1A9NA

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
b'VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 55
structure length 162
sequence length 162
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14580 LRR_9 Leucine-rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1a9nA00
3UL7A 2ELLA 4Z64C 5AWDA 3O53A 3WPDA 5CMNA 3WPFA 4K17A 3W3GA 4L3AA 1K5GC 1O6SA 4GT6A 4R08A 1OOKG 1M9SA 5FTTB 2UZXA 4IM6A 3OJAA 1PGVA 3G06A 2OMTA 1M10B 3ZYOA 4R6GA 1XEUA 3OJAB 4LXRA 2V70A 4ECNA 3W3JA 4FD0A 5HDHA 3WPGA 2Z66A 3C6PB 1P9AG 1ZIWA 4PKIG 2RA8A 3UL8A 4M7EC 2FT3A 5IJBA 3A79B 3RGZA 4U08A 5AWCA 4KT1A 2Z65A 4PSJA 1FS2A 1D0BA 2Z7XA 3OGKB 1XECA 4CC4C 3C6OB 4QBZA 2Z7XB 3G39A 3ZYNA 2P1OB 5IJCA 2OMXA 5AWBA 1O6TA 2JE1A 4Z94G 2OMZA 4PQ8A 1Z7XW 3REZA 4PERA 3TSRE 2JE0A 1P8VA 1QYYA 4R5CA 3OGLB 4FS7A 2JQDA 4RWTC 2WFHA 3RGXA 4XOSA 5B0TA 5B4PA 1XCDA 3KJ4A 4AW4A 2O6RA 4C2BB 4FDWA 3RIZA 3CIYA 4R6FA 4R07A 2Z64A 3VQ2A 1KOHA 4KNGA 4Z61C 4MN8B 3WN4A 4CNMA 4L3FA 4XGOA 4GLPA 3JB9j 5GS0A 2XWTC 5IYXC 4BSUA 4V2EA 4LSCA 4LXSA 4R0AA 3VQ1A 1FT8A 1W8AA 2Z82A 4CP6A 4J4LA 2OMVA 4ARRA 1WWLA 3E4GA 1DFJI 2Z63A 4R58A 3CIGA 5GMFA 2WQVA 2RR6A 2BEXA 2P1NB 3RFSA 4RCAB 2CA6A 4RCWA 2ID5A 4R5DA 4WYKA 2BNHA 1JL5A 4ARNA 3W3MA 5HZLB 4R6JA 4Y61B 3C6NB 2IFGA 1FQVA 4J0MA 5AZ5A 5GMGA 4U06A 5GQRK 1DS9A 2OMYA 1XWDC 1OTOA 3P72A 4QXEA 3E2JA 1G9UA 4PEQB 4LSXA 3G3AA 4NKHA 1M0ZA 2V9TB 3O6NA 1YRGA 4LI1A 4R6AA 3WPCA 5GS2B 3UN9A 1H6UA 3WPIA 2Q4GW 3ULAA 2XOTA 2Y5QA 4CNCA 4U09A 2O6SA 5IJDA 3RW6A 4MQWX 3WPHA 3RFEA 4V2DA 2OMWA 1DCEA 3G3BA 1OGQA 4EZGA 1P8TA 3W3KA 1GWBA 1OTNA 4U7LA 5GMHA 2Z81A 3SB4A 3OGMB 3PMHG 4B8CD 5LFNA 1FO1A 4Q62A 3ZYIA 4BSRA 4I6JB 4KXFB 4HQ1A 4CILA 3GOZA 4BV4R 4XSQA 1OTMA 2WQXA 3E6JA 3ZYJA 1A4YA 3ULUA 2O6QA 1KOOA 4AY9X 4LSAA 2Z62A 4Z8GA 1K5DC 3UL9A 4C2AB 2P1PB 4OQTA 3WPEA 5D3IA 1O6VA 3ULVA 3W3NA 4R09A 2ASSB 4P8SA 2WQWA 3G04C 4LI2A 3M18A 5CMPA 2ASTB 4NKGA 4M7EA 1OZNA 1A9NA 3RFJA 2A0ZA 2P1MB 3CVRA 4TZHA 1IO0A 4CC4A 3BZ5A 4YEBB 4LSXC 4Z79A 3WPBA 3RW7A 3W3LA 4Q3IA 4FCGA 4UFRA 5AWAA 4QC0A 2WQUA 1H6TA 4ECOA 2R9UA 4G8AA 3DZEA 4FHOA 5A5CA 4P91A 3RJ0A 4Q3GA 1U0ND 4WP6A 1M9LA 3M19A 5B0NA 3FXIA 2OMUA 2UZYA 4BSSA 2V9SA 2P1QB 4FMZA 4V2CA 1LTXA 1XKUA 4H09A 3E3ZA 1SQ0B
chains in the Genus database with same CATH superfamily
3UL7A 2ELLA 4Z64C 5AWDA 3O53A 3WPDA 5CMNA 3WPFA 4K17A 3W3GA 4L3AA 1K5GC 1O6SA 4GT6A 4R08A 1OOKG 1M9SA 5FTTB 2UZXA 4IM6A 3OJAA 1PGVA 3G06A 2OMTA 1M10B 3ZYOA 4R6GA 1XEUA 3OJAB 4LXRA 2V70A 4ECNA 3W3JA 4NZTM 4FD0A 5HDHA 3WPGA 2Z66A 3C6PB 1P9AG 1ZIWA 4PKIG 2RA8A 3UL8A 4M7EC 2FT3A 5IJBA 3A79B 3RGZA 4U08A 5AWCA 4KT1A 2Z65A 4PSJA 1FS2A 1D0BA 2Z7XA 3OGKB 1XECA 4CC4C 3C6OB 4QBZA 2Z7XB 3G39A 3ZYNA 2P1OB 5IJCA 2OMXA 5AWBA 1O6TA 2JE1A 4Z94G 2OMZA 4PQ8A 1Z7XW 3REZA 4PERA 3TSRE 2JE0A 1P8VA 1QYYA 4R5CA 3OGLB 4FS7A 2JQDA 4RWTC 2WFHA 3RGXA 4XOSA 5B0TA 5B4PA 1XCDA 3KJ4A 4AW4A 2O6RA 4C2BB 4FDWA 3RIZA 3CIYA 4R6FA 4R07A 2Z64A 3VQ2A 1KOHA 4KNGA 4Z61C 4MN8B 3WN4A 4CNMA 4L3FA 4XGOA 4GLPA 3JB9j 5GS0A 2XWTC 5IYXC 4BSUA 4V2EA 4LSCA 4LXSA 4R0AA 3VQ1A 1FT8A 1W8AA 2Z82A 4CP6A 4J4LA 2OMVA 4ARRA 1WWLA 3E4GA 1DFJI 2Z63A 4R58A 3CIGA 5GMFA 2WQVA 2RR6A 2BEXA 2P1NB 3RFSA 4RCAB 2CA6A 4RCWA 2ID5A 4R5DA 4WYKA 2BNHA 1JL5A 4ARNA 3W3MA 5HZLB 4R6JA 4Y61B 3C6NB 2IFGA 1FQVA 4J0MA 5AZ5A 5GMGA 4U06A 5GQRK 1DS9A 2OMYA 1XWDC 1OTOA 3P72A 4QXEA 3E2JA 1G9UA 4PEQB 4LSXA 3G3AA 4NKHA 1M0ZA 2V9TB 3O6NA 1YRGA 4LI1A 4R6AA 3WPCA 5GS2B 3UN9A 1H6UA 3WPIA 2Q4GW 3ULAA 2XOTA 2Y5QA 4CNCA 4U09A 2O6SA 5IJDA 3RW6A 4MQWX 3WPHA 3RFEA 4V2DA 2OMWA 1DCEA 3G3BA 1OGQA 4EZGA 1P8TA 3W3KA 1GWBA 1OTNA 4U7LA 5GMHA 2Z81A 3SB4A 3OGMB 3PMHG 4B8CD 5LFNA 1FO1A 4Q62A 3ZYIA 4BSRA 4I6JB 4KXFB 4HQ1A 4CILA 3GOZA 4BV4R 4NZRM 4XSQA 1OTMA 2WQXA 3E6JA 3ZYJA 1A4YA 3ULUA 2O6QA 1KOOA 4AY9X 4LSAA 2Z62A 4Z8GA 1K5DC 3UL9A 4C2AB 2P1PB 4OQTA 3WPEA 5D3IA 1O6VA 3ULVA 3W3NA 4R09A 2ASSB 4P8SA 2WQWA 3G04C 4LI2A 3M18A 5CMPA 2ASTB 4NKGA 4M7EA 1OZNA 1A9NA 3RFJA 2A0ZA 2P1MB 3CVRA 4TZHA 1IO0A 4CC4A 3BZ5A 4YEBB 4LSXC 4Z79A 3WPBA 3RW7A 3W3LA 4Q3IA 4FCGA 4UFRA 5AWAA 4QC0A 2WQUA 1H6TA 4ECOA 2R9UA 4G8AA 3DZEA 4FHOA 5A5CA 4P91A 3RJ0A 4Q3GA 1U0ND 4WP6A 1M9LA 3M19A 5B0NA 3FXIA 2OMUA 2UZYA 4BSSA 2V9SA 2P1QB 4FMZA 4V2CA 1LTXA 1XKUA 4H09A 3E3ZA 1SQ0B
chains in the Genus database with same CATH topology
3UL7A 2ELLA 4Z64C 5AWDA 3O53A 3WPDA 5CMNA 3WPFA 4K17A 3W3GA 4L3AA 1K5GC 1O6SA 4GT6A 4R08A 1OOKG 1M9SA 5FTTB 2UZXA 4IM6A 3OJAA 1PGVA 3G06A 2OMTA 1M10B 3ZYOA 4R6GA 1XEUA 3OJAB 4LXRA 2V70A 4ECNA 3W3JA 4FD0A 5HDHA 3WPGA 2Z66A 3C6PB 1P9AG 1ZIWA 4PKIG 2RA8A 3UL8A 4M7EC 2FT3A 5IJBA 3A79B 3RGZA 4U08A 5AWCA 4KT1A 2Z65A 4PSJA 1FS2A 1D0BA 2Z7XA 3OGKB 1XECA 4CC4C 3C6OB 4QBZA 2Z7XB 3G39A 3ZYNA 2P1OB 5IJCA 2OMXA 5AWBA 1O6TA 2JE1A 4Z94G 2OMZA 4PQ8A 1Z7XW 3REZA 4PERA 3TSRE 2JE0A 1P8VA 1QYYA 4R5CA 3OGLB 4FS7A 2JQDA 4RWTC 2WFHA 3RGXA 4XOSA 5B0TA 5B4PA 1XCDA 3KJ4A 4AW4A 2O6RA 4C2BB 4FDWA 3RIZA 3CIYA 4R6FA 4R07A 2Z64A 3VQ2A 1KOHA 4KNGA 4Z61C 4MN8B 3WN4A 4CNMA 4L3FA 4XGOA 4GLPA 3JB9j 5GS0A 2XWTC 5IYXC 4BSUA 4V2EA 4LSCA 4LXSA 4R0AA 3VQ1A 1FT8A 1W8AA 2Z82A 4CP6A 4J4LA 2OMVA 4ARRA 1WWLA 3E4GA 1DFJI 2Z63A 4R58A 3CIGA 5GMFA 2WQVA 2RR6A 2BEXA 2P1NB 3RFSA 4RCAB 2CA6A 4RCWA 2ID5A 4R5DA 4WYKA 2BNHA 1JL5A 4ARNA 3W3MA 5HZLB 4R6JA 4Y61B 3C6NB 2IFGA 1FQVA 4J0MA 5AZ5A 5GMGA 4U06A 5GQRK 1DS9A 2OMYA 1XWDC 1OTOA 3P72A 4QXEA 3E2JA 1G9UA 4PEQB 4LSXA 3G3AA 4NKHA 1M0ZA 2V9TB 3O6NA 1YRGA 4LI1A 4R6AA 3WPCA 5GS2B 3UN9A 1H6UA 3WPIA 2Q4GW 3ULAA 2XOTA 2Y5QA 4CNCA 4U09A 2O6SA 5IJDA 3RW6A 4MQWX 3WPHA 3RFEA 4V2DA 2OMWA 1DCEA 3G3BA 1OGQA 4EZGA 1P8TA 3W3KA 1GWBA 1OTNA 4U7LA 5GMHA 2Z81A 3SB4A 3OGMB 3PMHG 4B8CD 5LFNA 1FO1A 4Q62A 3ZYIA 4BSRA 4I6JB 4KXFB 4HQ1A 4CILA 3GOZA 4BV4R 4XSQA 1OTMA 2WQXA 3E6JA 3ZYJA 1A4YA 3ULUA 2O6QA 1KOOA 4AY9X 4LSAA 2Z62A 4Z8GA 1K5DC 3UL9A 4C2AB 2P1PB 4OQTA 3WPEA 5D3IA 1O6VA 3ULVA 3W3NA 4R09A 2ASSB 4P8SA 2WQWA 3G04C 4LI2A 3M18A 5CMPA 2ASTB 4NKGA 4M7EA 1OZNA 1A9NA 3RFJA 2A0ZA 2P1MB 3CVRA 4TZHA 1IO0A 4CC4A 3BZ5A 4YEBB 4LSXC 4Z79A 3WPBA 3RW7A 3W3LA 4Q3IA 4FCGA 4UFRA 5AWAA 4QC0A 2WQUA 1H6TA 4ECOA 2R9UA 4G8AA 3DZEA 4FHOA 5A5CA 4P91A 3RJ0A 4Q3GA 1U0ND 4WP6A 1M9LA 3M19A 5B0NA 3FXIA 2OMUA 2UZYA 4BSSA 2V9SA 2P1QB 4FMZA 4V2CA 1LTXA 1XKUA 4H09A 3E3ZA 1SQ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL7 A;  2ELL A;  4Z64 C;  5AWD A;  3O53 A;  3WPD A;  5CMN A;  3WPF A;  4K17 A;  3W3G A;  4L3A A;  1K5G C;  1O6S A;  4GT6 A;  4R08 A;  1OOK G;  1M9S A;  5FTT B;  2UZX A;  4IM6 A;  3OJA A;  1PGV A;  3G06 A;  2OMT A;  1M10 B;  3ZYO A;  4R6G A;  1XEU A;  3OJA B;  4LXR A;  2V70 A;  4ECN A;  3W3J A;  4FD0 A;  5HDH A;  3WPG A;  2Z66 A;  3C6P B;  1P9A G;  1ZIW A;  4PKI G;  2RA8 A;  3UL8 A;  4M7E C;  2FT3 A;  5IJB A;  3A79 B;  3RGZ A;  4U08 A;  5AWC A;  4KT1 A;  2Z65 A;  4PSJ A;  1FS2 A;  1D0B A;  2Z7X A;  3OGK B;  1XEC A;  4CC4 C;  3C6O B;  4QBZ A;  2Z7X B;  3G39 A;  3ZYN A;  2P1O B;  5IJC A;  2OMX A;  5AWB A;  1O6T A;  2JE1 A;  4Z94 G;  2OMZ A;  4PQ8 A;  1Z7X W;  3REZ A;  4PER A;  3TSR E;  2JE0 A;  1P8V A;  1QYY A;  4R5C A;  3OGL B;  4FS7 A;  2JQD A;  4RWT C;  2WFH A;  3RGX A;  4XOS A;  5B0T A;  5B4P A;  1XCD A;  3KJ4 A;  4AW4 A;  2O6R A;  4C2B B;  4FDW A;  3RIZ A;  3CIY A;  4R6F A;  4R07 A;  2Z64 A;  3VQ2 A;  1KOH A;  4KNG A;  4Z61 C;  4MN8 B;  3WN4 A;  4CNM A;  4L3F A;  4XGO A;  4GLP A;  3JB9 j;  5GS0 A;  2XWT C;  5IYX C;  4BSU A;  4V2E A;  4LSC A;  4LXS A;  4R0A A;  3VQ1 A;  1FT8 A;  1W8A A;  2Z82 A;  4CP6 A;  4J4L A;  2OMV A;  4ARR A;  1WWL A;  3E4G A;  1DFJ I;  2Z63 A;  4R58 A;  3CIG A;  5GMF A;  2WQV A;  2RR6 A;  2BEX A;  2P1N B;  3RFS A;  4RCA B;  2CA6 A;  4RCW A;  2ID5 A;  4R5D A;  4WYK A;  2BNH A;  1JL5 A;  4ARN A;  3W3M A;  5HZL B;  4R6J A;  4Y61 B;  3C6N B;  2IFG A;  1FQV A;  4J0M A;  5AZ5 A;  5GMG A;  4U06 A;  5GQR K;  1DS9 A;  2OMY A;  1XWD C;  1OTO A;  3P72 A;  4QXE A;  3E2J A;  1G9U A;  4PEQ B;  4LSX A;  3G3A A;  4NKH A;  1M0Z A;  2V9T B;  3O6N A;  1YRG A;  4LI1 A;  4R6A A;  3WPC A;  5GS2 B;  3UN9 A;  1H6U A;  3WPI A;  2Q4G W;  3ULA A;  2XOT A;  2Y5Q A;  4CNC A;  4U09 A;  2O6S A;  5IJD A;  3RW6 A;  4MQW X;  3WPH A;  3RFE A;  4V2D A;  2OMW A;  1DCE A;  3G3B A;  1OGQ A;  4EZG A;  1P8T A;  3W3K A;  1GWB A;  1OTN A;  4U7L A;  5GMH A;  2Z81 A;  3SB4 A;  3OGM B;  3PMH G;  4B8C D;  5LFN A;  1FO1 A;  4Q62 A;  3ZYI A;  4BSR A;  4I6J B;  4KXF B;  4HQ1 A;  4CIL A;  3GOZ A;  4BV4 R;  4XSQ A;  1OTM A;  2WQX A;  3E6J A;  3ZYJ A;  1A4Y A;  3ULU A;  2O6Q A;  1KOO A;  4AY9 X;  4LSA A;  2Z62 A;  4Z8G A;  1K5D C;  3UL9 A;  4C2A B;  2P1P B;  4OQT A;  3WPE A;  5D3I A;  1O6V A;  3ULV A;  3W3N A;  4R09 A;  2ASS B;  4P8S A;  2WQW A;  3G04 C;  4LI2 A;  3M18 A;  5CMP A;  2AST B;  4NKG A;  4M7E A;  1OZN A;  1A9N A;  3RFJ A;  2A0Z A;  2P1M B;  3CVR A;  4TZH A;  1IO0 A;  4CC4 A;  3BZ5 A;  4YEB B;  4LSX C;  4Z79 A;  3WPB A;  3RW7 A;  3W3L A;  4Q3I A;  4FCG A;  4UFR A;  5AWA A;  4QC0 A;  2WQU A;  1H6T A;  4ECO A;  2R9U A;  4G8A A;  3DZE A;  4FHO A;  5A5C A;  4P91 A;  3RJ0 A;  4Q3G A;  1U0N D;  4WP6 A;  1M9L A;  3M19 A;  5B0N A;  3FXI A;  2OMU A;  2UZY A;  4BSS A;  2V9S A;  2P1Q B;  4FMZ A;  4V2C A;  1LTX A;  1XKU A;  4H09 A;  3E3Z A;  1SQ0 B; 
#chains in the Genus database with same CATH topology
 3UL7 A;  2ELL A;  4Z64 C;  5AWD A;  3O53 A;  3WPD A;  5CMN A;  3WPF A;  4K17 A;  3W3G A;  4L3A A;  1K5G C;  1O6S A;  4GT6 A;  4R08 A;  1OOK G;  1M9S A;  5FTT B;  2UZX A;  4IM6 A;  3OJA A;  1PGV A;  3G06 A;  2OMT A;  1M10 B;  3ZYO A;  4R6G A;  1XEU A;  3OJA B;  4LXR A;  2V70 A;  4ECN A;  3W3J A;  4NZT M;  4FD0 A;  5HDH A;  3WPG A;  2Z66 A;  3C6P B;  1P9A G;  1ZIW A;  4PKI G;  2RA8 A;  3UL8 A;  4M7E C;  2FT3 A;  5IJB A;  3A79 B;  3RGZ A;  4U08 A;  5AWC A;  4KT1 A;  2Z65 A;  4PSJ A;  1FS2 A;  1D0B A;  2Z7X A;  3OGK B;  1XEC A;  4CC4 C;  3C6O B;  4QBZ A;  2Z7X B;  3G39 A;  3ZYN A;  2P1O B;  5IJC A;  2OMX A;  5AWB A;  1O6T A;  2JE1 A;  4Z94 G;  2OMZ A;  4PQ8 A;  1Z7X W;  3REZ A;  4PER A;  3TSR E;  2JE0 A;  1P8V A;  1QYY A;  4R5C A;  3OGL B;  4FS7 A;  2JQD A;  4RWT C;  2WFH A;  3RGX A;  4XOS A;  5B0T A;  5B4P A;  1XCD A;  3KJ4 A;  4AW4 A;  2O6R A;  4C2B B;  4FDW A;  3RIZ A;  3CIY A;  4R6F A;  4R07 A;  2Z64 A;  3VQ2 A;  1KOH A;  4KNG A;  4Z61 C;  4MN8 B;  3WN4 A;  4CNM A;  4L3F A;  4XGO A;  4GLP A;  3JB9 j;  5GS0 A;  2XWT C;  5IYX C;  4BSU A;  4V2E A;  4LSC A;  4LXS A;  4R0A A;  3VQ1 A;  1FT8 A;  1W8A A;  2Z82 A;  4CP6 A;  4J4L A;  2OMV A;  4ARR A;  1WWL A;  3E4G A;  1DFJ I;  2Z63 A;  4R58 A;  3CIG A;  5GMF A;  2WQV A;  2RR6 A;  2BEX A;  2P1N B;  3RFS A;  4RCA B;  2CA6 A;  4RCW A;  2ID5 A;  4R5D A;  4WYK A;  2BNH A;  1JL5 A;  4ARN A;  3W3M A;  5HZL B;  4R6J A;  4Y61 B;  3C6N B;  2IFG A;  1FQV A;  4J0M A;  5AZ5 A;  5GMG A;  4U06 A;  5GQR K;  1DS9 A;  2OMY A;  1XWD C;  1OTO A;  3P72 A;  4QXE A;  3E2J A;  1G9U A;  4PEQ B;  4LSX A;  3G3A A;  4NKH A;  1M0Z A;  2V9T B;  3O6N A;  1YRG A;  4LI1 A;  4R6A A;  3WPC A;  5GS2 B;  3UN9 A;  1H6U A;  3WPI A;  2Q4G W;  3ULA A;  2XOT A;  2Y5Q A;  4CNC A;  4U09 A;  2O6S A;  5IJD A;  3RW6 A;  4MQW X;  3WPH A;  3RFE A;  4V2D A;  2OMW A;  1DCE A;  3G3B A;  1OGQ A;  4EZG A;  1P8T A;  3W3K A;  1GWB A;  1OTN A;  4U7L A;  5GMH A;  2Z81 A;  3SB4 A;  3OGM B;  3PMH G;  4B8C D;  5LFN A;  1FO1 A;  4Q62 A;  3ZYI A;  4BSR A;  4I6J B;  4KXF B;  4HQ1 A;  4CIL A;  3GOZ A;  4BV4 R;  4NZR M;  4XSQ A;  1OTM A;  2WQX A;  3E6J A;  3ZYJ A;  1A4Y A;  3ULU A;  2O6Q A;  1KOO A;  4AY9 X;  4LSA A;  2Z62 A;  4Z8G A;  1K5D C;  3UL9 A;  4C2A B;  2P1P B;  4OQT A;  3WPE A;  5D3I A;  1O6V A;  3ULV A;  3W3N A;  4R09 A;  2ASS B;  4P8S A;  2WQW A;  3G04 C;  4LI2 A;  3M18 A;  5CMP A;  2AST B;  4NKG A;  4M7E A;  1OZN A;  1A9N A;  3RFJ A;  2A0Z A;  2P1M B;  3CVR A;  4TZH A;  1IO0 A;  4CC4 A;  3BZ5 A;  4YEB B;  4LSX C;  4Z79 A;  3WPB A;  3RW7 A;  3W3L A;  4Q3I A;  4FCG A;  4UFR A;  5AWA A;  4QC0 A;  2WQU A;  1H6T A;  4ECO A;  2R9U A;  4G8A A;  3DZE A;  4FHO A;  5A5C A;  4P91 A;  3RJ0 A;  4Q3G A;  1U0N D;  4WP6 A;  1M9L A;  3M19 A;  5B0N A;  3FXI A;  2OMU A;  2UZY A;  4BSS A;  2V9S A;  2P1Q B;  4FMZ A;  4V2C A;  1LTX A;  1XKU A;  4H09 A;  3E3Z A;  1SQ0 B; 
#chains in the Genus database with same CATH homology
 3UL7 A;  2ELL A;  4Z64 C;  5AWD A;  3O53 A;  3WPD A;  5CMN A;  3WPF A;  4K17 A;  3W3G A;  4L3A A;  1K5G C;  1O6S A;  4GT6 A;  4R08 A;  1OOK G;  1M9S A;  5FTT B;  2UZX A;  4IM6 A;  3OJA A;  1PGV A;  3G06 A;  2OMT A;  1M10 B;  3ZYO A;  4R6G A;  1XEU A;  3OJA B;  4LXR A;  2V70 A;  4ECN A;  3W3J A;  4FD0 A;  5HDH A;  3WPG A;  2Z66 A;  3C6P B;  1P9A G;  1ZIW A;  4PKI G;  2RA8 A;  3UL8 A;  4M7E C;  2FT3 A;  5IJB A;  3A79 B;  3RGZ A;  4U08 A;  5AWC A;  4KT1 A;  2Z65 A;  4PSJ A;  1FS2 A;  1D0B A;  2Z7X A;  3OGK B;  1XEC A;  4CC4 C;  3C6O B;  4QBZ A;  2Z7X B;  3G39 A;  3ZYN A;  2P1O B;  5IJC A;  2OMX A;  5AWB A;  1O6T A;  2JE1 A;  4Z94 G;  2OMZ A;  4PQ8 A;  1Z7X W;  3REZ A;  4PER A;  3TSR E;  2JE0 A;  1P8V A;  1QYY A;  4R5C A;  3OGL B;  4FS7 A;  2JQD A;  4RWT C;  2WFH A;  3RGX A;  4XOS A;  5B0T A;  5B4P A;  1XCD A;  3KJ4 A;  4AW4 A;  2O6R A;  4C2B B;  4FDW A;  3RIZ A;  3CIY A;  4R6F A;  4R07 A;  2Z64 A;  3VQ2 A;  1KOH A;  4KNG A;  4Z61 C;  4MN8 B;  3WN4 A;  4CNM A;  4L3F A;  4XGO A;  4GLP A;  3JB9 j;  5GS0 A;  2XWT C;  5IYX C;  4BSU A;  4V2E A;  4LSC A;  4LXS A;  4R0A A;  3VQ1 A;  1FT8 A;  1W8A A;  2Z82 A;  4CP6 A;  4J4L A;  2OMV A;  4ARR A;  1WWL A;  3E4G A;  1DFJ I;  2Z63 A;  4R58 A;  3CIG A;  5GMF A;  2WQV A;  2RR6 A;  2BEX A;  2P1N B;  3RFS A;  4RCA B;  2CA6 A;  4RCW A;  2ID5 A;  4R5D A;  4WYK A;  2BNH A;  1JL5 A;  4ARN A;  3W3M A;  5HZL B;  4R6J A;  4Y61 B;  3C6N B;  2IFG A;  1FQV A;  4J0M A;  5AZ5 A;  5GMG A;  4U06 A;  5GQR K;  1DS9 A;  2OMY A;  1XWD C;  1OTO A;  3P72 A;  4QXE A;  3E2J A;  1G9U A;  4PEQ B;  4LSX A;  3G3A A;  4NKH A;  1M0Z A;  2V9T B;  3O6N A;  1YRG A;  4LI1 A;  4R6A A;  3WPC A;  5GS2 B;  3UN9 A;  1H6U A;  3WPI A;  2Q4G W;  3ULA A;  2XOT A;  2Y5Q A;  4CNC A;  4U09 A;  2O6S A;  5IJD A;  3RW6 A;  4MQW X;  3WPH A;  3RFE A;  4V2D A;  2OMW A;  1DCE A;  3G3B A;  1OGQ A;  4EZG A;  1P8T A;  3W3K A;  1GWB A;  1OTN A;  4U7L A;  5GMH A;  2Z81 A;  3SB4 A;  3OGM B;  3PMH G;  4B8C D;  5LFN A;  1FO1 A;  4Q62 A;  3ZYI A;  4BSR A;  4I6J B;  4KXF B;  4HQ1 A;  4CIL A;  3GOZ A;  4BV4 R;  4XSQ A;  1OTM A;  2WQX A;  3E6J A;  3ZYJ A;  1A4Y A;  3ULU A;  2O6Q A;  1KOO A;  4AY9 X;  4LSA A;  2Z62 A;  4Z8G A;  1K5D C;  3UL9 A;  4C2A B;  2P1P B;  4OQT A;  3WPE A;  5D3I A;  1O6V A;  3ULV A;  3W3N A;  4R09 A;  2ASS B;  4P8S A;  2WQW A;  3G04 C;  4LI2 A;  3M18 A;  5CMP A;  2AST B;  4NKG A;  4M7E A;  1OZN A;  1A9N A;  3RFJ A;  2A0Z A;  2P1M B;  3CVR A;  4TZH A;  1IO0 A;  4CC4 A;  3BZ5 A;  4YEB B;  4LSX C;  4Z79 A;  3WPB A;  3RW7 A;  3W3L A;  4Q3I A;  4FCG A;  4UFR A;  5AWA A;  4QC0 A;  2WQU A;  1H6T A;  4ECO A;  2R9U A;  4G8A A;  3DZE A;  4FHO A;  5A5C A;  4P91 A;  3RJ0 A;  4Q3G A;  1U0N D;  4WP6 A;  1M9L A;  3M19 A;  5B0N A;  3FXI A;  2OMU A;  2UZY A;  4BSS A;  2V9S A;  2P1Q B;  4FMZ A;  4V2C A;  1LTX A;  1XKU A;  4H09 A;  3E3Z A;  1SQ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...