1A9NA

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
total genus 55
structure length 162
sequence length 162
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14580 LRR_9 Leucine-rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1a9nA00
4PKIG 1OTMA 2Z66A 1IO0A 3G3AA 2WFHA 4XGOA 4ARNA 2A0ZA 3M18A 3C6PB 3OJAB 4NKHA 5A5CA 2ID5A 4QXEA 2P1PB 4R6FA 4KNGA 4U08A 5AWDA 4L3FA 4R0AA 3RJ0A 4I6JB 1XCDA 4XSQA 2V70A 4CNCA 2WQVA 3BZ5A 3UL7A 2XOTA 3TSRE 3P72A 3G3BA 4J0MA 5GMFA 1P9AG 1FO1A 2P1MB 4GT6A 3ULAA 3JB9j 2V9TB 4CC4C 2O6SA 1PGVA 2WQXA 4KXFB 4R6JA 3W3KA 2UZXA 3A79B 2O6QA 2OMVA 5GQRK 5LFNA 2Z82A 4IM6A 4NKGA 4BSUA 1K5GC 2Z7XB 3E4GA 4C2AB 5GS2B 5D3IA 4AW4A 1P8VA 1OTOA 4RCAB 4ECNA 3UN9A 3WPDA 5AZ5A 1KOHA 4Z64C 4R6GA 4CC4A 4Z94G 4Z8GA 4FMZA 1O6VA 1P8TA 1GWBA 2O6RA 1FQVA 4V2CA 1OOKG 3REZA 1U0ND 2V9SA 2JQDA 3KJ4A 4ECOA 3ULUA 2Z81A 3RW7A 2BNHA 3WPHA 4KT1A 1K5DC 4V2EA 3VQ2A 4CILA 4CP6A 5GS0A 5IJDA 1ZIWA 1W8AA 4FDWA 3C6OB 4PQ8A 1H6TA 3SB4A 3FXIA 4Q3IA 4R5CA 1XKUA 1WWLA 3OGLB 4G8AA 3ZYNA 1DFJI 2P1QB 4U06A 3WN4A 5AWCA 1FS2A 3WPCA 4LI2A 3RIZA 5GMGA 1A4YA 1Z7XW 1YRGA 3RFSA 4LSXA 4HQ1A 1G9UA 1O6SA 4U09A 1JL5A 3O6NA 4LSAA 3UL9A 1SQ0B 3ZYIA 2R9UA 2XWTC 2OMYA 2RR6A 4K17A 4LI1A 3W3GA 4Y61B 3WPGA 4R09A 3WPIA 5FTTB 2BEXA 4LXRA 3RGZA 2ELLA 1DCEA 2OMWA 3ZYJA 3CVRA 4GLPA 4QC0A 5IJCA 3W3LA 1LTXA 3RFEA 2Z62A 3WPEA 2OMTA 5AWAA 5B4PA 3WPFA 2OMZA 4Q3GA 3DZEA 3WPBA 3E6JA 4L3AA 4Z61C 4RWTC 1M9LA 3G06A 4WP6A 4QBZA 2Z65A 4B8CD 1XEUA 4BSRA 3UL8A 2Y5QA 3OGKB 3RW6A 5B0TA 5HDHA 1QYYA 1M10B 4LXSA 3ULVA 4C2BB 1FT8A 2UZYA 5IJBA 4PEQB 4FD0A 1XECA 4WYKA 2OMUA 1OGQA 2WQUA 2Z63A 3E3ZA 3ZYOA 4P8SA 4R6AA 4Z79A 3VQ1A 1DS9A 4V2DA 3W3JA 2IFGA 2JE1A 4UFRA 5CMPA 4YEBB 1M9SA 3W3MA 4ARRA 4AY9X 4MQWX 2FT3A 2P1OB 1O6TA 2ASTB 2Z7XA 4LSCA 4U7LA 3CIGA 4FS7A 3RGXA 3G39A 5HZLB 3G04C 4J4LA 4R08A 5B0NA 2ASSB 1A9NA 2OMXA 4PSJA 1OTNA 4R58A 4RCWA 2CA6A 3E2JA 3W3NA 4H09A 1H6UA 4MN8B 4OQTA 4PERA 4Q62A 4M7EC 1M0ZA 1XWDC 4BV4R 4CNMA 2JE0A 2RA8A 3C6NB 4FHOA 3M19A 4R5DA 4TZHA 4FCGA 3RFJA 2P1NB 4LSXC 3OJAA 3PMHG 4XOSA 5AWBA 5CMNA 1KOOA 4EZGA 1OZNA 3O53A 4P91A 2Z64A 2WQWA 3OGMB 4M7EA 3GOZA 2Q4GW 1D0BA 4R07A 5GMHA 5IYXC 3CIYA 4BSSA
chains in the Genus database with same CATH superfamily
4PKIG 1OTMA 2Z66A 1IO0A 3G3AA 2WFHA 4XGOA 4ARNA 2A0ZA 3M18A 3C6PB 3OJAB 4NKHA 5A5CA 2ID5A 4QXEA 2P1PB 4R6FA 4KNGA 4U08A 5AWDA 4L3FA 4R0AA 3RJ0A 4I6JB 1XCDA 4XSQA 2V70A 4CNCA 2WQVA 3BZ5A 3UL7A 2XOTA 3TSRE 3P72A 3G3BA 4J0MA 5GMFA 1P9AG 1FO1A 2P1MB 4GT6A 3ULAA 3JB9j 2V9TB 4CC4C 2O6SA 1PGVA 2WQXA 4KXFB 4R6JA 3W3KA 2UZXA 3A79B 2O6QA 2OMVA 4NZTM 5GQRK 2Z82A 4IM6A 4NKGA 5LFNA 4BSUA 1K5GC 2Z7XB 3E4GA 4C2AB 5GS2B 5D3IA 4AW4A 1P8VA 1OTOA 4RCAB 4ECNA 3UN9A 3WPDA 5AZ5A 1KOHA 4Z64C 4R6GA 4CC4A 4Z94G 4Z8GA 4FMZA 1O6VA 1P8TA 1GWBA 2O6RA 1FQVA 4V2CA 1OOKG 3REZA 1U0ND 2V9SA 2JQDA 3KJ4A 4ECOA 3ULUA 2Z81A 3RW7A 2BNHA 3WPHA 4KT1A 1K5DC 4V2EA 3VQ2A 4CILA 4CP6A 5GS0A 5IJDA 1ZIWA 1W8AA 4FDWA 3C6OB 4PQ8A 1H6TA 3SB4A 3FXIA 4Q3IA 4R5CA 1XKUA 1WWLA 3OGLB 4G8AA 3ZYNA 1DFJI 2P1QB 4U06A 3WN4A 5AWCA 1FS2A 3WPCA 4LI2A 3RIZA 5GMGA 1A4YA 1Z7XW 1YRGA 3RFSA 4LSXA 4HQ1A 1G9UA 1O6SA 4U09A 1JL5A 3O6NA 4LSAA 3UL9A 1SQ0B 3ZYIA 2R9UA 2XWTC 2OMYA 2RR6A 4K17A 4LI1A 3W3GA 4Y61B 3WPGA 4R09A 3WPIA 5FTTB 2BEXA 4LXRA 3RGZA 2ELLA 1DCEA 2OMWA 3ZYJA 3CVRA 4GLPA 4QC0A 5IJCA 3W3LA 1LTXA 3RFEA 2Z62A 3WPEA 2OMTA 5AWAA 5B4PA 3WPFA 2OMZA 4Q3GA 3DZEA 3WPBA 3E6JA 4L3AA 4Z61C 4RWTC 1M9LA 3G06A 4WP6A 4QBZA 2Z65A 4B8CD 1XEUA 4BSRA 3UL8A 2Y5QA 3OGKB 3RW6A 5B0TA 5HDHA 1QYYA 1M10B 4LXSA 3ULVA 4C2BB 1FT8A 2UZYA 5IJBA 4PEQB 4FD0A 1XECA 4WYKA 2OMUA 1OGQA 2WQUA 2Z63A 3E3ZA 3ZYOA 4P8SA 4R6AA 4Z79A 3VQ1A 1DS9A 4V2DA 3W3JA 2IFGA 2JE1A 4UFRA 5CMPA 4YEBB 1M9SA 3W3MA 4ARRA 4AY9X 4MQWX 2FT3A 2P1OB 1O6TA 2ASTB 2Z7XA 4LSCA 4U7LA 3CIGA 4FS7A 3RGXA 3G39A 5HZLB 3G04C 4J4LA 4R08A 5B0NA 2ASSB 1A9NA 2OMXA 4PSJA 1OTNA 4R58A 4RCWA 2CA6A 3E2JA 3W3NA 4H09A 1H6UA 4MN8B 4OQTA 4PERA 4NZRM 4Q62A 4M7EC 1M0ZA 1XWDC 4BV4R 4CNMA 2JE0A 2RA8A 3C6NB 4FHOA 3M19A 4R5DA 4TZHA 4FCGA 3RFJA 2P1NB 4LSXC 3OJAA 3PMHG 4XOSA 5AWBA 5CMNA 1KOOA 4EZGA 1OZNA 3O53A 4P91A 2Z64A 2WQWA 3OGMB 4M7EA 3GOZA 2Q4GW 1D0BA 4R07A 5GMHA 5IYXC 3CIYA 4BSSA
chains in the Genus database with same CATH topology
4PKIG 1OTMA 2Z66A 1IO0A 3G3AA 2WFHA 4XGOA 4ARNA 2A0ZA 3M18A 3C6PB 3OJAB 4NKHA 5A5CA 2ID5A 4QXEA 2P1PB 4R6FA 4KNGA 4U08A 5AWDA 4L3FA 4R0AA 3RJ0A 4I6JB 1XCDA 4XSQA 2V70A 4CNCA 2WQVA 3BZ5A 3UL7A 2XOTA 3TSRE 3P72A 3G3BA 4J0MA 5GMFA 1P9AG 1FO1A 2P1MB 4GT6A 3ULAA 3JB9j 2V9TB 4CC4C 2O6SA 1PGVA 2WQXA 4KXFB 4R6JA 3W3KA 2UZXA 3A79B 2O6QA 2OMVA 5GQRK 5LFNA 2Z82A 4IM6A 4NKGA 4BSUA 1K5GC 2Z7XB 3E4GA 4C2AB 5GS2B 5D3IA 4AW4A 1P8VA 1OTOA 4RCAB 4ECNA 3UN9A 3WPDA 5AZ5A 1KOHA 4Z64C 4R6GA 4CC4A 4Z94G 4Z8GA 4FMZA 1O6VA 1P8TA 1GWBA 2O6RA 1FQVA 4V2CA 1OOKG 3REZA 1U0ND 2V9SA 2JQDA 3KJ4A 4ECOA 3ULUA 2Z81A 3RW7A 2BNHA 3WPHA 4KT1A 1K5DC 4V2EA 3VQ2A 4CILA 4CP6A 5GS0A 5IJDA 1ZIWA 1W8AA 4FDWA 3C6OB 4PQ8A 1H6TA 3SB4A 3FXIA 4Q3IA 4R5CA 1XKUA 1WWLA 3OGLB 4G8AA 3ZYNA 1DFJI 2P1QB 4U06A 3WN4A 5AWCA 1FS2A 3WPCA 4LI2A 3RIZA 5GMGA 1A4YA 1Z7XW 1YRGA 3RFSA 4LSXA 4HQ1A 1G9UA 1O6SA 4U09A 1JL5A 3O6NA 4LSAA 3UL9A 1SQ0B 3ZYIA 2R9UA 2XWTC 2OMYA 2RR6A 4K17A 4LI1A 3W3GA 4Y61B 3WPGA 4R09A 3WPIA 5FTTB 2BEXA 4LXRA 3RGZA 2ELLA 1DCEA 2OMWA 3ZYJA 3CVRA 4GLPA 4QC0A 5IJCA 3W3LA 1LTXA 3RFEA 2Z62A 3WPEA 2OMTA 5AWAA 5B4PA 3WPFA 2OMZA 4Q3GA 3DZEA 3WPBA 3E6JA 4L3AA 4Z61C 4RWTC 1M9LA 3G06A 4WP6A 4QBZA 2Z65A 4B8CD 1XEUA 4BSRA 3UL8A 2Y5QA 3OGKB 3RW6A 5B0TA 5HDHA 1QYYA 1M10B 4LXSA 3ULVA 4C2BB 1FT8A 2UZYA 5IJBA 4PEQB 4FD0A 1XECA 4WYKA 2OMUA 1OGQA 2WQUA 2Z63A 3E3ZA 3ZYOA 4P8SA 4R6AA 4Z79A 3VQ1A 1DS9A 4V2DA 3W3JA 2IFGA 2JE1A 4UFRA 5CMPA 4YEBB 1M9SA 3W3MA 4ARRA 4AY9X 4MQWX 2FT3A 2P1OB 1O6TA 2ASTB 2Z7XA 4LSCA 4U7LA 3CIGA 4FS7A 3RGXA 3G39A 5HZLB 3G04C 4J4LA 4R08A 5B0NA 2ASSB 1A9NA 2OMXA 4PSJA 1OTNA 4R58A 4RCWA 2CA6A 3E2JA 3W3NA 4H09A 1H6UA 4MN8B 4OQTA 4PERA 4Q62A 4M7EC 1M0ZA 1XWDC 4BV4R 4CNMA 2JE0A 2RA8A 3C6NB 4FHOA 3M19A 4R5DA 4TZHA 4FCGA 3RFJA 2P1NB 4LSXC 3OJAA 3PMHG 4XOSA 5AWBA 5CMNA 1KOOA 4EZGA 1OZNA 3O53A 4P91A 2Z64A 2WQWA 3OGMB 4M7EA 3GOZA 2Q4GW 1D0BA 4R07A 5GMHA 5IYXC 3CIYA 4BSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKI G;  1OTM A;  2Z66 A;  1IO0 A;  3G3A A;  2WFH A;  4XGO A;  4ARN A;  2A0Z A;  3M18 A;  3C6P B;  3OJA B;  4NKH A;  5A5C A;  2ID5 A;  4QXE A;  2P1P B;  4R6F A;  4KNG A;  4U08 A;  5AWD A;  4L3F A;  4R0A A;  3RJ0 A;  4I6J B;  1XCD A;  4XSQ A;  2V70 A;  4CNC A;  2WQV A;  3BZ5 A;  3UL7 A;  2XOT A;  3TSR E;  3P72 A;  3G3B A;  4J0M A;  5GMF A;  1P9A G;  1FO1 A;  2P1M B;  4GT6 A;  3ULA A;  3JB9 j;  2V9T B;  4CC4 C;  2O6S A;  1PGV A;  2WQX A;  4KXF B;  4R6J A;  3W3K A;  2UZX A;  3A79 B;  2O6Q A;  2OMV A;  5GQR K;  5LFN A;  2Z82 A;  4IM6 A;  4NKG A;  4BSU A;  1K5G C;  2Z7X B;  3E4G A;  4C2A B;  5GS2 B;  5D3I A;  4AW4 A;  1P8V A;  1OTO A;  4RCA B;  4ECN A;  3UN9 A;  3WPD A;  5AZ5 A;  1KOH A;  4Z64 C;  4R6G A;  4CC4 A;  4Z94 G;  4Z8G A;  4FMZ A;  1O6V A;  1P8T A;  1GWB A;  2O6R A;  1FQV A;  4V2C A;  1OOK G;  3REZ A;  1U0N D;  2V9S A;  2JQD A;  3KJ4 A;  4ECO A;  3ULU A;  2Z81 A;  3RW7 A;  2BNH A;  3WPH A;  4KT1 A;  1K5D C;  4V2E A;  3VQ2 A;  4CIL A;  4CP6 A;  5GS0 A;  5IJD A;  1ZIW A;  1W8A A;  4FDW A;  3C6O B;  4PQ8 A;  1H6T A;  3SB4 A;  3FXI A;  4Q3I A;  4R5C A;  1XKU A;  1WWL A;  3OGL B;  4G8A A;  3ZYN A;  1DFJ I;  2P1Q B;  4U06 A;  3WN4 A;  5AWC A;  1FS2 A;  3WPC A;  4LI2 A;  3RIZ A;  5GMG A;  1A4Y A;  1Z7X W;  1YRG A;  3RFS A;  4LSX A;  4HQ1 A;  1G9U A;  1O6S A;  4U09 A;  1JL5 A;  3O6N A;  4LSA A;  3UL9 A;  1SQ0 B;  3ZYI A;  2R9U A;  2XWT C;  2OMY A;  2RR6 A;  4K17 A;  4LI1 A;  3W3G A;  4Y61 B;  3WPG A;  4R09 A;  3WPI A;  5FTT B;  2BEX A;  4LXR A;  3RGZ A;  2ELL A;  1DCE A;  2OMW A;  3ZYJ A;  3CVR A;  4GLP A;  4QC0 A;  5IJC A;  3W3L A;  1LTX A;  3RFE A;  2Z62 A;  3WPE A;  2OMT A;  5AWA A;  5B4P A;  3WPF A;  2OMZ A;  4Q3G A;  3DZE A;  3WPB A;  3E6J A;  4L3A A;  4Z61 C;  4RWT C;  1M9L A;  3G06 A;  4WP6 A;  4QBZ A;  2Z65 A;  4B8C D;  1XEU A;  4BSR A;  3UL8 A;  2Y5Q A;  3OGK B;  3RW6 A;  5B0T A;  5HDH A;  1QYY A;  1M10 B;  4LXS A;  3ULV A;  4C2B B;  1FT8 A;  2UZY A;  5IJB A;  4PEQ B;  4FD0 A;  1XEC A;  4WYK A;  2OMU A;  1OGQ A;  2WQU A;  2Z63 A;  3E3Z A;  3ZYO A;  4P8S A;  4R6A A;  4Z79 A;  3VQ1 A;  1DS9 A;  4V2D A;  3W3J A;  2IFG A;  2JE1 A;  4UFR A;  5CMP A;  4YEB B;  1M9S A;  3W3M A;  4ARR A;  4AY9 X;  4MQW X;  2FT3 A;  2P1O B;  1O6T A;  2AST B;  2Z7X A;  4LSC A;  4U7L A;  3CIG A;  4FS7 A;  3RGX A;  3G39 A;  5HZL B;  3G04 C;  4J4L A;  4R08 A;  5B0N A;  2ASS B;  1A9N A;  2OMX A;  4PSJ A;  1OTN A;  4R58 A;  4RCW A;  2CA6 A;  3E2J A;  3W3N A;  4H09 A;  1H6U A;  4MN8 B;  4OQT A;  4PER A;  4Q62 A;  4M7E C;  1M0Z A;  1XWD C;  4BV4 R;  4CNM A;  2JE0 A;  2RA8 A;  3C6N B;  4FHO A;  3M19 A;  4R5D A;  4TZH A;  4FCG A;  3RFJ A;  2P1N B;  4LSX C;  3OJA A;  3PMH G;  4XOS A;  5AWB A;  5CMN A;  1KOO A;  4EZG A;  1OZN A;  3O53 A;  4P91 A;  2Z64 A;  2WQW A;  3OGM B;  4M7E A;  3GOZ A;  2Q4G W;  1D0B A;  4R07 A;  5GMH A;  5IYX C;  3CIY A;  4BSS A; 
#chains in the Genus database with same CATH topology
 4PKI G;  1OTM A;  2Z66 A;  1IO0 A;  3G3A A;  2WFH A;  4XGO A;  4ARN A;  2A0Z A;  3M18 A;  3C6P B;  3OJA B;  4NKH A;  5A5C A;  2ID5 A;  4QXE A;  2P1P B;  4R6F A;  4KNG A;  4U08 A;  5AWD A;  4L3F A;  4R0A A;  3RJ0 A;  4I6J B;  1XCD A;  4XSQ A;  2V70 A;  4CNC A;  2WQV A;  3BZ5 A;  3UL7 A;  2XOT A;  3TSR E;  3P72 A;  3G3B A;  4J0M A;  5GMF A;  1P9A G;  1FO1 A;  2P1M B;  4GT6 A;  3ULA A;  3JB9 j;  2V9T B;  4CC4 C;  2O6S A;  1PGV A;  2WQX A;  4KXF B;  4R6J A;  3W3K A;  2UZX A;  3A79 B;  2O6Q A;  2OMV A;  4NZT M;  5GQR K;  2Z82 A;  4IM6 A;  4NKG A;  5LFN A;  4BSU A;  1K5G C;  2Z7X B;  3E4G A;  4C2A B;  5GS2 B;  5D3I A;  4AW4 A;  1P8V A;  1OTO A;  4RCA B;  4ECN A;  3UN9 A;  3WPD A;  5AZ5 A;  1KOH A;  4Z64 C;  4R6G A;  4CC4 A;  4Z94 G;  4Z8G A;  4FMZ A;  1O6V A;  1P8T A;  1GWB A;  2O6R A;  1FQV A;  4V2C A;  1OOK G;  3REZ A;  1U0N D;  2V9S A;  2JQD A;  3KJ4 A;  4ECO A;  3ULU A;  2Z81 A;  3RW7 A;  2BNH A;  3WPH A;  4KT1 A;  1K5D C;  4V2E A;  3VQ2 A;  4CIL A;  4CP6 A;  5GS0 A;  5IJD A;  1ZIW A;  1W8A A;  4FDW A;  3C6O B;  4PQ8 A;  1H6T A;  3SB4 A;  3FXI A;  4Q3I A;  4R5C A;  1XKU A;  1WWL A;  3OGL B;  4G8A A;  3ZYN A;  1DFJ I;  2P1Q B;  4U06 A;  3WN4 A;  5AWC A;  1FS2 A;  3WPC A;  4LI2 A;  3RIZ A;  5GMG A;  1A4Y A;  1Z7X W;  1YRG A;  3RFS A;  4LSX A;  4HQ1 A;  1G9U A;  1O6S A;  4U09 A;  1JL5 A;  3O6N A;  4LSA A;  3UL9 A;  1SQ0 B;  3ZYI A;  2R9U A;  2XWT C;  2OMY A;  2RR6 A;  4K17 A;  4LI1 A;  3W3G A;  4Y61 B;  3WPG A;  4R09 A;  3WPI A;  5FTT B;  2BEX A;  4LXR A;  3RGZ A;  2ELL A;  1DCE A;  2OMW A;  3ZYJ A;  3CVR A;  4GLP A;  4QC0 A;  5IJC A;  3W3L A;  1LTX A;  3RFE A;  2Z62 A;  3WPE A;  2OMT A;  5AWA A;  5B4P A;  3WPF A;  2OMZ A;  4Q3G A;  3DZE A;  3WPB A;  3E6J A;  4L3A A;  4Z61 C;  4RWT C;  1M9L A;  3G06 A;  4WP6 A;  4QBZ A;  2Z65 A;  4B8C D;  1XEU A;  4BSR A;  3UL8 A;  2Y5Q A;  3OGK B;  3RW6 A;  5B0T A;  5HDH A;  1QYY A;  1M10 B;  4LXS A;  3ULV A;  4C2B B;  1FT8 A;  2UZY A;  5IJB A;  4PEQ B;  4FD0 A;  1XEC A;  4WYK A;  2OMU A;  1OGQ A;  2WQU A;  2Z63 A;  3E3Z A;  3ZYO A;  4P8S A;  4R6A A;  4Z79 A;  3VQ1 A;  1DS9 A;  4V2D A;  3W3J A;  2IFG A;  2JE1 A;  4UFR A;  5CMP A;  4YEB B;  1M9S A;  3W3M A;  4ARR A;  4AY9 X;  4MQW X;  2FT3 A;  2P1O B;  1O6T A;  2AST B;  2Z7X A;  4LSC A;  4U7L A;  3CIG A;  4FS7 A;  3RGX A;  3G39 A;  5HZL B;  3G04 C;  4J4L A;  4R08 A;  5B0N A;  2ASS B;  1A9N A;  2OMX A;  4PSJ A;  1OTN A;  4R58 A;  4RCW A;  2CA6 A;  3E2J A;  3W3N A;  4H09 A;  1H6U A;  4MN8 B;  4OQT A;  4PER A;  4NZR M;  4Q62 A;  4M7E C;  1M0Z A;  1XWD C;  4BV4 R;  4CNM A;  2JE0 A;  2RA8 A;  3C6N B;  4FHO A;  3M19 A;  4R5D A;  4TZH A;  4FCG A;  3RFJ A;  2P1N B;  4LSX C;  3OJA A;  3PMH G;  4XOS A;  5AWB A;  5CMN A;  1KOO A;  4EZG A;  1OZN A;  3O53 A;  4P91 A;  2Z64 A;  2WQW A;  3OGM B;  4M7E A;  3GOZ A;  2Q4G W;  1D0B A;  4R07 A;  5GMH A;  5IYX C;  3CIY A;  4BSS A; 
#chains in the Genus database with same CATH homology
 4PKI G;  1OTM A;  2Z66 A;  1IO0 A;  3G3A A;  2WFH A;  4XGO A;  4ARN A;  2A0Z A;  3M18 A;  3C6P B;  3OJA B;  4NKH A;  5A5C A;  2ID5 A;  4QXE A;  2P1P B;  4R6F A;  4KNG A;  4U08 A;  5AWD A;  4L3F A;  4R0A A;  3RJ0 A;  4I6J B;  1XCD A;  4XSQ A;  2V70 A;  4CNC A;  2WQV A;  3BZ5 A;  3UL7 A;  2XOT A;  3TSR E;  3P72 A;  3G3B A;  4J0M A;  5GMF A;  1P9A G;  1FO1 A;  2P1M B;  4GT6 A;  3ULA A;  3JB9 j;  2V9T B;  4CC4 C;  2O6S A;  1PGV A;  2WQX A;  4KXF B;  4R6J A;  3W3K A;  2UZX A;  3A79 B;  2O6Q A;  2OMV A;  5GQR K;  5LFN A;  2Z82 A;  4IM6 A;  4NKG A;  4BSU A;  1K5G C;  2Z7X B;  3E4G A;  4C2A B;  5GS2 B;  5D3I A;  4AW4 A;  1P8V A;  1OTO A;  4RCA B;  4ECN A;  3UN9 A;  3WPD A;  5AZ5 A;  1KOH A;  4Z64 C;  4R6G A;  4CC4 A;  4Z94 G;  4Z8G A;  4FMZ A;  1O6V A;  1P8T A;  1GWB A;  2O6R A;  1FQV A;  4V2C A;  1OOK G;  3REZ A;  1U0N D;  2V9S A;  2JQD A;  3KJ4 A;  4ECO A;  3ULU A;  2Z81 A;  3RW7 A;  2BNH A;  3WPH A;  4KT1 A;  1K5D C;  4V2E A;  3VQ2 A;  4CIL A;  4CP6 A;  5GS0 A;  5IJD A;  1ZIW A;  1W8A A;  4FDW A;  3C6O B;  4PQ8 A;  1H6T A;  3SB4 A;  3FXI A;  4Q3I A;  4R5C A;  1XKU A;  1WWL A;  3OGL B;  4G8A A;  3ZYN A;  1DFJ I;  2P1Q B;  4U06 A;  3WN4 A;  5AWC A;  1FS2 A;  3WPC A;  4LI2 A;  3RIZ A;  5GMG A;  1A4Y A;  1Z7X W;  1YRG A;  3RFS A;  4LSX A;  4HQ1 A;  1G9U A;  1O6S A;  4U09 A;  1JL5 A;  3O6N A;  4LSA A;  3UL9 A;  1SQ0 B;  3ZYI A;  2R9U A;  2XWT C;  2OMY A;  2RR6 A;  4K17 A;  4LI1 A;  3W3G A;  4Y61 B;  3WPG A;  4R09 A;  3WPI A;  5FTT B;  2BEX A;  4LXR A;  3RGZ A;  2ELL A;  1DCE A;  2OMW A;  3ZYJ A;  3CVR A;  4GLP A;  4QC0 A;  5IJC A;  3W3L A;  1LTX A;  3RFE A;  2Z62 A;  3WPE A;  2OMT A;  5AWA A;  5B4P A;  3WPF A;  2OMZ A;  4Q3G A;  3DZE A;  3WPB A;  3E6J A;  4L3A A;  4Z61 C;  4RWT C;  1M9L A;  3G06 A;  4WP6 A;  4QBZ A;  2Z65 A;  4B8C D;  1XEU A;  4BSR A;  3UL8 A;  2Y5Q A;  3OGK B;  3RW6 A;  5B0T A;  5HDH A;  1QYY A;  1M10 B;  4LXS A;  3ULV A;  4C2B B;  1FT8 A;  2UZY A;  5IJB A;  4PEQ B;  4FD0 A;  1XEC A;  4WYK A;  2OMU A;  1OGQ A;  2WQU A;  2Z63 A;  3E3Z A;  3ZYO A;  4P8S A;  4R6A A;  4Z79 A;  3VQ1 A;  1DS9 A;  4V2D A;  3W3J A;  2IFG A;  2JE1 A;  4UFR A;  5CMP A;  4YEB B;  1M9S A;  3W3M A;  4ARR A;  4AY9 X;  4MQW X;  2FT3 A;  2P1O B;  1O6T A;  2AST B;  2Z7X A;  4LSC A;  4U7L A;  3CIG A;  4FS7 A;  3RGX A;  3G39 A;  5HZL B;  3G04 C;  4J4L A;  4R08 A;  5B0N A;  2ASS B;  1A9N A;  2OMX A;  4PSJ A;  1OTN A;  4R58 A;  4RCW A;  2CA6 A;  3E2J A;  3W3N A;  4H09 A;  1H6U A;  4MN8 B;  4OQT A;  4PER A;  4Q62 A;  4M7E C;  1M0Z A;  1XWD C;  4BV4 R;  4CNM A;  2JE0 A;  2RA8 A;  3C6N B;  4FHO A;  3M19 A;  4R5D A;  4TZH A;  4FCG A;  3RFJ A;  2P1N B;  4LSX C;  3OJA A;  3PMH G;  4XOS A;  5AWB A;  5CMN A;  1KOO A;  4EZG A;  1OZN A;  3O53 A;  4P91 A;  2Z64 A;  2WQW A;  3OGM B;  4M7E A;  3GOZ A;  2Q4G W;  1D0B A;  4R07 A;  5GMH A;  5IYX C;  3CIY A;  4BSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...