 2MTBA 5A5VA 1W7AA 4IDNA 2C9DA 2QTVB 3IAXA 3QBVA 2O5RA 3KT0A 2HV8A 1P1KA 3LX5A 2R1VA 4H7HA 2QN1A 2VBGA 3E1KA 3QLUC 1UPUA 4IIBA 5J5AA 3KSBC 4NBSA 4F1KA 2YV3A 1CUUA 5U1PA 1JDJA 2XE7A 2Q3BA 6REQA 3MUOA 4NV0A 1FDWA 5GM2A 1X0VA 2DZDA 1KY4A 1RIIA 1R0BA 2CW5A 1C9MA 2IYZA 2WRZA 2Z5GA 3GRZA 4Y9SA 4AMUA 2WUEA 4B3FX 3HO1A 1AK9A 1Y4SA 1V8PA 1UDBA 3BSYA 5DYIA 3EGOA 1U8ZA 4DKJA 3UATA 2FPWA 4H27A 5TVGA 4M1EA 3H0KA 4M0CA 2LKCA 3IQEA 4EVIA 1W36D 1X7YA 4P83A 1PTJC 5B4VA 3ZCTA 2FZCA 5K7SA 3V8PA 2IBSA 4URWR 4F45A 4OK5A 4U39A 2H92A 4O8CA 4XUCA 3MN1A 3SHWA 4JJ4A 3EDYA 2OMKA 2B1JA 2Q3MA 3DTVA 3MMPA 3QOXA 4LWPA 4LXXA 2WJ6A 3E61A 5DHFA 1YCGA 4EI9A 3BXGA 4YAGA 4XRRA 4HQFA 3BHJA 4NBKA 5IANA 4G1CA 3PEYA 1WXFA 4ACAA 1QHXA 1SEVA 1ZM2A 3VI4B 3UB3A 3DOIA 1Q6YA 3HJUA 2WWVD 2QR2A 3ILYA 3LCCA 5C3UA 4YXWD 1XTBA 2R8PA 3CLVA 2GM9A 2G3YA 1OASA 2BR5A 2BBOA 1C0LA 3ZWOA 3Q9LA 1MRNA 3H5IA 4MYRA 3VSBA 1QJCA 2QHXA 3L8HA 4P0QB 1T4CB 3U16A 3RC1A 1RI3A 1GZ3A 1NUAA 3E48A 3O91A 3V7NA 1O97C 2VBCA 4YB8A 4C0JA 4FE4A 1WULS 1Q11A 4NJEB 5E4FA 3SEFA 4EJMA 5L3QB 5LMNB 1KYXA 2XMPA 2VEOA 3NORA 4HMQA 1RKXA 3M1IA 4GHWA 5A2GA 2AXNA 4I4TA 3QX7A 1A8HA 1J1IA 4HDCA 1NN3A 4MI3A 5H3LA 5B6IA 2QG9A 4LDPA 2JAWA 4HUJA 1POXA 3OC0A 1M8FA 4NH4A 1D6MA 1UZNA 1ZGJA 3AGQA 3BXPA 3LPAA 2GXQA 4JLDA 2IS4A 2AI3A 1AGYA 2ECFA 4FDAA 1EP3B 2WUDA 3ZC3A 4B9EA 2FGJA 3E4CA 1I3LA 5L40A 1WS6A 3AI3A 1LK5A 1COWA 3WIDA 3IO3A 2FWAA 4EEKA 2IH5A 2QMZA 1SOUA 2PCLA 4TZ6A 3E70C 5KSZA 1KSJA 2OV2A 2BDTA 2XE4A 3QVVA 1BIFA 4KXNA 5A4FS 5LZ5A 3N0RA 5JD3A 1GQFA 1CE8B 1NJ2A 4KL8S 3ME5A 1KEWA 2RHOA 4AJ2A 1ISRA 1YJAA 4N5LA 1PEAA 2X8BA 4QYMA 4ZCLA 4E11A 2YHIA 1IVSA 1U63A 2IC5A 3ABRB 3PIRA 4LZOA 4MVJE 2HWYA 1ENZA 2Q6OA 3HPQA 4HYEA 4EHAA 3OQNA 4JI2B 1W1WA 3FE2A 4EUFA 4IUCS 1NZDA 3OSUA 3ZU4A 4M22A 4BTVA 5DBGA 2BJHA 2V45A 1FXSA 5IPFA 4B7AA 3MCVA 4OKSA 5FA5A 5BN4B 3ZJTA 1C4XA 2NU6A 2C83A 1HTWA 3TKLA 2IHNA 2IU6A 3RWMB 3W4KA 2HJ9A 2I4IA 1Y5RA 1QCCA 3RROA 1MDBA 2RHWA 3G2LA 3TLJA 3UKOA 4PO3X 3A32A 2HXYA 2FRXA 5EKXA 3L92A 1RI2A 2HM7A 521PA 2QVBA 4B4OA 2H1HA 4LFAB 2WJ4A 4LMRA 3UTDA 1H2WA 1ORTA 1DXHA 4G5FA 3ROQA 5C7YA 2WPNA 4BQQA 2JGMA 3GNTA 1AU9A 2FWBA 4JLNA 5J4VA 5HJ2A 1FYFA 5JFOA 4ESHA 2P2DA 4J0CA 1RP1A 1T2DA 4JUBA 3U3MA 3D8RA 5FDFA 2PSFA 4Z4EA 3ONNA 1ADFA 4C06A 1D2HA 4I9GA 5I9TA 1GA1A 1FXUA 1HSZA 3S1AA 1R0SA 4K46A 5AOAA 2NUAA 3ZS8A 2D0IA 2AKYA 1JG3A 2AEMA 4J07A 1ABEA 2BHRA 5CPFA 1W2WB 2G28A 3MGAA 1O95D 1AA6A 3ZWMA 3RREA 4GOLD 3M6AA 1HORA 1IUKA 2BGJA 1T3ZA 3BMXA 3GMSA 4HAZA 4TVKA 3MT8A 5E2AA 3L6RA 2RBKA 1M74A 4RFSA 3MCAA 4N5IX 3GEGA 3EEQA 4DA0A 1U99A 2P3QA 1G5FA 1UOOA 2W6QA 3D0QA 3S5UA 2AJ8A 4ER0A 3G0OA 3TQSA 4OQ4A 3DZJA 1YZUA 4FCWA 2V4ZA 4JYCA 1X38A 3EZ6A 3AESA 3W2HA 4ZDWA 1OBVA 1NMSA 2H4JA 1T5DX 4DIOA 3Q3CA 1LJUA 1ZUNB 3F6BX 4QDKA 2B8WA 1PJ3A 1GGVA 1QGUA 1UMBB 2P9YA 4CM3A 4RTKA 3KUUA 2HWWA 2IHUA 1FU8A 3RUEA 3ZNPA 3BIFA 3A25A 1QVRA 4IG4A 4HF7A 3T95A 4C0QC 1RS0A 2WA2A 2YZ2A 4KMOA 1Y6FA 4NBVA 3HCCA 1WOMA 1TIPA 2HF7A 2Q4BA 4K9DA 4RVOA 1S4MA 1YQ9A 4O4LF 5IXJA 2BGLA 3IT0A 4QFBA 2WIDA 3HEBA 3AEKA 1NQVA 1U65A 3EXFB 4ZICA 3QXGA 4WVLA 3C3XA 3QPBA 2OXIA 3RTGA 2AZDA 4D81A 2FH5B 1SIWA 2FR8C 5IKXA 3F5SA 2C2YA 2DR2A 5LXTA 1Z39A 1NU6A 3KJFA 1WXDA 2VYFA 4D8TA 4ZGWA 1Y81A 2V7VA 3DBHA 5DX8A 3KZNA 2Z3WA 2FRVA 4P86A 3CJRA 2PZLA 4FNOA 1ZK0A 2I6UA 3DFMA 3AJEA 3GQBB 2O1XA 3EH1A 4GXTA 4MP6A 5DRTA 4A8HA 4AP5A 4ZEMA 3I5AA 3L0DA 3UAZA 2AN5A 4PNHA 1IZ0A 3COZA 1I2MA 4GD3Q 5J59A 4UHEA 1EH5A 1PG5A 3H86A 2ILVA 1JPVA 2A5YB 5I4KA 4TVSA 4LA4A 4Y2VA 4MYUA 4H3HB 2G6TA 4JC0A 1XEXB 4WKOA 1DCKA 4UU7A 3ITKA 2BWJA 3FLBA 3B7PA 4IQFA 2HQSA 4PC6A 3OUZA 1OWMA 2VEDA 5K0FA 3ZGZA 3NOXA 4E14A 5I7UA 2DFVA 2DULA 4YO8A 4NAHA 3QWBA 4KX3A 2YYZA 3ZE1B 5CLHA 5FLXA 3QG1A 3MBIA 2HOQA 4NL4H 1K6IA 3E6AA 3OETA 2E82A 4MV1A 4LY3A 1GGKA 4YP7A 2ROQA 3ZVRA 821PA 1Y1KE 4L0MA 4PG7A 1W76A 1YR2A 2ZB4A 1UCFA 3MCTA 4NI5A 1X2BA 3ES9A 3SQOA 1E0KA 4H6PA 4BVLA 2X86A 5CDFE 1UXIA 4B76A 3LRXA 1Z5VA 5L9AA 3UMCA 4FWTA 1XZIA 1XZQA 2W93A 3U26A 4AF8A 1GKYA 2FSSA 1Z16A 1KKMA 4H3KB 4IKPA 4EAAA 2VI5A 2BSQA 4BNDB 2IE8A 1FVXA 4LOHA 3STVA 4M46A 1E2BA 3UWMA 2DYKA 1SU7A 2XGMA 1X1CA 3GJ3A 3OEED 4FM9A 2VJMA 3LQYA 3ROXA 1JR3A 3WV4A 1QZTA 2I4NA 2QSJA 1WSDA 2V7EA 4H15A 2DC1A 2YQ5A 3IKMB 5HBGA 1U2PA 2VNIA 1HNNA 4Q1VA 5D51S 2VPWA 2FSIA 2GVZC 2XMGA 1V2HE 4J91A 5BY2A 3DB2A 1W35A 1CLUA 4XUEA 1HFEL 3K8ZA 5EKTA 1L9XA 1PWYE 3TTYA 1SC3A 4TTTS 3ZBQA 1E9RA 5B7GA 5BSKA 5JEEA 1TVMA 2FG7C 5LJIA 4R1TA 4NOMA 4HAVA 4P31A 1VKZA 1YUBA 4YUXA 3SQXA 2OL4A 3DMPA 4KQ6A 3TPFA 2F3PA 3HSKA 4PZCA 3BH7A 3C3DA 1G8YA 1TLFA 1QE5A 2BE7A 3P4UA 3EQ2A 2ID8A 4JMLA 4NWIA 4BDSA 3TK1A 3L4BC 3OUUA 3B5JA 1IL0A 3C39A 3OLVA 2CXPA 3JS5A 2B35A 3KV3O 3NV7A 3FMIA 1Y34E 3QLEA 3DGFC 3RNLA 3VPBA 3IVMA 3ETCA 5A4IS 1EXMA 1SHLA 3QBTA 4M21A 1YQTA 2I2CA 1J07A 1EG2A 2O3UA 2PUEA 3KO8A 2XVZA 1E2IA 2A5JA 5F1KA 1RQ7A 2FEMA 4HC4A 1RLIA 2O5VA 1PL8A 2V9ZA 1IVNA 2D2EA 4KBYA 4L57A 4YONB 1R64A 2OQ2A 1ZMTA 1Y7HA 2W42A 4PPGA 5FTNA 1DMRA 1T0HB 4LF7B 1U2EA 2P3OA 2WAOA 3A0UA 2AQ8A 2YWJA 1JU4A 1Y6ZA 3F67A 4L5AA 4MRVA 5HK9A 1Z5GA 4AJEA 4OJMX 2FFHA 3WFZA 4DMUB 5DN6D 3AM1A 3AR3A 3NTOA 4K87A 1NN5A 1QGYA 1WQ4A 2BMWA 2FPKA 3N8HA 4RQTA 1BEUB 5IS2A 4NFHA 3RM3A 5L3SB 5H4HA 4J0HA 2ET6A 3TBFA 3M70A 3SDBA 5IDXA 5JD6A 1NJ5A 5CXUA 3T1YB 2TYSB 4UREA 4HLCA 1TZJA 4KMRA 5ALTA 1D2EA 3ZGYA 4E31A 1XP5A 1U0EA 4JB2A 1GG5A 5H3HA 3AETB 3OIGA 4E51A 3DMNA 1EWKA 3HBAA 4GKBA 4F6CA 2ZRFA 3HR8A 3R9IA 3PI6A 4WPGA 1V8FA 4QXAA 1B74A 1SOVA 2FYTA 3L0CA 3IV6A 5DX0A 4CKBA 3A3KA 3F4LA 2J33A 5E4JA 1CQJA 4TWIA 4XGKA 5A6VA 4UM8B 2Q5FA 2Q62A 1BH2A 4PFSA 3S2SA 5IXYA 1A95A 2IP2A 1QOZA 2JZOA 3DJFA 3HGTA 3LUCA 2P11A 3H5VA 4JQCA 1XQ1A 1LPPA 4NAVA 3ZJVA 4BQNA 2IZ5A 1C7QA 4RD3A 4Y18A 4M87A 5GGXA 1G6Q1 2YJTD 4RXUA 1EM6A 3LA8A 3T9BA 3TH5A 3WWYA 4EUHA 2VZ8A 1FP4B 5EE5B 3WL8A 4MA0A 2R4QA 3LL4A 1FF9A 3EYWA 4UM7A 3BD7A 2SICE 1BD4A 1ZX1A 4RH3A 3A9CA 4K9MA 3H42B 3UW1A 2V7WA 4MVWA 4U7HA 1PR9A 2X4GA 4C7OA 3S4YA 2D7JA 2B2CA 2I76A 3RFCA 1Y6JA 4I99A 5E9AA 1OA1A 2R44A 1P4SA 4OHPA 3VZCA 5K3CA 4EQ6B 1MC4A 2FPLA 3U4CA 3ICEA 5JSFA 4JV5B 2XRMA 2QTMA 4YP1A 3FAKA 1CZUA 4V0QA 3VMMA 5ALHA 1QV7A 2QZSA 3GJ5A 1PR3A 1F2VA 1S2IA 3MEQA 3DB1A 4PX9A 3M5CA 5DHRA 2R1UA 3AJ8A 3RKRA 3GHYA 4KN8A 4Y0VA 4P9NA 4WZAB 2FUKA 2QZ9A 1X39A 3VOTA 1QR6A 1C8KA 4G4IA 3TTTA 2E1RA 3CNBA 4QDOA 3U6BA 5E2BA 2C88A 1GGHA 2INGX 4HDRB 4XOIA 5I7WA 2P30A 3I76A 4WUVA 2BTQA 3LWBA 1B4DA 2QAGB 3C3CA 1PIWA 3GVCA 3O0DA 4PBSA 2OVFA 3FFBA 1KDRA 5IK2A 4BP3A 2O8VA 4NJMB 2Y0DA 1DFIA 4F72A 5TQ2B 4DLYA 1KEKA 1NF9A 3S7ZA 5ITVA 5I48A 5F2NA 2C9CA 4XM1A 3MQ4A 5CDGA 5KX5F 1GG2A 1JTEA 1FB5A 1RZUA 2OG1A 4QUAA 1HDYA 4D82A 4KWIA 1LVGA 1PHPA 2GCGA 3AMVA 2YASA 2AEJA 2BEJA 4MGYR 2UYQA 3HADA 3P2JA 1W46A 1KETA 1RI5A 3QW4B 5JU6A 3AR9A 1DKNA 1SR8A 1WCYA 2WHXA 3HP1A 3AHEA 4BY9E 3SZOA 1NDQA 2W6MA 4PC7A 1SQFA 2WNSA 5F1OA 1QRTA 4Q9KA 5K0LA 1UKEA 1GNRA 3HE3A 1WZNA 2ATXA 1VCIA 1G41A 1U8AA 3PD7A 4PHHA 5LNK1 2JKVA 3WY9A 2GCIA 5IMSA 5JAZA 1UM9A 1SWVA 4QYSA 5IZ4A 2HT1A 1WKVA 4KVGA 4ZTZB 2IRWA 3FX2A 4MV3A 2CZQA 1PJ8A 1W0JD 1Y48E 2ZPAA 2Y0CA 1PQYA 2I4RA 4JFRA 2W6PA 1BKYA 2BYTA 2C54A 3PYMA 2FJPA 2NWQA 4WL0A 5FXMA 4MUGA 2VJQA 4DLSA 5JWHA 2HA4A 2YHSA 1BCRB 4EARA 2F67A 3F6EX 1TM7E 5K6RA 2HHAA 3FJ1A 5B58C 4HDQB 2BGGA 1W4ZA 3JZIA 1T8YA 1XCOA 1M1NA 3QU2A 2JFQA 3E5HA 4HNUA 4NBWA 1L8AA 3LK6A 1DBIA 1OAAA 2MHCA 3DE6X 3HN6A 3LVFO 1E96A 4LUCA 2ZIXA 5J5VA 1J70A 2NSYA 4JP5A 1TM2A 4W5RA 2G9NA 3AOGA 4DBZA 4IEIA 3E15A 2QTNA 3NHAA 3WFIA 4QQFA 4IRUB 4B82A 3BFPA 3L1JA 2I55A 1ZMXA 2EZ4A 1UZUA 4JYAB 4PANA 1JHXA 4LWZA 5BSUA 3FMGA 3A6PC 3DE7X 1I36A 3WMEA 1TT7A 2XBUA 1Y8RA 3C70A 2SCUB 4NBRA 4YRFA 3T5BA 4MR8B 4PLPA 3I64A 4ESOA 1DQZA 1SHJA 5HE8A 1GUYA 5CCDA 4EG3A 1J0DA 5DIFA 5ELXA 4QYWA 5IKPA 3ILSA 1KJ9A 4QUJA 1H0SA 4KJXA 4D5GA 2AMYA 3QIAA 4BMPB 2YKGA 4ZEVA 2JLZA 1YRQA 4CG0A 4ZJZA 2OK8A 4LNUA 3T0GA 1G6KA 1SC4A 1UAAA 1EFDN 2DRIA 3HFGA 1FP6A 2J4DA 4U9UA 3WGMA 3PC8C 3GC6A 2QTZA 2AW5A 2NO4A 1XQVA 2HBYA 3VR0A 2ATIA 4W5NA 4UXJA 5B4TA 4WNIA 2KLHA 1ULZA 3VQTA 4DMHA 4NE7A 1E1RA 1BMFA 3AWIA 4CQMB 1XBTA 1XF1A 3GFPA 4JJFA 4UUBA 1MUUA 2UYYA 5CM9C 1IUOA 5DTEA 2LP4Y 4GPBA 2QQ5A 3IS3A 1DDOA 1FUYB 1BROA 1M0WA 2CZGA 3V7UA 3SP1A 3SFZA 4TS4A 4MLCA 1JDBB 2EZUA 3H11A 4I9FA 1N6KA 1NBMA 1YU6A 4UE3S 1P3JA 5LOVF 4URHA 1VL8A 3AM5A 1EUDA 1H69A 1KY5A 2CFTA 2ZJFA 3KJQA 4J6FA 4AP9A 2IUSA 4DR7B 4NZYA 2XKAA 1RFLA 1R9MA 1L3BA 1X2EA 2PXHA 1Q0HA 3GELA 5FHRA 2B61A 2X2FA 2A7QA 2AXQA 3FWKA 3KKPA 5LQJA 4D44A 2N46A 3H1BA 2A58A 4MEJA 3KTAB 2X0EA 1XGKA 2OQIA 4PZZA 1C3OB 3FOCA 4P93A 3VTZA 5FA8A 2Y0EA 3CX8A 1SCIA 4F9EA 1GGMA 2XZTA 4ETIA 2ZT7A 4N65A 4RTRA 3LPCA 2F59A 3LLUA 1GAEO 1I4TD 1QFMA 4X85A 4R7GA 5FQNA 4DQKA 4PC1A 3UWOA 1TFUA 2CLSA 2IXTA 3KB8A 4ID3A 3U17A 1DC3A 4ID9A 1UBEA 1YONA 2NO9A 3PFFA 4ZHQB 3IILA 3TN7A 1D4ZA 1I7NA 3A4MA 3LIIA 1LD3A 3BWEA 4XCXA 2V8BA 2XE8A 4REQB 3R7FA 5TE9A 4D8XA 1TYBE 2XMZA 3O4GA 5ECDA 1UT6A 1E0JA 4GDMA 4LHVA 1T10A 4KQWA 1EP2B 4P4LA 3WRVA 2QXTA 4Q7QA 5CT9A 2CJYA 3B52X 3HWX1 4IHJF 2ETVA 5FWNA 1JR4A 2WFLB 4CN9A 2AN3A 1XYYA 2CLDX 3K8YA 4KZKA 1OILA 4OJKA 4D56A 4BEVA 4RW0A 5IFLA 4UDYX 4OXRA 3SVZA 2B4AA 4D9HA 1OD6A 2QAJA 3MD9A 1TM4E 1SRQA 1Z2AA 1ECFA 4JCOA 3PJRA 4OIMA 5F35A 1EZ4A 3MAJA 5G4KB 2HX1A 1XDDA 2QLNA 3IPYA 5BNZA 4FNGA 1VMAA 1K6MA 2GX6A 2I87A 3LBNA 1S96A 4C2AA 1ANKA 2GILA 4D3YA 2WYOA 4X95A 2KS6A 1C9YA 4LPKA 1V7ZA 4X8LA 4CMBA 4GX5A 3PNSA 1SZJG 4N8EA 4A03A 4G84A 3EDCA 4OHFA 4PU0A 3VBEA 4YUAA 3HKDB 4E1VA 3B12A 4KGVA 2BELA 1R8JA 3CC8A 1JR2A 2TECE 3CTMA 3OIYA 5BWLA 1XRRA 4U7PB 5CT8A 2JCVA 3EVNA 1Q2UA 4RZ2A 1YK0A 5EIFA 2QY9A 1DEHA 4KXWA 1QH1B 1HZJA 3N6XA 5EZYB 3DZDA 1OYYA 5CGZA 4ZVVA 4GNRA 3O8NA 4TS1A 1GV0A 1GU0A 3H5LA 1JJVA 4MIYA 4GIBA 2WJJA 4YRZA 2O20A 2W2KB 2ZBEA 3WJ2A 2V7TA 4RA6A 2D6FA 3TYXA 4IHAA 4GPZA 1TVKA 3UWKA 1B23P 2Z0MA 1FYDA 2VPTA 1QQBA 4ZQBA 3WMFA 4AZ0B 3HR7A 3KWMA 1L3CA 3Q1KA 2DPYA 2D7CA 2OCKA 1XLTA 2N42A 2ZAYA 1T0BA 4GRDA 5K3BA 3HVJA 2NU9A 1I7CB 1I3NA 5I9IA 4C3OB 1U9YA 5KWJA 3MT7A 1AMNA 3FDIA 3H2HA 1R6TA 1M1YE 4PPNA 2X40A 3MTQA 4QL3A 1IN8A 3ED1A 3OEHD 1CJTC 4X7MA 1E60A 3U31A 4KXMA 3ZXIA 3ZWCA 5HM8A 3OT5A 1X1TA 1XSEA 2XMDA 1N2EA 3I3SR 5HF6A 1NW7A 3T7KA 4C6TA 1G55A 5EEHA 1C30B 1KMHB 1ADYA 5IC6A 3WYGA 1GVHA 4D0LB 1V41E 1F8GA 2PH1A 2UYGA 3CNOA 4X00A 4AG6A 5EHXA 2AJLI 2VTDA 2C95A 5KJFA 2J0SA 2X2PA 1E6EA 2I6SA 3IUJA 1A69A 4ZP1A 2BEKA 2EKDA 3GOHA 2VA8A 2Q29A 1Z0AA 2VO1A 3JWHA 5B2EA 5CEJA 1IN1A 3ZGVA 4D41A 4IOJA 4M3NA 5HPYB 1EGQA 1YS1X 3SJZA 1P8JA 3GEHA 2ZBRA 5A7HA 2Q3FA 3O3OB 1FLDA 1WPGA 4IDCA 5E6UA 1HM5A 3IIKA 1YE8A 2CMDA 4TMTA 3ECAA 3D3JA 1DT5A 1JBKA 5AKEA 2ZE8A 1T3TA 3K9NA 2OC4A 2ZTHA 3ANSA 5EIBD 3RVPA 3BICA 4Q24A 2PUAA 3B6ZA 1G5PA 2DHDA 2DR3A 2IYYA 1PGQA 3A6FA 4EG1A 3UGJA 2ZYAA 1H2BA 4JBIA 4R5HA 3LLSA 2Q4OA 1MW8X 2AMLA 1TT5B 2SKEA 3H6KA 4TKZA 4DLBA 1E2DA 3EVEA 4C3VA 2I7XA 4B09A 4HJRA 1KR2A 5EN4A 5B55A 1GP2A 1BG6A 1LJLA 1RM5A 3D4PA 4WGGA 2A4MA 3DTYA 2AK3A 4XB6B 3OHMA 1CJSA 2H4ZA 2IU0A 4CJXA 1H2XA 1HRDA 2MSLA 3OU6A 5LMZA 4FEAA 2ZSFA 3OMXA 1JG2A 4I6JA 4J1SA 4JLMA 5KJCA 2C00A 3L8YA 3MQ2A 3PIIA 5ILGA 1XV5A 1ZI8A 3FOFC 4YVFA 3H3FA 1NRWA 3WP1B 3SQWA 4QT0A 5HVNA 2IEZA 1RWVA 1JIJA 3KXLA 2BSAA 4WTOA 4JROA 1NJ6A 2PKQO 1G2QA 1OV4A 4M1YA 5LA6F 5HRCA 4RO0A 5JADA 3RHZA 1ZUHA 2XB9A 5BNTA 5KJEA 1LBQA 3A6EA 4WKBA 4AKEA 4B80A 1V5FA 4N5MA 3SMQA 3BMQB 4P4GA 1HY3A 4ZO7A 3UAWA 1ENPA 3B1VA 4BMOB 1T6NA 4RD1A 4YMUA 2Q2VA 4RABA 4AX8A 3MT0A 1PW7A 1AO0A 1UPXA 4MB2A 2ABWA 2IXDA 9LDBA 2WFZA 1ZZEA 3HTXA 1SU4A 4IIJA 2QXYA 3GW8A 3RYFA 1JBQA 1PZFA 1PUXA 4EO9A 4KITB 1A8QA 1OXUA 3K0BA 4UUQA 2VF8A 3NP7A 4EW2A 2OBLA 4J0KA 1QB8A 4EGJA 1UMCB 1KVTA 1W52X 2BZSA 2QSUA 3KDSE 3P9ZA 2Q9UA 5HKLA 1K9VF 4AECA 3DT6A 2C2XA 4PCAA 4Y1EA 4LX0A 3OEHA 2XRZA 1JHZA 2Z4RA 3DHWC 3KALA 1B6TA 4M9XA 1LRKA 3KUDA 4LY0A 4MW0A 2B36A 5JLAA 1EZ1A 1QAQA 3DE3X 4HDMA 5GZ3A 4G5RA 4GX2A 4DSOA 5EZ6B 2A5FA 1XDZA 2B4TO 1U7TA 3IHKA 3MHTA 3WDKA 1LBSA 4QRIA 4MAFA 3DDHA 1HFJA 1KOFA 1BEEA 4HQLA 4Z9FA 9ATCA 3HYCA 2KE5A 4CLOA 4HB4A 4PZ9A 2JA1A 1WB9A 2GJSA 2I7TA 3FBGA 1AMOA 2IYAA 1UKAA 4MV5A 1ZEMA 2ZIFA 4D9MA 2BHSA 3CN9A 1TMGE 3JQBC 4GE3A 4XEUA 4DPKA 4A1OA 1JYEA 1I1OA 3OI7A 4O2RA 1TW2A 3WHLA 4KN9S 2QD1A 1ONPA 4QOFA 2F6RA 4JZYA 1ZNZA 1TLTA 2QN3A 4W1RA 2G70A 4DNQA 8AT1A 3PKIA 1V7CA 2VRNA 4GVXA 2ICAA 4NH0A 2DT5A 4QEDA 3T12A 4CEIA 1XMIA 5KU7A 3UCEA 3W6PA 5DLPA 2E5LB 3GFGA 1NXOA 2WTNA 4IJQA 3RWOA 3EGXB 5AW1A 2ORYA 1A4UA 3V1YA 1JFRA 1DXQA 2HLHA 3NHPA 1DARA 3MINB 3BQ9A 4P5PA 4QECA 4BFZA 2HWKA 1PZGA 3QTTA 3MJVA 1JX6A 3IXLA 4J0QA 4B74A 1E3EA 6LDHA 4TLBA 2V96A 1S3IA 1N3BA 2G1KA 2OV8A 2PAAA 1RQPA 4KXXA 1SU6A 5FOSA 5FUVA 4NAUA 3O1HB 1OHHD 2G76A 1Y4AE 4YHBA 1KWKA 4QJBA 1LNQA 2Y76A 4RJ2A 2WWTA 3C4QA 3FNEA 4PLWA 3VGJA 4QQNA 2OZLB 5K0CA 4MQFB 4KPFC 3KB6A 1G1AA 1Q2XA 2O7QA 1UH5A 2YZGA 1RCTE 1U1FA 4MDHA 3A1CA 1H1DA 3PFHA 2LNDA 1FNSA 5KNBD 3W5BA 4LWOA 3O03A 1VHJA 5J63A 3KUCA 2I99A 2VDLB 5ES3A 1T9DA 1NURA 1E59A 4A2PA 3L1VA 3FPLA 4X5OA 4BZPA 3L49A 1H42A 2NMVA 2FWIA 3UT5B 4DCSA 4A0SA 3WGGA 3RK0A 3EHDA 1PWXA 2IFTA 2EW2A 1IVYA 3OTWA 2W70A 3UCFA 1WE2A 3BREA 4YJFA 4EMTA 4W8GA 2VPYA 1QHNA 1QG2A 3HA2A 4BFVA 3NHJA 1M34A 2JCXA 4G01B 4UUNA 3UXMA 4ZPXA 3LQ2A 2X6TA 3IWDB 1N8NA 2DBYA 2V7UA 2WZDA 4AS3A 1Z4OA 3IQXA 4E2ZA 2GMWA 4YPVA 5GONF 3K6RA 4BNWA 2ONZA 1E69A 1UC5B 5C7IO 5JQGA 4TV9F 1YI8A 4G4SP 4EGQA 1R5BA 3OQ6A 1LK7A 3SS8A 4LRYA 4RH0A 2WP8J 1EDOA 2QVYX 3HY4A 1N3YA 2CJXA 4GWGA 4KXQA 4U63A 2AJBA 2CL5A 3BA6A 1CY4A 4H17A 3TQFA 3TM4A 2V0GA 1UZLA 2C4KA 1MIOA 2H16A 2K2WA 2BCGY 2PA0A 4LQCA 4MUNA 2JIZD 5JYBA 2A5DA 2LCIA 1NV8A 3NWEA 2P2ZA 4M0MA 1GARA 4KQIA 2C5LA 1PSDA 3FTCA 1UP6A 2HFKA 3HEAA 1MA3A 4GLOA 5LQKA 1W87A 3H2IA 1PJRA 4FFBB 4JT2A 4D97A 3FUVA 3W6OA 1J49A 4YRBA 4F7WA 5JZOA 4NMLA 3E2PA 4PPYA 1U9CA 1EWTA 3W8EA 4EYSA 2YWFA 1Z75A 2JI7A 4M9CA 4B6OA 3AOEA 3U40A 3NIDB 1ZAYA 2N3ZA 1BZYA 4C7MA 2EL9A 1WTCA 2H9AA 2X14A 4XCQA 3LBYA 5LWHA 3C7KA 3GUUA 1ZEJA 3N2ZB 5H70A 3M9LA 2RHBA 3OZ7A 4AY4A 1GN8A 5E3IA 2HHHB 1K92A 3EDOA 3X1DA 4ASUA 1HYHA 2CGEA 1KDZA 1JHUA 1AK1A 2DKOA 5KYWB 3F3MA 4HDKA 1ZGBA 3CW8X 1LK0A 2YY6A 1NLZA 1DKPA 1L5HB 3NAQA 4WHMA 1MQ9A 4KU4A 2F9FA 4JUFA 3V8EA 4URVR 3ZIAD 4RMJA 4W4TA 3NHWA 3UBTA 3IDSA 4RBNA 1Y7IA 2VLIA 3U3RA 1JHAA 4J3NA 2O8DB 5ALXA 4S24A 2Q27A 3G6KA 3QHQA 1D4FA 4EB3A 3SXUB 2RHCA 1GPLA 1E3LA 3LIPA 1ZIOA 4L8WB 3UPDA 1VBKA 2F1HA 2QUIA 3EDMA 3D4BA 4P3PA 3I6IA 5T6MA 4UEJA 5EJ7A 4C14A 4FLFA 1NRXA 5JS6A 3R7SA 1E64A 4WCVA 4KQXA 3Q2IA 1N2CE 2B1IA 2EEZA 5G3YA 2JLAA 3DL0A 1CHDA 1RYYA 2CKDA 3K7EA 3WXBA 3ZE9A 4LVUA 5JH7F 5KTNA 5AMXA 1G5RA 2YFQA 4HB2A 1XJ0A 3ND7A 3NH9A 4OAOA 3ZXYA 4HLDA 5B53A 1EXVA 2V65A 1CR6A 2W71A 4NONA 2PT9A 4QBFA 1CTQA 4R84A 2P9JA 4IILA 3I09A 1LDGA 2GM5A 4G5XA 3L8ZA 5TVKA 3RRYA 2J85A 5HQTA 1Z5PA 2FE1A 1W6UA 2I6FA 1E9DA 1MN6A 2HK7A 2HTFA 2XCQA 2B92A 7GPBA 4JEUA 1YRWA 3M89A 3BSWA 1E6LA 2JGDA 4DTIA 2I8CA 5A1JA 2FEKA 1UDWA 5C34B 2PLNA 2OBBA 4PSAA 3O1IC 4UNIA 4WINA 3NANA 4R2KA 4MW6A 3KX2A 1J21A 1YIDA 3M6MD 1M8KA 3MJHA 5BUSA 3C6XA 1Y1LA 5JNRA 2AE2A 1V8OA 1O96B 2A0YA 3GMTA 2EJBA 5EP2A 2ZRIA 2CFOA 2O2ZA 3WO1A 1UINA 1II8B 2I2FA 2PPLA 3H4TA 2ZI9A 4MWGA 2VH5R 3I2HA 4HLUA 3B7GA 2OFOA 3QPDA 1X42A 1YJ5A 1K9SA 4R0VA 4DQUA 1P4GA 1ZESA 1IJKA 2LVBA 2CNWA 1EUCA 4H9GA 4R51A 4O1MA 3RUDA 1C1DB 3O93A 1R74A 3AEXA 1BRMA 5ESRA 4B8ZA 3IQFA 1E66A 3P52A 3QFRA 4G9EA 1KARA 1SVIA 3NT4A 1FJ2A 3KB2A 5ABPA 1QB7A 4OGGA 3DBVO 2WOOA 3L05A 2Q7XA 4TM8A 5D1HA 4KSBA 3CVUA 4FR0A 4BPBA 1EESA 5I7HA 1CKEA 4MGIR 4FFMA 3DA8A 3AHDA 2WSLA 4O2BF 1ZONA 5K8UA 1QRAA 2Q3DA 1RZVA 3KYDA 3M33A 4MYCA 4CNBA 4RDCA 3ZXXA 1V11A 2F64A 4BNZA 5GMOA 3TTUA 2DG2A 1JKJB 1P72A 1BC5A 3AH8A 4XWKA 4IIYA 1QK5A 1YWGO 2C3UA 4ENVA 3VDNB 3BVPA 2PUHA 1QH8B 1FQOA 4EWLA 1NE7A 1NR7A 4QJIA 4YRKA 2HI0A 4NZ9A 2ACVA 3G0CA 3IALA 3KOZA 4R6WA 5KCMA 4HADA 3Q3EA 5KYYA 5JH7B 2ODAA 3I23A 3S2UA 1Z36A 3KQKA 2F1OA 2XCUA 1T6ZA 3SY8A 4RLQA 2IZ7A 2P1DA 3A4IA 3AIKA 2P27A 1PS8A 5SY4A 2P0YA 3ENQA 4R8KA 4D0SA 4FCCA 4RXMA 1OB5A 1GOTA 3HNRA 3KD3A 5EIAA 1HNZB 2V6JA 3EIXA 4EPRA 2XODA 5K2OA 4EW3A 3REOA 4DR6B 3FCCA 2WSMA 3GT3A 2B9EA 1E79D 2CXNA 3BWYA 2JCYA 3N8NA 5EJFA 1GNSA 1QHHB 1VPLA 1KO1A 2OBYA 5B1IA 1QRUA 4O4HF 1K66A 3BH6A 3D8TA 2WD7A 5T41A 2VJPA 1NVUQ 5T64A 3WYNA 1NR1A 3GXOA 1E62A 5BYBA 2PGLA 1PR5A 3BWVA 5COAA 3AZOA 1CYEA 4ZZ3A 1K68A 5B3KA 1OFHA 1FTNA 4YQEA 5D01A 1V26A 3GNLA 5C52B 1HOTA 4YCSA 1FDSA 4RZUA 3LQ1A 4GP9A 5FUQA 1XNHA 3KSZO 1E94E 2P5TB 3K5PA 3TLBA 3LXMA 4HPXB 2Q5OA 1VSBA 4MGHA 3KHUA 1ZXLA 5IARA 1J8FA 4CV0A 1T9GR 2BOVA 2IYQA 5BP7A 2P0EA 4DHWA 1YIAA 1XQ9A 2A9KA 2GN9A 3R0ZA 5DHAA 2R6HA 2G9UA 5MFPA 2RH8A 4NJMA 5LOVA 2FWJA 3SYKA 2PLAA 3VFDA 2P75A 1P9LA 1MAWA 3ZTYA 2BY4A 2PGOA 4AUEA 2GN1A 3MWLA 3E4DA 4F5DA 4H6XA 3AF2A 5BW8A 3ZQJA 4ZGGA 3B89A 4KFSA 1QVZA 3HLYA 1ZVMA 1N6IA 3TR6A 4BE4A 4E4TA 3QVJA 3OG9A 3KUXA 3ELYA 4LDRA 1JPNA 4L0DA 2VP3A 2WB4A 1I7QB 2A14A 4HNHA 4F86A 1IHYA 1NQWA 4ASUD 1SFRA 4L5BA 3IL2A 4FDVA 2X0RA 3K9WA 2Q1SA 4G0XA 3RI3A 3EVFA 5D3MB 1K5HA 2EQ5A 3JQ8A 2YNMD 3EUWA 4J9VA 1IEQA 1SBHA 1V71A 2WIKA 2FSPA 3BGOS 1CQIB 2ZXEA 3K6JA 5C31A 3SSAA 5ERGB 1GTJ1 2JB9A 4MV6A 2EAUA 3LY5A 2IYLD 2BMVA 5C1DA 1ZCFA 3P9CA 4WLEA 4G0MA 2GAIA 4X9XA 5EZYF 3BMNA 4MVYA 4CQLB 1P9RA 4Q4HA 4XD2A 2B7BA 3ECCA 3H5RA 4Q37A 1MH1A 4TT3D 3ZEAA 5ECGC 1YQGA 3LGAA 5KYVA 1T35A 3AUXA 4BBAA 3GGOA 4BO5A 2JK1A 1MJGM 3K4HA 4XASA 5KTPA 5CFOA 4QUBA 2P3LA 1ABFA 3JTEA 3PHHA 1L4EA 4NCXA 1EP9A 2M6LA 1EE9A 3JVIA 3PUKA 5IU6A 5MGBA 1T4MA 3TAXA 4BJ3A 2PBLA 4IKEA 4AJLA 2XNKA 3BJRA 2B4RO 4BQPA 3CSSA 1VJ0A 1RXWA 1RYHA 5CD1A 1NUHA 3OCXA 1MABA 2O19A 1T2VA 2ZIWB 4DCOA 1L7MA 2RIRA 3ZD9A 1XALA 5FADA 1NYTA 4JJ6A 3EPRA 4OKIA 5EKDA 4ZVNA 4UM9B 2B82A 4LJ5A 2WUWE 5JXGA 2H6EA 2GT1A 2W11A 5AKZA 3EVAA 4X7BA 2O7NA 3CCCA 1OY1A 3RANA 1GQRA 1IE3A 2Q0QA 3EW7A 3JAKB 3I45A 1DPFA 1QHEA 2QXUA 3HVIA 4JVLA 4MYTA 4FC7A 3IIIA 2I3DA 4GEKA 4ZDKA 1U1GA 4WJLA 1I24A 3HP4A 3EGWA 2PX2A 3AVTA 2G17A 1ZJYA 5KDLA 3CRW1 1YBAA 2QYSA 4D7AA 1P7YA 1UK6A 1V8ZA 1E9FA 1Z12A 3QYAA 2GCEA 4P54A 5K01A 3AEQB 2X7JA 2YWCA 4RGYA 1UWCA 4J49A 1A97A 4S12A 3VR2A 1EIWA 2NXJA 4Y2PA 2AG1A 3E0XA 2Y1DA 2Y9MB 3LY7A 3KOXA 2JGAA 5AW5A 1XAIA 3T7JA 1IRXA 2WINI 4I36A 3HA5A 3ETDA 4KKXB 3LOUA 4TYNA 4J0GA 1L2TA 1EXWA 2N75A 4P38A 1UQTA 1E3TA 1Y3BE 1Y4ZA 1T25A 5TGTA 2IH4A 2WDZA 5KVCA 4K6FA 1DO8A 4E33A 4XSHA 1PFKA 4RVNA 1NBME 5DYGA 4BXOB 4WCFC 5C8XA 2R6ZA 4KPUA 4NCHA 4RGBA 8ADHA 2FPSA 3AI7A 3DLBA 3HC7A 3TM5A 3HUUA 1NQAO 4PG8A 1GL9B 1XCLA 2ZYIA 3GLHE 3HRIA 3KPJA 4GNKA 1A50B 1JHPA 3L7LA 3UMGA 5K0EA 2FW0A 4ZAYA 1DEAA 3GIWA 1HE5A 1K3TA 1J1UA 3HN2A 3C8MA 4AURA 2W6JD 3UK1A 3JARB 5DGXA 1JEOA 3FHJA 4KQJA 4QLBA 4KH1A 2WU3A 3LOQA 1UMKA 2V0CA 5CEFA 2YQZA 1O4VA 1F2TA 4WOCA 3RVKA 2CXTA 4O59O 2EFCB 2CVHA 4WFJA 1F0KA 4OHZA 3K4PA 4XLZA 3RS2A 2QIOA 4I46A 2JK0A 2OZEA 3B2EA 5BWMA 4NDAA 1KOLA 4IIUA 5EKUA 1NBMD 1WVMA 3CU5A 4PPQA 4ZYWA 4JT4A 2UVQA 3V1TC 3RS0A 3I34X 4C07A 2R8ZA 1XELA 3QI7A 5F78A