3E6AA

Crystal structure and functional analysis of glyceraldehyde-3-phosphate dehydrogenase from oryza sativa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
334
Chain Sequence
KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
publication title Crystal structure and Functional Analysis of Glyceraldehyde-3-phosphate Dehydrogenase from Oryza Sativa
rcsb
source organism Oryza sativa japonica group
molecule tags Oxidoreductase
total genus 84
structure length 334
sequence length 334
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3e6aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e6aA01
1CDOA 1P31A 2Y66A 1WDMA 1KC1A 3HDQA 3U4CA 1SBYA 4XZ3A 4RPJA 3MJTA 2UVDA 4O1MA 1KEVA 4YJGA 2NWQA 2Y0CA 4LISA 5G4KB 3VZQA 2PWZA 2BI8A 5K6AA 5KTKA 5G0UA 1AUPA 4RF2A 3JYQA 4ALKA 4J90A 2C20A 1PR9A 2DQ4A 1PWZA 3IQDB 4J91A 4LGVA 4YCAA 2OP1A 1MGOA 3D1LA 4R16A 4GQAA 2GO1A 2Q99A 3TZKA 5IJZA 1T2DA 1LLUA 2VUUA 5LDGA 4ZN6A 1PJQA 3NGLA 1IUKA 4J6FA 3EVNA 3PLNA 1WDKA 2YV1A 2EP5A 1MP0A 2H63A 3B20A 4J1SA 1I2CA 1MXHA 4INAA 4MIYA 3I9MA 3CINA 3WS7A 4XR4A 5IDWA 4PFJA 2CUKA 1ISJA 4FOOA 1YB1A 1ENZA 1SC6A 2E4AA 3Q1LA 1Y81A 4OXYA 3T4XA 4CQLB 2IZ1A 1YBVA 2HMVA 2VCYA 2VZ0A 2NU7A 2OL4A 3TZQA 1X0VA 3CMMA 3TRIA 2F00A 4UUNA 5TS3A 1PIWA 3OQ1A 3ZWNA 3H9EO 4FPXA 2TMGA 1T1RA 1Q2XA 3T4EA 1DO8A 1LX6A 3CTMA 5T73A 4ZU3A 2NTNA 4MIEA 5BT9A 1CYDA 1Q0HA 4BHTA 1LLDA 2QX7A 2EWMA 3JSAA 1NPYA 5KNLA 1N2SA 1GUYA 3SXPA 4BNNA 2DTXA 4R68A 4OGWA 1E1LA 2X22A 1LC0A 4A03A 3WLEA 4BB6A 3GAFA 1T2FA 5H82A 4F6LA 4NBTA 4KDEA 3F5QA 2P5YA 3CIFA 1U5CA 1B8VA 2XOXA 4AJEA 3IJRA 2IDZA 1KETA 4QQRA 4E0BA 3LK7A 2I3AA 1XU9A 4BMNA 1IHYA 1EZ4A 3IMFA 3ON5A 4CLRA 4S1VA 3HDYA 3RFVA 2YFHA 1IL0A 1U3TA 4DC0A 3WGHA 3RVDA 1VM6A 4OMUA 3EYWA 2B5VA 4DLBA 1K89A 2UYYA 3G3EA 1H6BA 1Z82A 3JQGA 1HZZA 3A4VA 3BHIA 4M49A 1KVTA 2O7QA 4WK6A 4Z3DA 3JQ9A 1NM5A 4R3NA 1H0KA 2BKAA 4DIFA 1EVYA 4DQVA 3I4FA 1BDMA 2H1SA 4GLOA 4RPHA 3DMYA 3D3WA 2YQ4A 3RFXA 4D0RA 3JQ8B 3IOYA 3HZZA 3WNQA 1VSVA 2X8LA 1ULUA 4AVYA 1K0UA 5TGDA 3FCOA 2EF1A 4UVEA 5FI3A 1BTOA 4TVBA 4F6CA 5DN9A 1SO8A 4OM8A 4H7PA 5AQ1A 4GVXA 3PIIA 4H15A 5JDIC 4CM7A 1SCUA 1I0ZA 4GL4A 3OETA 4BNHA 1U4OA 4PLPA 1LNQA 5F3RA 2F1KA 4JX8A 3U4DA 1BXGA 3H2SA 2VRBA 4N7RA 4AFNA 6LDHA 4FCCA 4YXFA 5TT0A 3IDSA 4E32A 3W4JA 4M86A 3ZU5A 1R16A 3BTSA 2DUWA 3DO5A 1R4MA 4YACA 3G1UA 4CV3A 1J49A 1H2BA 1EUCA 3VH3A 2VRCA 5HS4A 2UUOA 4EYEA 1P33A 4RCVA 4XDYA 2GN9A 2X5OA 2JCXA 5G4KA 2NU8A 3DZBA 4B7UA 3OEYA 2BFOA 3D3EA 3WX0A 5M6DA 3VHRA 5T67A 4QO8A 1IHXA 3LF1A 1RM0A 2BH9A 3NT5A 2QRKA 3F5SA 1F14A 4GH5A 3ASUA 4O6VA 4XX0A 4B3IA 1Q7GA 3HNPA 3OJ0A 4DGSA 2YUTA 5L4NA 3SLGA 5A05A 1EUZA 1ZK2A 3UVEA 4CM8B 1YRLA 2X9VA 4IXWA 2B69A 1V0JA 3ONFA 3ZHBA 1TI7A 2G82A 4ALLA 4QEDA 3H5AA 4GGOA 2CMDA 4CQLA 1PR3A 2FN7A 3ZNPA 1GZ6A 2Y0DA 2C7VA 5K6AC 1LTHR 4PRKA 2VHXA 1UXIA 4IUYA 1DPGA 4CMJA 2GPTA 4UAGA 3ZWYA 5A04A 3FWZA 2EW2A 2D5CA 2AW5A 1U8FO 3D64A 3ONDA 4MKZA 1PGQA 5AVOA 4W82A 3UCFA 3S2GA 4JXKA 2EIHA 4RJTA 3P2YA 5I7VA 2C5AA 1J0XO 4Z0TA 3WGGA 4D46A 4RO0A 1E1NA 2GGSA 2B37A 3PJGA 5MDHA 5KVCA 3OJEA 4MO2A 1KVSA 3EZYA 2VYVA 4R1UA 3I5MA 3JQBA 4MDHA 4IZIA 3PI7A 5L7YA 1PEDA 2WD7A 1C0IA 4EEZA 1P77A 2VNAA 4GI2A 4CUZA 4Y98A 1B8PA 1UZNA 4BO0A 3KEQA 4Y6SA 4A27A 4PLWA 1EVIA 4BKUA 4DTIA 2FSSA 1NFQA 5C7LO 1WMAA 3H65A 4GBJA 1UXKA 1ZO8A 3LT4A 4WOJA 1XELA 4IINA 3C7CB 3RUDA 3E9NA 3HFGA 5EERA 3QWHA 4LMPA 5EQFA 2EP7A 4Q3CA 2P68A 1IULA 3ITDA 1DBVO 1T24A 1GUFA 2Y93A 2D3TA 4NMHA 4NPCA 3VZSA 3ASVA 3ROKA 4XGNA 4AG3A 1UAYA 4IXTA 1AE1A 2Q1SA 3WQQA 1K3TA 1EK6A 1PGPA 1QP8A 3F47A 4DPLA 2PKRA 1OMOA 2HQ1A 2Q1TA 2XXJA 3AUSA 4XYGA 3TOXA 5JPIA 1Y5RA 4NDNE 4MOWA 3JQ8A 3W1VA 5HA5A 4NK4A 2BELA 4GLLA 5CEFA 1E1KA 4WLEA 1GAEO 1JA9A 1QSGA 1T1SA 2ZB3A 4B4WA 1NVTA 4ZRNA 4LW8A 4Y6RA 3W4IA 4CUJA 4Q3DA 3ANLA 4YPOA 2YV2A 3H2ZA 3L0DA 5DCWA 1QYXA 3ZU3A 4GPD1 1RYDA 1V8BA 4TSKA 2GN4A 7MDHA 5JW6A 4UVHA 4QT0A 4XYBA 1N1GA 1LI4A 4RQUA 1R66A 4BNMA 3JQ9C 3U5TA 3LU1A 1P0FA 2X4GA 3L6OO 1WNTA 3BMNB 3TDKA 4QXMA 1HSOA 3GNSA 4FD3A 4PN3A 1LUAA 1J6UA 1ZXBA 4I08A 1YGYA 5B12A 5JYFA 3DOJA 3UGKA 1ADGA 3SLKA 1ZJZA 4B79A 1B14A 4ALMA 2J5KA 1SOVA 3QP9A 4OXKA 3C3XA 4DQUA 5F5LA 4YRBA 2X6TA 4J1NA 5CP8A 1GDHA 1YKFA 1VJ1A 4AJNA 1AHIA 1KEPA 3JD3A 5AYVA 5J9GA 4JGBA 2DBQA 3H8VA 3E9MA 2O7SA 3QV1A 3JD0A 3MWEB 2Y0EA 4R1TA 3DMTC 1NYTA 1DDOA 2JD2A 1VLLA 4W9NA 4D44A 2H9IA 3HE3A 3BTOA 3ZV4A 1O0SA 4OKIA 4D42A 2ZB7A 3KUXA 4CM8A 2O4CA 2R2GA 3WFJA 3GEDA 4KWIA 3PQEA 1L1FA 4OQZA 2VRCD 3V1TC 1EEHA 1JW9B 4PRLA 3UXYA 3MJEA 3UUWA 3AUTA 4Z9YA 1R37A 3DXFA 1DOHA 1I3KA 1K6XA 2UDPA 1WLYA 4E33A 2I5PO 3QSGA 5COQA 1Q7BA 1JKJA 4CR8A 2Y05A 1PJLA 3AWDA 2AQKA 1K2WA 2PFGA 1NFFA 2GZ2A 3KTDA 4WLOA 2Z5LA 3GH3A 2GSDA 1GEEA 3RJ5A 1X7GA 4XB1A 3OIDA 1UAGA 4AJ1A 1ZK0A 1ONOA 3E82A 3W8FA 1VKOA 4NJMB 3OA0A 4BO9A 1EDOA 2FOIA 3DBRB 2EEZA 5JO9A 4CM6A 1HT0A 3AY3A 3TN7A 3KSUA 3Q3CA 1EFLA 3E5RA 2OFPA 2FRDA 4MVJP 3ZCXA 4E4YA 1I3LA 4A73A 1DC6A 2I99A 3FBGA 2YHUA 1OBFO 1YJQA 4R3WA 2BLLA 3BHJA 3ZW8A 1FDUA 3F3SA 1E92A 1RWBA 2B36A 5CDTA 4A10A 5F1PA 5KJ1A 3WWYA 5CG1A 1ZZEA 5T8KA 2FZEA 3LT0A 2UV8A 2Y1OA 3MJCA 3ZNOA 3DC2A 4E5PA 1NR7A 4W7IA 2OMEA 3ZZNA 4BNWA 5CEJA 4BKPA 2VHWA 2YYYA 3F4LA 4GVLA 3F6YA 3VH1A 3OEWA 4PCVA 4JBGA 2PNFA 4X54A 5G2OA 4CJXA 1GD1O 2PGJA 4BNFA 1KY4A 5DDIP 1UDBA 2NQ8A 4BNUA 4BNKA 4E2YA 4HWKA 5JCXA 3LF2A 3JQAB 3MJ4A 4ND4A 2HK8A 3N74A 1V6AA 3KSDO 4K28A 1UDCA 2NU9A 1F17A 2X9NA 1N9GB 4B4UA 1SMKA 2O3SA 3AI1A 1A9YA 1RPNA 2I9PA 4KP7A 3GG2A 4JROA 4BO1A 4OL9A 1MLDA 2PR2A 2P5UA 1B8UA 1F06A 3I9JA 3AJRA 2V6BA 2H5LA 3S2FA 1YB4A 1HDZA 4CMCA 3P5SA 5L3ZA 1X15A 1PZHA 2YY7A 4XJSA 4CV0A 5F1OA 4ZQEA 2XF8A 3QY9A 3GRKA 3MJVA 2G5CA 2PD3A 3BMNA 1RM3A 3KV3O 3VAZA 4E5NA 4PLGA 3F1LA 4PG6A 3I52A 4CV2A 2VTDA 4IM7A 2WD8A 4L75A 4LCJA 5H81A 2DM6A 4WLUA 4HXYA 3DTTA 4LVCA 4M87A 4W4TA 3VTFA 4B8WA 4UUOA 4O63O 4ALIA 1N92A 1NQAO 1M66A 2O23A 4CPDA 2BGLA 4EITA 4IDEA 4XQ9A 5TQVA 2B35A 1DC3A 2NNLD 3K73O 4TMFA 1TB4A 4N5NA 2A4KA 3OJOA 5EESA 3S8MA 1W0CA 1EVJA 3TWOA 2LDXA 1JQBA 1XU7A 4J3FA 5BQFA 1AGNA 4LSMA 2DPHA 1I10A 1PJCA 1RJWA 2Z95A 4MVJI 3WMXA 3C1OA 3C1TA 4PZCA 3R1IA 5C37A 3V8BA 1ENOA 5CDSA 2Z1MA 1H93A 3UCEA 3W4KA 3H9GA 3PJEA 4O59O 3IUSA 4TRJA 1SPXA 4IGEA 3EDMA 3GMSA 5I9MA 1VRWA 3PVZA 1AXEA 3NDJA 4W7HA 4YEDA 1YO6A 3KETA 3GGGA 3K31A 5A9SB 4LSWA 5JC8A 2QG4A 3SJUA 3I9OA 3ZHYA 1I01A 5T57A 4IPTA 4NJMA 4O5OA 3DAFA 4E2WA 3DBRA 1A4UA 2PA3A 1XIVA 2FY8A 3GQVA 2ZCVA 3IC5A 1D4FA 1V35A 5BNFA 1XA0A 2D59A 3GRPA 4E5MA 4U6QA 3DZIA 3NT4A 4FC6A 2Y1GA 4YRAA 2ZYGA 2WE7A 5H83A 4BO3A 1RM5A 2J8ZA 5DCUA 5IAAA 5LDHA 3BMCB 2JHGA 3HG7A 1U1IA 2D5AA 4RZHA 1Y7TA 4BMSA 2FR8A 4PG4A 4CLEA 1X7DA 5DF1A 4CM9A 2VWHA 1EDZA 1LDMA 2EERA 3UICA 1GL3A 1QYDA 2GERA 4YT4A 5T6BA 2HAEA 3KYCB 4EJ0A 1HYGA 4NK5A 3NT2A 3R0IA 2O3TA 3QA9A 1HE4A 3KHUA 1GQYA 3DZKA 3NRCA 4GX5A 4CMHA 4YWJA 2AEJA 2WDZA 3AM4A 2O50A 4J0EA 2CF5A 3V2HA 2PGDA 2Q46A 1B26A 2YDYA 3TL3A 2C07A 3KB6A 2NADA 4UREA 3JQAA 1GTMA 3AY7A 4G5HA 1JAYA 5CFZA 4K6CA 3BMOB 5I8ZA 2HMSA 3GUYA 4IGFA 2Y1DA 4CMAA 1N5DA 3KYDB 2ZJ0A 4BIIA 1N9GA 5CG2A 2WSBA 3DTYA 1WAMA 3RKUA 3HN7A 5T8KC 1QV6A 2AG5A 4QFDA 1F12A 4BB5A 3ZWAA 4CL8A 2BFAA 5L51A 1SEPA 2VTEA 3TZ6A 2C7GA 2AQIA 4BNGA 1ZEJA 4RF3A 1LDYA 3BIOA 3L4BA 1YXMA 1MC5A 5JY1A 3PQDA 2VWPA 3NUGA 2GLXA 4IJKA 3QVWA 1WVGA 4MVJM 4Z6KA 2IRWA 2JFGA 1GZ4A 3RIHA 1UXJA 3QE3A 2PZKA 2NVBA 3OP4A 1E3LA 3TOZA 4DBVO 2DBZA 5B1YA 1AHHA 1DIRA 4BKQA 2P2SA 1GFSA 4CMKA 1C1DA 5B4UA 2J5QA 1L7EA 4IBOA 1U8XX 2G0TA 4JIGA 1MG0A 3NDRA 2J3IA 4TVOA 4DRYA 2C0CA 4JQCA 3O26A 1E7WA 3HSKA 1VL0A 2JL1A 3LDHA 4RVHA 4YQYA 3ZNQA 1E3EA 2GDZA 1X1EA 3BYZA 2I6TA 3KVOA 2IEDA 5ITWA 3AM3A 2W2LA 4Q3AA 1GY8A 1HF3A 4EZBA 3RC1A 1DRVA 3WGIA 3FNFA 1X7HA 3NGXA 3OECA 1NP3A 1R15A 4BVAA 1CERA 2VT3A 2C54A 1WWKA 1LC3A 3E9QA 4MKRA 3FR7A 3FSRA 3IKVA 4PZEA 3OMLA 2GUGA 1A4IA 1AXGA 4FBGA 4OO3A 1LJ8A 2WYWA 3QVSA 3ABIA 4FW8A 1WXDA 2AEMA 4PLTA 1A27A 4J7UA 5KVVA 4ZJUA 5HTOA 2HU2A 3KRTA 1Z73A 4NQZA 5IN4A 1PGOA 4YYZA 3H3FA 2TMDA 1E7RA 2QZZA 3JYNA 4ZQGA 1IPEA 3L9WA 5A9SA 2DU8A 3FHLA 1NVMB 1U2GA 1I5RA 1PL8A 1Z6ZA 4CLHA 4CM1A 2WTBA 4LK3A 4TKLA 4YA6A 4IS3A 3RC7A 2Y1CA 4PVCA 1D1TA 2QIOA 1XGKA 4FN4A 1NQOA 1P1IA 2HO5A 1LXCA 1Y9EA 1A7AA 4TQGA 5L7TA 3PEFA 4PLCA 1TVEA 4DBZA 1YDWA 3C7AA 1ENYA 2YV3A 2YDXA 1I33A 1E3IA 3QVOA 4FOSA 4GMFA 4MINA 2Y1FA 3JQFC 4XJTA 4DREA 3U0BA 3WOHA 2RAFA 3R3SA 4QO7A 1HXHA 3BMCA 4HBGA 1KERA 1LQUA 2Q50A 4L74A 4DXHA 3QWIA 4R69A 3HFSA 3EK2A 2PKQO 1EBUA 4I1IA 3GR6A 3KYCA 3HHPA 2RBEA 1UZMA 4XEHA 3KZVA 3WYBA 3MCVA 4MVJF 2P4HX 3V2UA 4QUKA 4BS9A 1QG6A 4DMLA 4FS3A 4WJZA 2X0IA 3QVTA 1Y8RB 5ICSA 1I32A 2X0NA 3WYEA 4KWHA 1XWFA 2ZCUA 3FR8A 2A35A 4WOKA 3RBZA 4MVJH 3HDHA 3VC7A 3BMOA 4OOEA 2AXQA 4AJKA 4RVGA 3KYDA 3GVPA 4Z0PA 5JAZA 1YQXA 4WCFB 3B6ZA 3TPCA 2WE8A 1BW9B 4NFYA 1NX6A 3CPSA 2X7HA 1ULSA 5I7SA 4BO4A 2CZCA 1P1RA 3AFNA 3L6EA 3PRJA 4CUKA 3D4NA 3MTJA 2I67A 4Z3KA 5A3JA 1ZMTA 1FF9A 1DJQA 3GN2A 3HUDA 4HP8A 4TZKA 4J0FA 3K2BA 1ZK3A 3AY6A 4MP8A 4PG5A 2BFPA 2JJYA 1ZKMA 1ZK4A 1ADFA 2Z1NA 3NKLA 4DYDA 4NH4A 1DIHA 3AI3A 1XQ1A 4GSLA 4RVSA 3JQAD 1HL3A 3M1AA 3EGOA 4JN6B 1HDXA 5KKAA 2PD6A 4OXNA 5IZCC 2WWRA 2Q49A 4XQGA 4I9HA 2EJWA 4FFPA 1DFGA 3PGJA 4E12A 3RKRA 1O5IA 3RUFA 5MGBA 3RCBA 2DT5A 2X5JO 4MIOA 4E6PA 2J3JA 1LSUA 3DONA 4Y6PA 2EHDA 4IQ0A 1OFGA 3OFSA 4L0QA 4AJ2A 1FDSA 1T4DA 4D3FA 3Q9NA 1MC4A 4YQZA 3UW3A 1QLJA 3DL2A 2GZ3A 1D3AA 3L4BC 4N18A 4Q9NA 4TKMA 5TF4A 2V6FA 3GDGA 3VKVA 4BKOA 2VWGA 4NI5A 1JKFA 4PLYA 1LRLA 4D3SA 1R0KA 4EUFA 1EQUA 3PYMA 1NQTA 1ADBA 2HK7A 2NVWA 4L8VA 4LRTB 5GZ6A 4L4XA 1E5LA 4JJIA 1WPQA 2PY6A 3H7AA 4GX1A 1ZCJA 2NU6A 2YHIB 5I9LA 1J5PA 4ZHSA 2NV6A 2PTGA 2QRLA 2CSUA 3ONEA 4J1QA 1Z7EA 4H16A 4M54A 4CL3A 3PPIA 3OF2A 3WWZA 1JAXA 4MPDA 2FWMX 2HKIA 1QXSA 2V6MA 3HADA 3GEGA 1Y5MA 2VHYA 2EG9A 2HCTA 2W2LD 4OSOA 3PLRA 3WSWA 1E5QA 4CMEA 4D0SA 3B1FA 1E6UA 1JKIA 4NBWA 3DBHB 3BTVA 3GK3A 4YR9A 3GOHA 3PFFA 1T2CA 4L4SA 5FEUA 2CY0A 5JSFA 1ONNA 1EE9A 4IDBA 2P4QA 3RROA 1S7CA 4FSHA 3D5TA 1UZLA 4AJOA 4R51A 3M2TA 2LDBA 4EW6A 1OOEA 4GSKA 4I5FA 1VPDA 1UUFA 4CQMB 3EW7A 1HE5A 5JYAA 4FC7A 2JD1A 2CD9A 2PK3A 5G0VA 5JMWA 1GZ3A 3GC6A 4M89A 1HLDA 3PFWO 5A3VA 4RPLA 5EQDA 3B70A 4BNJA 1LBEA 4CMIB 4CLDA 4RPGA 1D1SA 5G4LA 1ZJYA 1VKNA 3SX2A 4RVUA 3RQSA 3JQEA 4HNGA 1BXKA 2B4QA 5A9RA 5FWNA 3INRA 1DIBA 1E7YA 1FDWA 1GCUA 1DXYA 1O89A 3JQ6A 3ZWOA 5I9NA 3TL2A 4IJUA 3PWZA 1E0DA 5ILGA 3ZWXA 5JYEA 3VVCA 3NJ8A 3ENKA 4WLNA 1MFZA 1FJHA 1KBZA 2BI7A 5GZ1A 2YFQA 2GR9A 4A2CA 1KVQA 4EEXA 5JAIA 3MWDB 4YJFB 4KUHA 4HKTA 2OUIA 5BNTA 4RLSA 3TF5A 3I83A 4FIZA 3E6AA 1P1JA 1IE3A 4WCFA 3FNEA 3O9ZA 1D8AA 1ML3A 4J4HA 1BW9A 3DZFA 3ENNA 1T4BA 1Y8QB 4CODB 2C59A 3PP8A 2X23A 3CEAA 1DRWA 1EQ2A 4WEOA 5I7FA 4EJ6A 4XDZA 2ZQYA 1PS0A 1U4SA 3L9XA 4XIJA 3G79A 4D45A 4CMBA 4R54A 2PH5A 4XRRA 1IZ0A 3ZGYA 4AICA 3IS3A 5EPOA 1I36A 3ROPA 3WGZA 5KJFA 4NZ9A 5L53A 4FR5A 1VC2A 2IYOA 3AUUA 1PS9A 3WR5A 4CMGA 2WM3A 1N1EA 3ADOA 1G6KA 3NDIA 2V6GA 1NHGA 4TRNA 2X58A 2ZATA 2XAAA 1TXGA 3GGPA 2PKQP 4YVFA 3ZWMA 2E37A 2O3JA 2EKLA 5TSDA 1P1FA 3FF4A 4E13A 1R4NB 5L45A 4AL4A 1H9BA 4FJ0A 4PVDA 3TJRA 4KTVE 2BFMA 1X0XA 3LT2A 5F21A 1LRKA 2HDHA 1LLQA 2JAHA 3RUEA 2RHCA 1IPFA 3GMDA 4DA9A 2OORA 2DUUA 3OH8A 3DZHA 2WEKA 1O6ZA 3TSCA 2Q2VA 3IKTA 3CE6A 2DC1A 2I3GA 4S3MA 2WYVA 5L4SA 1DC5A 4P22A 3VKUA 1JDJA 3I9KA 1LDEA 2YHIA 4L73A 5CPBA 4CM5A 3CZRA 4IMRA 2RH4A 2B5WA 3QQPA 1HZJA 4G65A 4OOFA 3U9LA 2GN8A 4DWVA 4FFLA 5EJ2A 4XYLA 5ER9A 3R3JA 4J4TA 4DLLA 4IIUA 1QYVA 3N58A 1DSSG 4FGSA 1TLTA 1HYHA 1A9ZA 4JCOA 3RC2A 1XR3A 4YAGA 4CM4B 3RUCA 2W90A 2FPGA 3EAGA 3OIFA 1DIGA 3DBHA 3INGA 2GRAA 4J2HA 4TWRA 2JCYA 4QFCA 1H6CA 5TLSA 1OC2A 4WNCA 4CQMA 3HJAA 1VSUA 1W73A 5KOIA 4NNJA 4CLOB 2RH8A 1RYEA 5L4LA 3OJLA 5AXBA 5JS6A 1YBAA 2GD1O 3GVHA 1NASA 1VL6A 5DBIA 3CXRA 4CMIA 3KLPX 4D7AA 3GF4A 4CMEC 3WSVA 2BGMA 4WNIA 2CDBA 4WGGA 1LSSA 3LC7O 4FDAA 3KO8A 3AOGA 2AE1A 4GX2A 2FPIA 1PL6A 2VNSA 2V7PA 2VZ8A 3ZNNA 2EXXA 4BO2A 5JBIA 4BV8A 4RF4A 1ZEMA 5JY6A 3QWAA 4YBZA 3WGQA 1QYCA 4HY3A 4PLZA 5KIAA 1I30A 3ITKA 3KEOA 2VYVD 2P9EA 3JQBC 2BHLA 1UP7A 2G1UA 4IDGA 4URFA 4YJFA 2GN6A 1BXZA 1UXGA 4H3VA 1XKQA 5COBA 2ZYDA 3JQ7B 4NBUA 3D7LA 3E48A 4E30A 3RJ9A 1PSDA 1ISHA 1O94A 1JWBB 1OAAA 1X13A 3I9NA 2DFDA 3GUCA 2J6IA 1Y8QA 4ZQFA 3GPIA 3SC4A 1DLIA 1XCBA 1QMGA 3FPCA 5AXCA 3BAZA 1CRWG 5K9ZA 1F8FA 4AJJA 4YAEA 1I2BA 1YONA 4UEKA 4J7CA 4KUEA 4U6SA 3K30A 4BOYA 3DHEA 3EY4A 2PZMA 2ZQZA 3QIVA 3ZWVA 2JFHA 5A5FA 1VE9A 4ALJA 3G1TA 5KJCA 4UVIA 4XQCA 3D4OA 4PLVA 3KLMX 1HLPA 4EBFA 1S6YA 5CDGA 4BNLA 1P74A 4KQXA 3IJPA 3GN1A 1E3WB 1R4NA 8LDHA 4BNZA 1W8DA 1BWSA 3AI2A 1ENPA 3GA0A 3AM5A 5FI5A 2CVZA 5U9CA 1YWGO 1A72A 2ET6A 1PQPA 1TEHA 2RHRA 3AU9A 4I5EA 4XGIA 5COAA 2QRJA 3L07A 4J4BA 4E31A 8ADHA 1QV7A 2C2YA 3H6KA 4R5HA 2GNAA 4R01A 4B8ZA 1WDLA 4NG5A 1HDGO 1C1XB 3BMQB 3ZH2A 2DFVA 3WTCA 2AQHA 4XIYA 1NWCA 3CH6A 3K92A 4NU5A 5TNXA 1YL7A 2ZYAA 5CEEA 2FZWA 1QYWA 3K6JA 4OQYA 2D2IA 4A0SA 5BSGA 2OP0A 2Q2WA 3O4RA 1DHRA 4HNHA 1W6UA 3DHYA 4JP2A 2EKPA 2EW8A 4RLHA 3ZWBA 1LDNA 4M1QA 4M8SA 2O3RA 3PZBA 1HSZA 3RUIA 3H3JA 1ARZA 1H9AA 2ZK7A 4CM4A 4Y8VA 5K0ZA 1CETA 1NWHA 3BTUA 4JLWA 4WUVA 3ST7A 3VH4A 3DBVO 5ILOA 1XLTA 3H5NA 4DVJA 5IXYA 5JAQA 1FMCA 4W9NC 3DQPA 4BQPA 3ROMA 3TNLA 4AJHA 3RC9A 5DZSA 4GMGA 1XHLA 1OC4A 4W6ZA 2Q22A 4DYVA 3JV7A 3IP3A 1T26A 2NQTA 1EK5A 4NFSA 3VH2A 4BQRA 5CAEA 1EMDA 4LN1A 4II2A 4BUCA 1PJBA 3ETGA 4CLOA 2Y99A 4K9DA 1B16A 3ANNA 3P7MA 4BNXA 5ENVA 4HFRA 2ZTLA 3DZJA 5CHEA 5IFLA 1UR5A 3ETDA 3QW2A 3FPLA 4HFJA 4D41A 5DNAA 3HWRA 4DQXA 4DMMA 1AN9A 2Q4BA 1QLHA 1M67A 3NTOA 1P9LA 1JU9A 1MUUA 3K8ZA 2GASA 5B4VA 1O9BA 3N7UA 3B1JA 1PQUA 2BMAA 1PS8A 4L9RA 3PGXA 4RL6A 1ISIA 5IF3A 3LT1A 4RZIA 1NAHA 1V3VA 4CQMD 3RUAA 1GYRA 2JFFA 5HBRA 3C8MA 1E3JA 3UHAA 3IP1A 5CPFA 7ADHA 2E48A 3C7DB 5C3MA 1P1KA 1M76A 3WG9A 4MJLA 3PXXA 4U5QA 3GLQA 5C7IO 1ZVMA 1DAPA 3JQ7A 4FFOA 4YJDA 3F1KA 4TRMA 3UCXA 1YVEI 3FD8A 1QR6A 1TA4A 5F1KA 2ZTMA 5THQA 3E03A 4JBIA 3OA2A 4GWKA 3RBXA 4P8RA 4E21A 3KOUA 2AHRA 4P4NA 4WASA 2C29D 1B15A 4BV9A 4NR0A 3I6IA 5C5IA 1KIFA 4B3HA 1QORA 4LVUA 3ZN2A 4BNYA 3V5NA 2PLAA 1SB9A 1B0AA 1OI7A 1LQTA 1CQIA 3RUHA 5HWSA 3H9UA 4WEQA 3U3XA 4BNTA 1A7KA 3H4VA 4Z9FA 4Q39A 3G0OA 5A03A 5LCXA 4ZRMA 1LEHA 1I24A 1X1TA 3E5MA 2X1HA 1E7QA 2BRUA 1ISMA 2A94A 2RCYA 4GX0A 3AOEA 1C3VA 4R41A 3DAGA 5DOVA 3F46A 4XRGA 2EGHA 1ORRA 4PIVA 1Z45A 4IJWA 4D79A 4KQWA 1SOWA 5KJEA 4IY1A 1E3WA 2VUSA 3HDJA 1Z75A 3JD1A 5G0TA 1HDRA 3PHJA 2NTJA 4EUHA 4DPMA 1QKIA 5IN5A 3MTGA 3I23A 2D1YA 2VYNA 4RDHA 2DTEA 3DFUA 3GDFA 1DHTA 1XDWA 4N54A 2B83A 3WQSB 4ZQBA 1YE3A 3UF0A 3I3OA 3GVCA 4I5DA 1EBFA 2FHSA 1C1XA 4IDCA 3BMQA 1GPDG 1PZGA 4MKXA 1V3TA 3GVXA 3DFZA 2JKVA 1C14A 2FP4A 2J5RA 1O95A 1E7MA 4ALNA 5JAMA 2GZ1A 4DIOA 4OSPA 4FB5A 2OOSA 2HUNA 3H9JA 4RF5A 1G0OA 4FJ2A 2W98A 3ORFA 2XXBA 4OYRA 3PDJA 3A9WA 3ZDFA 1T25A 4WKGA 3WICA 3PYLA 4BO6A 3AU8A 1NXQA 2BGKA 4EJMA 2ZTUA 1E6WA 9LDBA 1WP4A 3PDUA 2EV9A 2UUPA 3TZHA 3WB9A 3ANMA 3KM0A 4KTTE 5A5EA 5ICMA 1VI2A 3NX4A 4BO8A 3EVTA 3AFMA 3F4BA 4YT2A 3K5PA 3OICA 4A5OA 5THKA 1N7HA 1PGJA 5JDCA 2BF7A 3A06A 1B2LA 2W8ZA 1U3VA 1N7GA 2O2SA 3EZLA 4B4OA 1NR1A 3V1YA 4XB2A 5HM8A 3U4IA 3WFIA 1WZIA 1F8GA 4E5YA 2D0IA 2ZJ1A 3EHEA 1M6WA 4ND2A 4HV4A 1F0YA 1ZNQO 1YL6A 4KOAA 3UFXA 2ZTVA 1NAIA 4N5MA 3GFBA 1N8KA 1UDAA 1IYZA 5ITVA 1UP4A 1Q0QA 1GU7A 3FN4A 4QTZA 1P0CA 5BSFA 5L40A 4OKNA 2IYPA 2OHXA 2WD7B 5IXSA 3PHIA 4Z0HO 4N5LA 3VPGA 1GADO 3GHYA 1KYQA 4I9UA 1H2HA 4JJGA 3FWNA 4XKJA 4WLVA 3SJ7A 4K26A 4ND3A 1KY5A 3QHAA 5G0WA 1GPJA 2QYSA 2PZJA 4IDDA 3I4CA 4JBHA 1M75A 1UH5A 3WIDA 1WW8A 4LRSB 2FR0A 2OXIA 1JN0A 1FDTA 1U28A 4U7WA 3RU9A 4NBRA 2EKQA 4CM9D 3X2EA 3PK0A 4IJVA 2CFCA 2VT2A 3WLFA 4AJLA 2NUAA 3JTMA 3UH1A 1NTOA 3DWFA 3K2EA 4XD2A 3UN1A 3ICCA 3V1UA 1VJTA 2POQX 2FSVA 5BSEA 4F3YA 1B3RA 1V9LA 5DBFA 4RVDA 2QHXA 2O3UA 2B4TO 1YDEA 1YJ8A 4XCVA 3ZU4A 2B4RO 5J23A 1PX0A 4HX5A 5KWEA 3GEMA 4IQGA 5JLAA 4QECA 1SNYA 1DC4A 3PHLA 3BA1A 3JCZA 4OHUA 3ZV5A 2DVMA 4ITUA 2AE2A 1Z74A 3VDQA 5JFOA 1BHSA 3NEPX 4JK3A 4Y9DA 1R12A 5KKCA 3KYBA 5FF9A 2FPPA 4O0LA 3VPHA 3VZPA 4BGIA 2JD0A 4RORA 4PG8A 2IE0A 1NQ5A 4FJ1A 1U5AA 3PWKA 2X0RA 2NM0A 1GV1A 2CF6A 5HS6A 1KOLA 3SVTA 1TT7A 5U4QA 3NJ4A 3UAGA 3DMTA 1D7OA 5B4TA 4BGEA 5JE8A 3AK4A 4L76A 5ADHA 1KEWA 3HQ4O 3TZCA 1CQJA 4MP6A 4YDRA 1GCOA 2NVUB 4ZICA 6ADHA 4E2XA 3B1KA 1YH3A 4A26A 3LLVA 1LSJA 5DP1A 5AXDA 5L7WA 5LC1A 4PG7A 2AQ8A 1W4ZA 4IMPA 1MX3A 4DL9A 2X86A 4U0KA 1IZ9A 3GZNB 2ZB4A 3G49A 4CV1A 4QX6A 3SC6A 3Q6IA 3COSA 2AG8A 3RD5A 2GF2A 1HYEA 3W8DA 5IDXA 2IZ0A 3AOEC 1XEAA 3NTQA 2SCUA 2JHFA 1NBOA 2UAGA 4L4RA 3ROQA 4IZHA 2DKNA 3V2GA 5I8WA 3D0OA 4J16A 1HWYA 3U49A 4AJIA 1EFKA 1R0LA 3EMKA 4R1SA 1PQWA 3Q0EA 1M6HA 1Y6JA 4XYMA 4YB8A 3HB5X 3U4HA 2CVQA 2PD4A 3VVBA 1PJSA 2Y67A 4ONEA 2A92A 4XWYA 4J1TA 4EUEA 3JQDA 2CVOA 2WMDA 3C24A 2YW9A 5IG2A 2VYND 4UULA 5JCJA 4YAKA 4P38A 1RKXA 4TZTA 3WXBA 1LRJA 4FFNA 5CDUA 2HLPA 4RDIA 4WPGA 2ZIZA 5AXAA 1HTBA 2ZKLA 3W8EA 3GDOA 2FR1A 2PGLA 2YZ7A 1IB6A 3X2FA 2O4UX 3ZWWA 2R6JA 1C0PA 1GQ2A 1LLCA 2DTDA 2X9GA 3NYWA 1LA2A 2Q2QA 3GZ4A 5ES3A 1HE2A 2I65A 2RIRA 2I66A 2HRZA 1NHWA 2NTVA 4KZPA 2EJVA 1ZMOA 3FNHA 4ND1A 3FBTA 2ILTA 4NU6A 2OZPA 5ENDA 1CF2O 3JQCA 4LCEA 2R00A 1B7GO 1KS9A 4R1NA 2DBVO 4IDAA 1ZIDA 1HDYA 3DR3A 1PL7A 3GGOA 4BO7A 1KEUA 3D5QA 5JXWA 1JLLA 3HN2A 1Y8RA 2HJRA 3M2PA 3S2EA 1XSEA 5JDCC 5TX7A 4NJOA 1B3BA 4F46A 4OIMA 1ZW1A 2AA3A 1DFHA 2V65A 4RGBA 1YQDA 5ER6A 3WGOA 2E6UX 1U9JA 3M6IA 4TROA 1YQGA 1ID1A 4JJFA 1GR0A 1KC3A 3PHHA 2VHZA 1YBMA 1HEUA 1MV8A 2Y68A 3P19A 2VWQA 2CDAA 2CDCA 3PYXA 1ZBQA 1ISFA 1HDOA 3FTNA 4YAJA 2VOEA 1ZH8A 4I8XA 4HADA 5EIOA 4NBVA 3WYCA 3IAHA 3K96A 5FFFA 3RAJA 3MJSA 4AJPA 4MVJA 3CUKA 1BVRA 5B37A 3DOOA 1PZFA 4XYEA 3WNVA 1YOVB 1XYGA 2EGGA 4BMVA 3A14A 2W2KB 2NLOA 4R4JA 4YAIA 5HRUA 3WIEA 1KVRA 3Q2KA 1XQ6A 5A02A 3OHSX 2Q45A 5DBGA 2VHVA 4C7JA 1JVSA 2IEBA 3C85A 1MXFA 3GHHA 3AW9A 3PHGA 1E6EA 3BXXA 4ROSA 3WJAA 4XGKA 3ZU2A 1ZSYA 2W4QA 4Q3BA 4HUJA 4EGFA 4YJHB 4P4LA 5EMHA 3IIEA 2Q1WA 3MEQA 3I6QA 1DAOA 1PJ4A 4JP3A 1ONPA 3GNTA 2NVUA 1GYQA 1NFRA 2NACA 3L77A 3WMWA 1G0NA 1V3UA 4HFMA 1JWAB 1HKUA 1WMBA 3VPSA 1BG6A 4CM3A 2QW8A 4G81A 4ZD6A 2PH3A 3LLSA 3U09A 1NPTO 3EC7A 3JD2A 3GZNA 3DZGA 3P2OA 4LMRA 4B7XA 3T7EA 2IXBA 1XG5A 3ZWPA 3E1KA 2C5EA 1R6DA 2HRBA 3RSHA 3LQFA 3OBBA 4DLAA 3ICPA 2ZB8A 5DT9A 3DDNA 3WTBA 4D43A 4NIMA 5A4DA 3KSZO 4WCDA 3JYPA 2O3QA 4Q3EA 2G17A 4E3ZA 1U3UA 4FQ8A 4E5KA 2OGUA 3QJ5A 3U62A 1P44A 3ETEA 1C0LA 3LYLA 3GG9A 2D8AA 3VPXA 5EL0A 1EUDA 3BZUA 3M1LA 1ZFNA 4Y67A 3KBOA 5A06A 2J3HA 3QRWA 4IDFA 4DUPA 5JC1A 2WYUA 1IY8A 5GY7A 3RBVA 3CSDA 3ZV6A 4J7XA 3QWFA 4HFNA 2JCVA 4R9SA 3O38A 1K6IA 3FI9A 3FTPA 1H6DA 4C4OA 4Q3NA 1E77A 4B7CA 1SEVA 3INTA 4J49A 3I9LA 4BNVA 2VQ3A 1MB4A 1LU9A 4PGFA 3S2IA 3O8QB 3UKOA 2Q4EA 4ZA2A 4MVJG 4EI2A 1IOLA 5TIIA 5CDYA 4CR7A 2VOJA 1E3SA 3NTRA 1DFIA 3F9IA 3SBOA 1YS4A 2QQ5A 4DC1A 4CR6A 3T7CA 4K1LA 4GKBA 3ZW9A 5JO0A 4UUMA 3TFQA 2PZLA 4R9RA 3RFTA 1ZXLA 1CEQA 1T2AA 5JCJD 1CIVA 2B0JA 1C0KA 4UUPA 3ZHZA 3OQ6A 3GVIA 4XR9A 5GMOA 4RPKA 1G1AA 3JYLA 2AEFA 1U2DA 3D4PA 4BL5A 3Q11A 1ZSNA 2C82A 1BVUA 4KDFA 2DAPA 3GT0A 3DOCA 1PJTA 4M55A 2IXAA 5JMPA 1BMDA 1P1HA 3H5RA 3VDRA 2JAPA 4YT8A 1GUZA 5JYDA 4NFHA 4GAEA 4QSMA 5DULA 3ZHXA 4W99A 1QRRA 4FGWA 3VZRA 3O03A 4WECA 3DB2A 2Q3EA 1HETA 5BR7A 5DOZA 2R00C 1HE3A 1YB5A 3E8XA 4U0JA 3S1LA 5KVQA 4B4VA 2X5KO 5KCZA 2CNBA 3G17A 3GY0A 4XQEA 1O8CA 3UOGA 3PIDA 3OQBA 1E1MA 4C7KA 5BSHA 1U7TA 3KXDA 3WDSA 5GZ3A 4RQTA 1YOVA 2X0JA 4J2OA 5EINA 2O48X 3C1AA 3L4SO 2W2KA 3DBLB 5I7EA 1LSOA 2HMTA 2HMUA 2BD0A 5L95A 4NHEA 1H6AA 3WBFA 1GEGA 2DBRA 3R6DA 4RV9A 3W6UA 3S55A 4XA8A 3I1JA 1Y9AA 4WCFC 5TC4A 2P9GA 3PJFA 3E18A 4KUGA 1I3MA 2DLDA 3MZ0A 5DCYA 1TT5B 4ESOA 1LDGA 3RI3A 4UVDA 1K5HA 4YJHA 4A7PA 1Y1PA 4DPKA 3LC2O 4ID9A 2E82A 2NSDA 1Q0LA 2QYTA 1PWXA 3CZMA 3IUPA 5FYDA 3GNQA 4B3JA 2HMWA 4Z9XA 1DIAA 4MVJD 1C1DB 2YQ5A 3H9QA 4GKVA 1EVZA 1PJ2A 3VTZA 4YJGB 1ZSVA 4BNIA 1R0SA 1BSVA 3Q9UA 3K9QO 3SEFA 1ISGA 1MG5A 1U7HA 5C7OO 3RU7A 1EE2A 2IZZA 4J9UE 5KJ6A 4IIVA 2VUTA 3JD4A 4FFMA 1A71A 5T64A 3WGTA 2P9CA 3QLJA 3JYOA 1FK8A 1T2EA 1JVBA 1Z7BA 2VN8A 9LDTA 1MA0A 4MVJE 2H6EA 4GGPA 1SZJG 1UJMA 4BGUA 1PTJA 4DIBA 4II3A 3GPDG 2P91A 4UVGA 1PU2A 4D3DA 4TRRA 1Q7CA 5G0SA 5TRTA 2DPGA 4I9NA 1RM4A 4UEOA 3RASA 1E7SA 3Q2IA 2XPCA 3CKYA 4ND5A 3RWBA 5AOVA 3L6DA 3TQHA 3OJFA 2OO5A 2IODA 1I3NA 3LVFO 5BNIA 1DEHA 3IL2A 3CMCO 1BGVA 2O2YA 1A5ZA 4GWGA 5T5QA 3EUWA 4PLFA 3JQFA 2G76A 3ULKA 1HRDA 4YTEA 1X14A 3W6ZA 4KMSA 4PZDA 3BHMA 1ZK1A 4I5GA 4CLXA 3ZWCA 3WBBA 3A28A 1CJCA 3O8QA 3DHNA 3NAQA 2Y1EA 1FDVA 4K6FA 4WE3A 1M2WA 5KVSA 3GFGA 4ILKA 5EN4A 5TT1A 3NV9A 5L9AA 1MFPA 1JTVA 3FNGA 5TJHA 3DAPA 4BKRA 4YRDA 1P3DA 1VJ0A 4WLFA 2WJPA 1J4AA 1I8TA 2HK9A 4OJNA 1NPDA 4EDFA 2QZ9A 1VL8A 3AUAA 2HSDA 1SAYA 2VZ9A 2A9FA 1UP6A 2D4AA 3STHA 2FMUA 4E2ZA 2YJZA 2J3KA 2PV7A 1CWUA 2OBYA 1P45A 3OM9A 4CLRB 1DRUA 1GYPA 4YT5A 1BDBA 4J9VA 3PZRA 3JQGB 3PTZA 4OH1A 5JDIA 4J43A 4ZQHA 1ZUD1 5IDQA 3DEYX 5DP2A 4FFRA 4UEJA 1KVUA 1LDBA 1PZEA 1YL5A 3OSUA 4BGVA 5IZ4A 1K6JA 1GQQA 3WGYA 1NVGA 3VPFA 1OZAA 3PWSA 1H94A 3QVXA 3ZI0A 3LC1O 4ZVVA 1NNUA 3D3WB 5JNLA 1DLJA 3VOSA 1UXHA 2GCGA 1DJNA 3LSYA 4G2NA 4MP3A 3WQRA 5A9TA 3PJDA 4RVFA 4F45A 1L7DA 5IZCA 1GV0A 3A1NA 3LZ6A 1FXSA 3TFOA 2GYYA 2OBNA 3WJ7A 1BRMA 4U8GA 5A1TA 2C2XA 4R5MA 3FRJA 1WZEA 4IS2A 3ZV3A 4OAQA 4AJ4A 1DB3A 3MOGA 5U1PA 1PJ3A 3DBLA 1SB8A 2E49A 5TJ9A 3OIGA 5F5NA 3GAZA 1Q1NA 4BO5A 2HJSA 3HB4X 4ZGWA 2Q1UA 4IQ8A 1HDCA 4JNKA 4P4GA 1BXGB 3QWBA 1TT5A 1H5QA 3MOIA 1I2ZA 1PGNA 1ADCA 2I76A 3ADPA 4PLHA 1U3WA 3PQFA 5IDYA 2AMFA 1R4MB
chains in the Genus database with same CATH superfamily
1CDOA 1P31A 3KG2A 3U9SA 3MCUA 4JJZA 4DM7A 1MO6A 1QZUA 2Q3JA 3BORA 3MJTA 2OKCA 1WJGA 4BZQA 1R8SA 2QUIA 4YJGA 1NURA 2XBMA 2Y0CA 4B31A 2OV4A 2VTVA 5H3HA 1JFSA 1SPBS 1GNPA 1SUIA 2QVGA 4Z1MA 2UZ0A 3LMKA 3VZQA 1JDBC 1GQRA 2CVPA 1QH0A 4B09A 5JS7A 5FTNA 3RS3A 3IQDB 5FBQB 4OGLA 1ZH6A 2VJYA 1RS0A 4YCAA 5DI9A 5C34B 5GP1A 1BN6A 5HTKA 3A9TA 2QUAA 1AQNA 1DCFA 3VC3A 1UANA 4BC1A 5GONB 4Y6LA 2BEUB 4BBAA 5JLJA 2AOWA 5LDGA 2VUUA 1SXIA 1G2PA 3T5GA 1FY2A 3EVNA 3H5VA 3UUGA 1CY1A 2DQSA 2YV1A 2EP5A 4FGUA 1KO1A 2D1FA 1MP0A 3B20A 1K1EA 1V47A 3K9CA 3KKLA 1FSSA 3QUBA 4J1SA 4PBSA 2ORED 3CT4A 5ERXA 1RAGA 5IDWA 5H4GA 2A30A 4PFJA 3NPMA 1OQAA 3IRVA 1YB1A 1SC6A 4ZHQB 3DLBA 4OXYA 4TZ6A 1UZAA 2Z3ZA 2VDNB 2IZ1A 5E6UB 2QG6A 5JIBA 2VZ0A 2OL4A 1QIHA 4C2UA 1QP0A 1GNRA 4N3BA 5AW7A 4I46A 3AZQA 2P1DA 3PNQA 3F71A 4K9OA 3S1AB 1EP2B 3OQ1A 4O4LB 4WWHA 2VAWA 4DLRA 1S96A 1XDDA 4FPXA 5F7XA 3I61A 4FHGA 4PQEA 3DKIA 4PAMA 3HWX1 4NCHA 4B44A 2I6SA 3CTMA 1M10A 3HKDA 5T73A 3MCZA 2FQ1A 4MIEA 2NTNA 4G8JA 2FEPA 3BXHA 3BKWA 1CYDA 4ZI5A 4BQOA 1LLDA 1Y9JA 1T8TA 3BL8A 3FDXA 5T41A 1KFBB 3BFVA 1N2SA 3KVNA 4MYSA 3SXPA 3WV5A 1E1LA 4UHBA 2BM0A 1C4WA 4BB6A 2YUIA 4BFLA 3GAFA 1T2FA 3M6UA 5H82A 1SULA 2MJLA 1E9EA 2P5YA 3F5QA 4KDEA 5AKHA 3X1DA 3CIFA 1FX0A 2P9BA 1OH7A 2J6BA 1W9HA 1R8YA 1R8JA 1TM1E 4M8IA 3L02A 2XOXA 4CIWA 2LIVA 1KETA 4E0BA 2I3AA 3AETA 3AEYA 4K9NA 3U81A 1OGYA 4BMNA 4MITA 1EZ4A 5HK8A 4D8TA 1O9GA 2Q0XA 3B5IA 3IMFA 3K0HA 4YAUA 1N34B 1CEYA 3U31A 3DTNA 4ARZB 1QGOA 1U3TA 3WGHA 2WK1A 3M6AA 4OMUA 4RZUA 2XOEA 4O2AF 3AP3A 2PQMA 3B3FA 1V8FA 5H3CA 4Z4CA 3URMA 3PUHA 1H0HA 3T7SA 4ZYXA 2W6QA 2JB9A 4KR2A 3A4VA 3BHIA 3C6QA 3SR3A 3V42A 1JHYA 1XF9A 3WRYC 2FPLA 1OCEA 4NV3A 1REQB 1EIZA 5K0FA 4PNPA 5FA6A 5H5JA 5SY9A 4ZZ3A 3RWOA 5DI3B 1NM5A 5KHAA 5LP6B 1O6FA 3RVQA 3I4FA 4DQVA 2NGRA 4F3CA 4GL2A 3WRXA 4F06A 3BE5A 2H1SA 3TD9A 3A6DA 2CXNA 2EF0A 1XL1A 3IT0A 1NKTA 2PT7A 2C99A 2FN9A 2J3LA 3F7NA 1JIKA 3JQ8B 4L72A 3WNQA 4C0AC 4P0TA 5IJ9B 1RKUA 2FW8A 2Q3FA 5F2EA 5HCIA 4AVYA 4AYWA 2C7RA 1Y63A 2DR2A 4FZ3A 3USCS 5K8LA 1QUEA 1T5SA 4I3GA 1EFCA 1BWPA 1T4CB 5AM0A 3R41A 1P4SA 2GJ8A 2ZROA 3JR7A 2GD6A 3DVAB 3PE6A 5DN9A 3X43A 2HIHA 3D4BA 3CX7A 4H15A 4G5XA 5J9FA 2PUCA 4CM7A 1RHKA 4GL4A 4RY2A 5LQRA 4QJIA 4WDRA 1HNZB 3ESQA 3C3AA 1LNQA 2HHAA 2OCPA 5LLSA 4CKCA 2VRBA 1EXDA 2HT6A 1G7RA 1H8EA 4N6OA 3MWYW 3IQEA 3DFIA 3DV9A 3HEBA 5BSVA 5FBLB 2Q5EA 4UTVA 3CNNA 1I7SB 1AS3A 2B4AA 4N8SA 4OL0A 5D5PA 3FHJA 1L5GB 2IOFK 3DO5A 2FLKA 1IN6A 5JH7F 2WM2A 3MMPA 4X45A 3G0IA 4HVAA 3VH3A 4V39A 3DBOB 3LCJA 2DSNA 3C8UA 5AT1A 4EYEA 1J8DA 4B0PA 3N9IA 3X1JA 1T6ZA 2H08A 2X5OA 4G37A 3MM4A 3G2JA 1XJWA 2BRUC 3KHTA 4R2XA 2BM9A 3T1QA 1TNDA 2LGJA 4BFUA 3PL1A 2C5SA 5AVTA 3D3EA 2YJ6A 3OFVA 5M6DA 1DL5A 2XITA 3G7NA 2XKAA 1KYWA 4MQ5A 1KSGA 1DX9A 1UJ4A 2GPYA 2HW8A 1OWPA 1C0EA 5EKDA 5GONA 2BEUA 3PLAE 5AHOA 2QRKA 7ABPA 3ASUA 4G8CA 4MWBA 1Q7GA 2ATEA 3C3YA 3TQIA 4D0RA 1T34A 2F8MA 1ZK2A 3I6BA 4WN3A 4ZWNA 3SQOA 3UVEA 1AGYA 3UJPA 5KDDA 1YRLA 2B69A 2JW5A 4R8MA 2J9YB 3E9ZA 1O7JA 2GM9A 1DAFA 4H6PA 1LPNA 2H57A 2XE6A 4ZHQA 4KKVA 2F55A 3TM5A 1C9KA 5E6UA 1PR3A 3ZDDA 2R5FA 4I1RA 1YF3A 2C7VA 1KPGA 3JQQA 4YRCA 4ZOBA 4LX0A 3G8AA 1DX6A 5K09A 4YREA 4D0LB 5C80A 4Y2SA 3S1AA 4MDEA 1CDZA 4O4LA 4YN3A 4MA5A 1MKYA 2GPTA 2QUKA 5A04A 3CQ9A 3RSLA 2AKYA 1GT91 1AQJA 3V48A 3UATA 4RD1A 4X65B 1W36B 3ENZA 1H2ZA 5AVOA 1J22A 2R6CA 3VR2D 5IMSA 4HB4A 3ZVRA 2EIHA 4RJTA 2W4IA 3IUJA 1G17A 4NAUA 3ETJA 3P2YA 5GJBA 5E38A 2XDWA 2C5AA 4PYLA 1J0XO 4ZDIA 3D6AA 2FMKA 5J59A 4D46A 2ZI6A 4RPIA 1E1NA 2B37A 5MDHA 2AG1A 4JLUA 2EJBA 2NXNA 4RMIA 3HSSA 2RC5A 5JAPA 2VHEA 3EZYA 1IBCA 1RD4A 4MDHA 5L7YA 2WD7A 3IODA 4LF8B 2B1IA 4KWCA 1X70A 3GCWA 2YOGA 2DLCX 4YUAA 1ZVVA 4Y98A 1B8PA 4BO0A 5BNZA 2F8SA 4A27A 1EVIA 4IIBA 1NFQA 3I9FA 5DTIA 1ZO8A 4PQFA 5GVSA 3RJZA 4ARZA 5F9HA 1Y33E 3RUDA 1DEAA 1EWRA 1VXOA 2JFWA 2FPIB 3TNFA 3VU3A 2P68A 2XTJA 2I1VB 1R0BA 2JHPA 2J31A 2QT0A 2ZDGA 3P4YA 4IIJF 4K9RA 3K70B 5EEGA 2ZS7A 3FGZA 3STTA 3VZSA 1REQA 5LXTF 2EBWA 8GPBA 4FE3A 5DI3A 2JASA 4TL8A 5LP6A 2GXAA 1VKHA 4QO7A 4NCAA 3HA7A 4OXRA 1OB5A 1CD5A 2HQ1A 2NU9B 1FFCA 3LC0A 1OVMA 2HQSA 4NDNE 3GX1A 3JQ8A 4N39A 1JQ5A 3PA6A 4NK4A 4YROA 2YRWA 4K87A 5DXFA 5HRAA 2WF7A 3C3KA 5IJ9A 4WLEA 3RHFA 3SEZA 4EB6B 5BN5B 4IMIB 1CZHA 2H7CA 4BC0A 1JQKA 4LW8A 5IYZA 2PWBA 4UHEA 3I0NA 5EGNA 1BVYF 4CUJA 1T4CA 4Q3DA 3KPWA 1JU4A 4YPOA 3P9ZA 3DVAA 4FLFA 1B1AA 4MB6A 3L0DA 2O2EA 3H1GA 4HAUA 2RBGA 1HZZC 5LQDA 7MDHA 1U28C 2WHEA 3N0XA 3WWEA 2HH9A 2VDJA 4BQNA 2RDMA 3UFBA 5BSRA 2BM8A 1WKCA 1LI4A 3HKCB 3SS8A 1TZJA 4WZAA 4RQUA 3ROTA 4K0KB 4F21A 2WINI 3HCWA 3LU1A 4I8DA 1YIOA 1I1NA 2QAGC 3I42A 1RRMA 4HHEA 4HZIA 4X8HA 1XFDA 3DW3X 3BMNB 2WHYA 4HUQB 3TDKA 3WK4A 1W29A 2QN2A 3I4LA 1USKA 1LUAA 4JLBA 3UV3A 2DUMA 4JR1A 3LYUA 2QM3A 4HDMB 4R7GA 4FWTA 1ZXBA 5I51A 1BQ4A 2H1CA 3GLIA 1RWKA 4L8WB 5B12A 4DW8A 5JNRA 4O3MA 4QXQA 3L79A 1XKLA 3QM1A 2K2QB 1JR4A 1D09A 1B14A 4BLVA 1LY1A 1QIJA 2E9SA 2J5KA 3KKPA 3TM4A 1BAPA 3NMUF 2X8AA 3C3XA 1NSTA 2QPAA 2X6TA 3DQZA 4P9NA 2O0LA 4QGSA 1GDHA 1YKFA 1OAOC 2B92A 1W49A 2R48A 4K86A 1AHIA 1KEPA 4XSVA 4AJNA 4DABA 2O8FB 1AGXA 2VUHB 2DBQA 3BZWA 2XYGA 1UBCA 3CZCA 3DH0A 1DMSA 3QV1A 1A8HA 5LU8A 4CG2A 4Y9RA 3MWEB 2RHGB 2XWSA 2Y0EA 1H66A 1F9AA 1QAOA 1VDZA 4ERXA 1XZPA 1JZQA 3TBFA 4Y2YA 3L1HA 1FRFS 1TMGE 3GJQA 3HPRA 1WVIA 2FW0A 4W9NA 5IFKA 3G85A 1OT3A 3AFGA 5EIWA 3ZV4A 3DUFB 1KFKB 1O0SA 1HURA 4F93B 3T1YB 4FYXA 2O4CA 1ECBA 2C88A 4NQRA 1P5JA 3WFJA 5H7XA 4F9FA 4YMVA 3DS8A 5C1DA 1P0QA 4RYDA 1DKPA 3UXYA 5FOVA 1KR5A 3AEXA 1R37A 1EDBA 3DXFA 3FMVA 1E9SA 4MWSA 4Q4JB 5EY5B 5JCPA 3OQNA 4E33A 4FILA 2OCXA 2V55B 4EL0A 1NGSA 1WL8A 2BGUA 4GE3A 1SXPA 2V3CC 3QSGA 4JODA 5K0TA 1A5BB 3HZOA 5COQA 1JFRA 2Y05A 4BCDA 3AWDA 3IQWA 4KREA 4QG7A 4QDXA 2BBOA 3T4UA 3LXRA 1OWNA 1N2JA 3WLIA 1UADA 5E1BA 3WMFA 3R0XA 3L0OA 2GSDA 1XQWA 5CLGA 1NN3A 1X7GA 1KXZA 1ZK0A 2JIOA 1G3UA 3DV2A 4WY8A 4ARCA 1SZPA 4NJMB 3OA0A 3D3KA 1EDOA 3HJRA 3DBRB 3SC3A 4IGKA 2O20A 2EEZA 5JO9A 2IYWA 4BLRA 1EG7A 2LIPA 4J1TC 4W63A 3KGDA 3CONA 1HT0A 1UBSB 2MSNA 3UNXA 3EPJA 3TN7A 1FYWA 4KRFA 3Q3CA 5DB4A 2QX4A 5EP4A 2FF7A 3E5RA 1DQYA 1TCBA 1GU0A 3DYVA 2XWPA 4X0EA 1T3GA 1ESCA 4UBOA 3Q3VA 4OFWA 1DC6A 1A7UA 4HZUB 2J08A 2Y76A 3C8HA 3NIWA 4Q02A 4C9BA 1YJQA 4R3WA 4LXUA 3GROA 2NP7A 4UUAA 1FDUA 1A1SA 1Q0SA 1E92A 1T1GA 2B36A 3FB4A 5CDTA 4A10A 5I5EA 4LF9B 2C7PA 5KJ1A 5KPDA 3AG5A 5GJVC 1ZZEA 2JLCA 5T8KA 1HBJA 4M1YA 4YNBA 1HR0B 2EFJA 3DC2A 4W7IA 1WQ1R 5FOXA 3RRFA 1F0PA 1ZCZA 2LVBA 4F9TA 4W5JA 3SS7X 2RGUA 5BPFA 1UWLA 3VISA 5KX5A 3A6PC 4PCVA 1LX7A 5FV4A 4EB3A 2O5CA 4CJXA 9MHTA 2RGGA 2PGJA 5BWLA 4NE9A 4BNFA 1E4YA 2XNJA 3K0EA 1N5KA 2Q5CA 4E2YA 1P5HA 2GBLC 3NKFA 3KJNA 4V0MA 1QHYA 3VR6D 3MJ4A 3TB6A 4RBNA 4ND4A 4Z9BA 4D4JA 3N74A 3RFUA 3WIBA 2V9CA 1ZDMA 3JX9A 2D06A 4TTSA 5ALOA 1YQTA 2XTNA 4XPIB 2O2XA 3QTTA 1UDCA 3E8SA 2NU9A 3QKWA 3ISVA 3EEFA 3FPEA 4LJSA 2XLCA 2O3SA 4GE0A 3AB3A 3D8RA 3V8PA 5L3SB 1RPNA 3DFMA 2VUIB 1OW3B 4EGAA 1G16A 1EM6A 2ZJ3A 2X8WA 2ZU0C 1BD4A 4EB6A 5BN5A 4TTTS 4Y0AA 2VL7A 1KQ3A 2V5VA 1N7JA 2YN2A 1C4KA 5TGTA 4LJ6A 1EPUA 2FZ5A 2ATVA 2HLDA 1B8UA 2AMVA 1M2OB 1F06A 2ONZA 3RSQA 3C87A 3S5JA 3VSBA 4OLAA 4UM9B 5K3CA 1AF7A 1P6QA 2OQ2A 3R3XA 4NE7A 1QE0A 1STOA 3ASZA 1TA9A 3HKCA 1Z5NA 3P5SA 1GG2A 4G5OA 2GOYA 5KSYA 2WNIA 1FW8A 5DHSA 4LRYA 1PZHA 4BVHA 3JQRA 4C07A 4D6XA 1E60A 3T41A 2ZI4A 1JDSA 3QY9A 1GZUA 4YASA 2G5CA 2PD3A 3BMNA 1RM3A 4HUQA 1PJZA 2Z4RA 1ZD4A 4E5NA 2FSPA 4RQAA 4PLGA 2M6LA 4WBXC 4CV2A 4HDMA 4KXMA 3DULA 3ROZA 3EVBA 3UAZA 3H84A 1UBNA 4HXYA 4LVCA 3BBLA 3LVBA 3WHIA 1TUBB 2X2OA 1U8EA 3C43A 5DJ5A 4RFVA 4CPDA 1R6VA 1XEWY 1JXAA 2HRCA 1VLZA 3EUFA 5CIWA 3DYBA 4MYTA 4YDSA 3KSBC 1OH8A 1YVPA 3LL7A 1KJQA 3QE9Y 1DKUA 2ZI7A 3DE0X 3P9IA 3K73O 1PD1A 2KE5A 3CPEA 1Q74A 3KPUA 4TMFA 1IQRA 4LJAA 4IX9A 4N5NA 5AI0A 3T5TA 5CLJA 3FHTA 2E4XA 5FNVB 3D6VA 3QLUC 3OJOA 4JBWA 5EESA 2Q1YA 4PTYA 1JZTA 3RSOA 4DEVA 1W94A 3MWEA 2O2JA 1EVJA 3FDZB 3TWOA 2UYOA 5FBVB 1XA3A 3AHCA 1JEAA 1JQBA 3QITA 4J3FA 1JBKA 2RGNA 4OI1A 5BQFA 1J39A 1O87A 3U60B 5FLKA 3RKUA 5EHXA 3ITNA 1TJ4A 1PJCA 2DPHA 3P27A 1Z0AA 1I1QB 1VL1A 2Q0QA 2Z95A 3DUFA 5HX7A 3C1OA 4KIFA 1RPZA 3C1TA 4Z4IA 2PO5A 3DTVD 5JRJA 4X7PA 3ZJ5A 2OVFA 2ZBVA 5C46F 3R1IA 3MWJA 3MSXA 1CUZA 2I0FA 3V8BA 1JMYA 1DG9A 2Z1MA 3Q5DA 1N3LA 1U2PA 1QC5B 3AF1A 3H9GA 3FOCA 1NVKA 3BHNA 1L4GA 2O7NA 4Q4JA 4QTXA 1SPXA 3SHOA 1Q12A 3SZGA 3WMGA 4EK9A 4LJ7A 1Z2DA 2XZTA 3EQZA 5EJ6A 1UPTA 2W9XA 5BW6B 4YEDA 1P5ZB 4BX2A 3KETA 2DBYA 2OFWA 1PNVA 2A5DA 2O1XA 2HB6A 1OWLA 1L4YA 2RARA 4QXAA 3SJUA 3D3JA 4TVKA 1T0UA 2QL7A 2AN9A 2VH5R 1GARA 2P9FA 4ZCSA 4NJMA 3DBRA 1A4UA 1XIVA 5LQKA 4BZZA 4Q1AA 4E5VA 3IC5A 4ETWA 2V97A 4EA8A 4PYRA 2G71A 3CHYA 3GRPA 4MMYB 5AMXA 4Q7KA 5EE3A 3R4VA 4U6QA 5I7AA 5ALJA 5IJ0A 3IBTA 1J8QA 3M33A 3PXUA 4QLOA 3WIVA 2IYSA 1ULAA 2PIAA 4HZUA 4F96A 2R1ZA 2VYFA 2WE7A 5FTLA 5I48A 3KQKA 1RQXA 3CRRA 3UAOA 4ETMA 3GJ3A 5BW5A 1MR3F 5LDHA 1AKYA 4Q93A 1S4MA 2JHGA 1U1IA 2D5AA 1YJAA 1J8MF 1QJCA 2FR8A 3GLHE 3PDWA 2HDNB 3RLFA 4ENVA 4HGYA 2XB2A 1G4UR 1RLMA 3NB0A 3NO4A 4V0SA 2VDQB 2R85A 3VX4A 1GL3A 3X1YA 1FP2A 2GERA 1I3OA 1WVMA 3KYCB 3LW7A 3BDIA 4HG2A 1L0BA 1FP7A 4NK5A 5G3ZA 3TW4A 1OI2A 3H19A 4GZ3A 1MTZA 1KP9A 1R3DA 3QA9A 4AY3A 5ARBA 1GQYA 4D0NA 1HEIA 2EKDA 3II6X 1LBTA 1ZWKA 2CF5A 1RABA 2Z5FA 2Q46A 3OQJA 4HLNA 4DA6A 2VSYA 3HJFA 2C07A 2NADA 4JLOA 3O4VA 4BQFA 3GQBB 1UK9A 2BMEA 2G0AA 4I6JA 1JAYA 4MYDA 3NALA 3V34A 5CFZA 1CUWA 1QWSA 3JZDA 2CFIA 4WZBE 4XPIA 5DN6A 1JIJA 3N6XA 4DLPA 3GUYA 4CMAA 5HRCA 2IYTA 4BIIA 1JKXA 2REBA 2R8BA 2WSBA 5L3SA 1QHNA 4JB2A 3BRSA 3TIGA 2AG5A 3ZD6A 2VT6A 5IM4A 1UBRS 3A32A 1UKVY 4CL8A 3LI2A 3AR9A 2CMHA 4K9QA 5L51A 4TSFA 1SEPA 3A1TA 3G6KA 4DUGD 2VTEA 3N8GA 4KN8A 1UFVA 4CKYA 5JQGB 3CLSC 2X19A 1ZEJA 4RF3A 4ZEMA 4RY8A 3FFWA 1QTRA 1LDYA 3BIOA 1NRJB 4NKRA 4ILEA 3ZGNA 4A92A 4DIUA 5JMTA 1T3LA 3DLCA 5JY1A 2EC5A 2ZS8A 2AGVA 2P9TA 2QLMA 3PQDA 4LY9A 1D9ZA 2F48A 4O2BF 1DQRA 2WSSD 1ZGGA 4IJKA 2WOOA 3QVWA 5B2EA 3H0VB 1P6UA 2IRWA 5IX8A 5SV2A 1Z4NA 1C9YA 2EFYA 1YQ9A 3L5KA 4HOYA 1TCCA 3OP4A 4XFKA 2WSLA 2I62A 3TQRA 2DBZA 1W52X 5B1YA 1AHHA 1N6HA 2OUKA 2R25B 3QYJA 1ZL0A 1C1DA 5B4UA 1LVUA 1V1RB 1L7EA 2AR7A 4RXUA 4REMA 3WYDA 1TUBA 5JNVA 2XUJA 1NLFA 1RR6A 2HA2A 2VDPB 4JQCA 1O1YA 1UC8A 2E4YA 1VL0A 2JL1A 3H99A 3LDHA 3ZNQA 1ZQ9A 1Z4MA 3SKXA 1L1RA 3BH6A 3DL4A 4ZT6A 5JJCA 3BYZA 2I6TA 3I6YA 1C30B 5M34A 3AKZA 1RAAA 2H07A 2ZUTA 5FUXA 1JLSA 5BT8A 1PO7A 1N32B 4Q3AA 3S2ZA 5KQMA 2JJ2D 4ZZ2A 4TS1A 5FNVA 3PQ4A 1EP3B 3EFBA 3RC3A 2XRMA 1DRVA 5KQSA 5DSXA 3Q7TA 3BKXA 4Z4GA 1NP3A 4BVAA 1CERA 3HM2A 1J8VA 4DLUA 3SU8A 3W06A 2C54A 4BJHB 4LIPD 4S2UA 1PBNA 3QIAA 2QA5A 3FSRA 2JAOA 3H13A 4PZEA 1RQPA 4YP0A 5IK2A 5CB4B 1SC3A 1WXHA 3QLEA 3DMNA 4R8SA 2PRYA 1GPAA 2YWDA 1U0FA 4BJ1A 2OGWA 4O8ZA 3QVSA 3ABIA 3GU3A 4A8PA 1U99A 1T9CA 5HE8A 4EECA 2IYAA 1F6WA 1WXDA 1SCIA 2F2TA 1A27A 2D54A 2QE7A 3H83A 4J7UA 4PLTA 4F72A 3GW8A 4YV7A 4ZJUA 5KVVA 4MPTA 1MVNA 1CUJA 1QC5A 1RRPA 2E4ZA 2NXJA 3H42B 2CBXA 1TFRA 2INGX 3B53X 3EWNA 3LGXA 4HGRA 4EA9A 1UYJA 2DHCA 5CH8A 4U5XA 1YR3A 1PI3A 2B0CA 2HCFA 3BICA 2J9RA 3HRIA 1D0IA 4QNMA 1AOXA 3PEVA 5JJIA 2YJ4A 5JI3E 2QVYX 2DU8A 3FHLA 3A4TA 3UJ6A 2X2FA 3I1YA 2AYZA 1G7TA 1Z6ZA 3I04A 5AI6A 1MOSA 1PVOA 4LK3A 4TKLA 4IS3A 5CFMA 3RC7A 1P0MA 3T1OA 3VYTB 4NH0A 1FVFA 2Q6LA 1NQOA 1V95A 1Y9EA 2FU5C 1KYXA 4HDSB 4PLCA 4MW6A 5FWYB 1XU4A 4AS3A 5IF9A 5L7TA 1OHHD 2H54A 4BTEA 1MHTA 2LPMA 5GTDA 4LE1A 1J8FA 2YDXA 3CZ4A 5D6NA 1E3IA 5BOVA 3IE1A 3D6FA 1RZRD 2OKGA 3CS3A 3L0CA 3DOUA 4OGGA 2R1TA 5B53A 4MINA 2DSTA 2G25A 3WAJA 3WOHA 3R3SA 1VOTA 3Q7PA 1C3JA 4L16A 4HBGA 1N0UA 1KERA 1SBNE 2I7TA 1L9XA 2Q50A 4LHWA 4PC2A 1Y8ZA 4JOSA 1U0TA 1N4AA 5CT4A 3GR6A 3KYCA 3DUWA 1J23A 1DT5A 4CN9A 4IL5A 1K3FA 3OZBA 4G9EA 3K0CA 1GN9A 4TYQA 4TYNA 3V2UA 2W83A 2DR3A 3NHFA 1BEEA 1H2EA 3AZPA 4RIIA 2EZUA 4RHEA 5ICSA 3QVTA 1Y8RB 2OCAA 4OJKA 4X3CA 2PM8A 1MPTA 3V6MA 5MFZA 4OXQA 3WYEA 4KWHA 1TKCA 3F96A 2DCMA 1CDEA 3GQBA 4EHAA 4RK4A 3A2KA 5A6VA 1YJXA 4RV4A 2EZ4A 4CM6A 1V4NA 3QEBZ 3M1IA 4AJKA 2B2XA 4PR0A 2N75A 4RVGA 1XRLA 2EATA 4Z0PA 4WXEA 1QCZA 3D81A 2FW1A 2BOVA 2PS3A 3JARB 5CT9A 1ZZGA 3N28A 4K9KA 1JFTA 3EODA 1OBOA 3SX4A 3PX7A 1VLVA 3CPSA 1ULSA 2XNHA 2A1TS 1RYBA 4DLXA 5A62A 5KYUB 3IIKA 5JQGA 3A9SA 3PRJA 1P1RA 1U2ZA 1UJ2A 3L6EA 4JT4A 3EEOA 3MXTA 3CF0A 3ZD7A 1ZMTA 1DJQA 3EP8B 1IXKA 1PT9A 1RYZA 1ZUIA 2OQRA 3AY6A 3GN2A 1XVLA 3QU2A 4UHKA 5E4JA 2JJYA 2C61A 2HPHA 2Q5QA 1ZK4A 4E6EA 3T7DA 4NH4A 1DIHA 2AZDA 1XQ1A 1D2EA 3KQSA 3MB5A 4GSLA 3RRBA 1PLKA 4X7RA 3SMQA 3TIFA 2CCKA 2HYDA 5C51B 1B8NA 3Q98A 1F60A 4KRYA 2CHGA 4JQYA 5KKAA 2NPFA 3WK8A 4Y2UA 4R1MA 1V96A 3VBEA 2Q49A 2DLNA 2QUJA 4DMLA 3A3PA 4X93A 4WTOA 1XE3A 3DDUA 1XTQA 3LD9A 4ZVNA 4TKVA 2GFIA 4H6VA 3T7AA 3RUFA 4ZZ1A 5F7OA 1V1RA 5MGBA 4BFXA 2VQFB 1ZC3A 4PN7A 2BEWB 2CMFA 4E6PA 3DONA 3U7HB 1KMMA 3MJFA 2ZRLA 1POWA 1EHIA 3IOEA 4UFOA 4AJ2A 1FDSA 3VNVA 1FP4B 1MC4A 2YXPX 4YQZA 4BLTA 1AK2A 1QLJA 4N18A 1D3AA 3V4RA 3GRVA 2NO9A 4CE6A 4H6XA 7GPBA 1C30A 1VI5A 3CRW1 3VDNB 4BKOA 4DMCA 5KKNB 1W4LA 1ZH2A 2ALJA 2NT4A 3HU5A 2QMUA 4TV8A 5IUJC 3D7RA 5EIHA 3K1JA 4XWWA 1LRLA 4QULA 1GKYA 4XI9A 1VJDA 3FPJA 2Q4OA 3PYMA 2O8NA 4KXNA 3LUDA 1Q14A 4ACAA 4LGMA 4N8EA 2PVPA 1E5LA 3EIOA 4B80A 4DR5B 2W7TA 3HCOA 5CB4A 1NXXA 3IQGX 1KJ9A 1UPCA 2JLVA 1TJ5A 1X1DA 4GX1A 4TM8A 3UM9A 1XXLA 3UC9A 4ISCA 1KSJA 5I9LA 4ME6A 4AS1A 4EM6A 4QQFA 4AZTA 3MINB 2HPVA 4ZVRA 1UT6A 1UIRA 3LRTA 2CSUA 3A1DA 4KMRA 5AHKA 4ZODA 2WZBA 1WQ3A 3AL2A 4UC0A 1K7FB 3OLXA 3PPIA 1ZLYA 1GSHA 1B4DA 2C42A 2HWYA 4Q4HB 2V8BA 3B1VA 1WO8A 1LVGA 2G8NA 2HEIA 2WRZA 2V6MA 2QNBA 3HGTA 4MO9A 4QFMA 3GEGA 1V4VA 4LZOA 5ELMA 4ZCLA 2HCTA 3SDSA 4FHEA 3GPBA 3HO8A 3PLRA 3WSWA 1E5QA 2QQ0A 1T2UA 3ZQJA 1VFNA 2FPGB 5JWOA 4NBWA 1TL7C 4HRXA 4KPYA 3EZ2A 4XASA 2GD0A 3PFHA 1KNQA 2F8LA 4KLRA 3PUXA 4Z9AA 3W5VA 1AMUA 4DMRA 1Y1QA 1LPBB 4DRZA 1FLNA 3ZTWA 1UZLA 1ZJJA 3O82A 1Z33A 4YUVA 4EW6A 2PX0A 4HPWA 4TXMA 2BZ1A 4L28A 3QE4A 2C5FA 1UUFA 1QGUA 4HDSA 3ZGXA 5FWYA 2A1IA 3KV1A 5ADWA 3VR4H 4KVGA 4G67A 1T8RA 3MC1A 3RSFA 2E0IA 3GFSA 2CD9A 4F8JA 5JMWA 4FE7A 3ZZUA 1GZ3A 4DKXA 3GC6A 1QTIA 4GI1A 4FDVA 5D00A 5KYKA 1G6OA 2AKAB 1G3QA 2WD9A 5KWIA 4CMIB 2ISCA 4JEUA 2ZM6B 5LQJA 3EVAA 4RPGA 3KKQA 1WDTA 2LCIA 4RVUA 3JQEA 4HNGA 3WLKX 3LHKA 3P4XA 1QG2A 1FDIA 2B4QA 4URUR 4X8OA 5A9RA 1VDMA 3V7FA 4IX1A 1CUYA 1ZVQA 2YIDA 4GM1A 1PT6A 2OG1A 2QI9C 3IP7A 2FPWA 4B17A 1VTKA 4HYQA 3RHSA 3HJGA 4CDGA 3PWZA 1E0DA 4UDXX 2C97A 3T15A 1WXFA 1YVRA 3EXEB 5LZ2A 10MHA 4NAHA 3TJZA 3RVJA 2XMQA 3UHPA 4I3HA 3WLMA 4AN4A 2YFQA 5ILOA 1P61B 2GR9A 3AKCA 1EFRA 4EEXA 1CFJA 1L4MA 4YJFB 4W8GA 4HKTA 3H17A 3TPZA 3OZFA 4RWZA 2WFMA 4RLSA 1A0OA 1KTVA 5EP1A 4FQ7A 4CTOA 1PW7A 4BFTA 3PRHA 2Q27A 4LHZA 4N0QA 3UUFA 4IDPA 1N2OA 3BAFA 1CUAA 4KCGA 4OXXA 3AEZA 4A0GA 5LIPA 3JARA 1Z2AA 3KXLA 4DR4B 3FG9A 4KO2S 3PNOA 4K6OA 2E21A 3NXKA 3F8SA 2WP8J 1QQTA 1CUDA 4R8VA 3BSWA 2CVFA 3CU5A 3R3YA 5I7FA 2JFBA 2QN1A 3FTQA 3V1KA 2IW3A 3N39C 3OZIA 4ZGBA 4KIGA 2GK6A 5BY2A 4MPPA 3UWKA 3L9XA 4JSRA 4XIJA 1S02A 2HCBA 5ULLA 4DSAA 4MGZR 4CMBA 4EGQA 5CB0A 4FYJA 4C0KA 1A9QA 3IS3A 5E4YA 4KR7A 3KXIA 5KJFA 4NZ9A 1D2CA 1YT5A 1PS9A 3WDLA 3WR5A 1N1EA 3MAJA 5BUQA 4BBZA 4U7HA 3RRNA 2X58A 4KQMA 3SVLA 2XAAA 3CISA 2MR5A 1J33A 1TXGA 1MHPA 2BTOA 2H06A 2BEWA 4GNKA 4HPXB 4MNTA 4ZQIA 2E37A 2O3JA 3SFTA 2OGTA 3GGJA 3TBKA 4HUTA 4U7DA 2XUDA 4EFKA 3B9BA 2XE7A 4W5QA 1R4NB 4DLTA 3WSTA 2EOAA 1FP4A 1H9BA 1C29B 1G1MA 4FJ0A 4YHHB 3K53A 5KNBA 1L5YA 4W1RA 1IVSA 2PUDA 3N0RA 3FROA 2W6NA 4V24A 4E70A 1GA6A 2BMJA 2HDHA 1E2BA 2HJWA 2RHCA 3HPQA 2O2ZA 5ALGA 1W4BA 4DA9A 1ZHFA 4UNIA 1AX9A 1QCDA 1SD5A 2Q21A 3QI2A 4CEIA 3BXZA 4ZJYA 2DC1A 2RGWA 3GL9A 4LJ9A 1YS1X 1KDYA 3RV3A 2ARKA 1RWPA 3KQPA 1LDEA 2PZ8A 3NH6A 1BE8A 2X7XA 5CPBA 4UXHA 5TF0A 2QMZA 2RH4A 3MINA 1NYLA 4UD2A 4W7SA 2KS6A 4DWVA 4FFLA 3IAM1 5EJ2A 5ER9A 5IAGA 4DLNA 1XZNA 1LBQA 3IQHX 4TMYA 1JHPA 1LI5A 1T5HX 4DLLA 4Q4HA 2NPOA 4RDXA 5LQUA 1DSSG 3RFCA 2PH7A 5AM4A 3DM5A 3SF8B 1TLTA 4YRIA 3QX3A 4G9GA 4UE2A 1ORHA 1GNQA 4JVOA 1XR3A 4MWCA 4LHYA 1FQOA 3IVXA 2W90A 2OAGA 4NMWA 5E1OA 4OA5A 4H77A 3EEBA 2AC7A 2FPGA 3ZWDA 4X62B 3VNAA 1RZVA 3MCWA 4LZPA 2B4KA 2GRAA 2ZT8A 1ZAKA 2R2AA 1RLTA 4TWRA 3AB7A 4MRVA 1OJLA 1QLWA 3ABQB 3V8VA 3R20A 4GOKA 4NC9A 4EAAA 3OEEA 3PPWA 4JA2A 3KAJA 4BUZA 3EZXA 3HJAA 1W73A 3E84A 3A1SA 5F2OA 4NNJA 4AUMA 3MS7A 3KJQA 3GFPA 3X1ZA 4EG4A 2I4RA 3OJLA 3QKRB 3SHFA 1VSBA 1YR2A 3W6NA 4D4IA 3B3QA 2CCGA 3BG5A 4RZXA 5DNEA 3WI7A 5F77A 1ZQ1A 3WFZA 3BBPA 2GCOB 3CXRA 4HMQA 4CMIA 3OT1B 2G88A 4KQEA 3GF4A 4G1MB 4Q1EA 3RAPR 2ZE8A 4DCPA 3WSVA 5C8YF 1G5RA 1P1CA 3TLAA 5FJJA 3UK2A 5CA1B 4WNIA 5JCZA 1NOJA 3KJEA 1ZRHA 3L1JA 421PA 1BX1A 3GDWA 4Y1GA 4G1FA 4ZO9A 1YTUA 4GX2A 5LWQA 3K0AB 3OFNA 1I2AA 3L7AA 1WXQA 2FN4A 5L8VA 1YD7A 4MKFA 3A3KA 3HTXA 4LXYA 2WU8A 1ZEMA 2MYUA 4HAYA 4MW4A 4QASA 4UHHA 1FYFA 5JY6A 2QGFA 3ENWA 3A58B 3EXEA 2Q5LA 1UEXC 4CHGA 4LWQA 5FKJA 3PHCA 3KWLA 1I30A 2VYVD 1E64A 2PWAA 4ZVOA 3ZZMA 1AV6A 5FDFA 4IDGA 3VR3D 2QM8A 2CFTA 4YJFA 1JVNA 1KQGA 2GN6A 3O47A 5E7IA 2YR0A 1XKQA 5COBA 4NBUA 1CNMA 3UHOA 2ADFA 1Y1SA 3VFDA 1F38A 1K4KA 1PSDA 3I09A 3URKA 1THMA 3CNLA 1YR9A 2O0MA 1EI9A 3IUMA 1FLVA 3OZ7A 2VATA 3EVFA 3MGAA 4GC5A 4GOOD 4GYJA 4WFIA 5BW4A 2Q07A 5IJAA 1XVUA 3HB1A 4X66B 4KU4A 1ZMRA 1ULBA 2RHJA 1TYDE 5LD2C 1RBQA 1OB2A 3IWBB 1XCBA 2D7JA 3DF9A 4ZT2A 1NULA 1YQUA 4PZLA 1AO0A 5AXCA 3KHKA 1CRWG 2BW0A 2IIQA 3ANYB 1FBTA 3P9CA 4XWTA 4YAEA 3RG8A 1I2BA 1GG9A 5IT9A 4LXXA 3MTAA 4KK3A 4B3SB 3CLTD 2YOFA 2O2GA 3K1AB 4ND7A 2QYOA 3GJ0A 2BP7A 4HEA1 4PX9A 4URYR 2MSKA 2VDRB 1JIQA 2CYCA 2VK2A 1ZJ5A 2ZQZA 3QIVA 3ZWVA 2XIJA 4QU8A 4F7DA 2ZVDA 3NHRA 4RTKA 1SVLA 1WEKA 3IAUA 4XDHA 3Q8MA 3AGQA 4OM7A 3BREA 3RC8A 2EDAA 2B21A 1DG3A 3D4OA 2PJDA 3FPAA 3JWPA 1MRNA 3SSMA 3VVMA 4ARBA 4DMUB 4BNLA 4O1IA 5LZ9A 3EP5B 4DR3B 2F3RA 2HPZA 5LYJB 2J5BA 3GN1A 3OTWA 1R4NA 2PXCA 1FS4A 2NSYA 3A6HA 3R4CA 3AM5A 3DWEX 4K40A 2H1LA 4HBZA 5FI5A 3M3DA 4UOZA 2ET6A 4TXNA 1PQPA 1LQ2A 4I5EA 3L07A 4J4BA 2WTEA 3KCQA 1QVZA 4FE4A 1FFSA 3H6KA 2JAQA 1G8HA 2GNAA 2HJVA 3V6LA 4CU5A 4X91A 4QJ3A 3ZJTA 1ZNYA 2YXBA 3K0BA 4NG5A 4FVTA 4AW9A 4M8NE 3ZH2A 2FPOA 2DFVA 2JJQA 5LQSA 3WTCA 4XIYA 2MHCA 4NBKA 4YUXA 5CEEA 2A58A 4NMXB 4DWWA 1KOJA 2EG5A 4FDTA 1QYWA 3VBCA 3PNVA 1CZOA 1TDJA 3MTEA 1U80A 2H2DA 5A4FS 2OP0A 1F3LA 4ENWA 2FEMA 5CFLA 2F3TA 2IH4A 2EW8A 1RC1A 4AZ0B 2FFHA 4M1QA 3SDZA 3SF8A 1A9TA 3LXXA 2NYVA 3IB3A 3CLHA 2O3RA 3PZBA 2R8OA 4M8SA 4C4RA 1RAEA 3QBJA 1ZP6A 4WESB 1JB9A 1QHHB 3EMVA 2VP6A 1D2NA 1XL0A 1SK8A 4P98A 4BQPA 1X6VA 3TNLA 1N9KA 3RC9A 2AI3A 4GMGA 2P5TB 3B3GA 1A9SA 5DZSA 2HT1A 1V7PC 4CCYB 4DR6B 5F5XA 2PKEA 3LUFA 3IP3A 4DCGA 2NQTA 1EK5A 3G6WA 4FLMA 4JMPA 5D1HA 5LNK1 2WB2A 1MX1A 3C7TA 5SZJA 2C4TA 4II2A 2H8GA 4R0NA 1PJBA 3ZDBA 5CLFA 4KLNA 1NJGA 4H3KB 2VRNA 4LWZA 3P7MA 3ANNA 2Q0SA 5ENVA 3QKRA 3LQ1A 3EC1A 3CKLA 4DN6A 4TZ0A 5IKOA 1FQKA 4PGAA 2GCOA 2ZUCA 1KYVA 3FSGD 3U17A 3UB3A 3OT1A 3B60A 2JFPA 4D41A 1IRXA 3RVNA 3IBGA 2VJKA 5ALPA 3P4UA 1NF8A 5CA1A 4DR1B 1HV8A 5A3SA 3DLHA 3DCIA 5DK6A 1EQAA 1RXEA 2PRZA 3NTOA 3K0AA 1J2RA 3HDVA 1UKEA 5HGXA 4A8HA 2C4MA 1IDOA 4GXRA 4EVQA 2P1ZA 2EZTA 2RJOA 3STWA 1EK0A 4TTRA 4Y2HA 4AUEA 1Q1EA 3PDHA 3B1JA 5E6RA 4BB0A 4RL6A 4M1MA 1GVNB 3K09A 2ZREA 2R3SA 4CG3A 4RZIA 2XECA 1N2HA