1A9NA

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 162
sequence length 162
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14580 LRR_9 Leucine-rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1a9nA00
3W3GA 1IO0A 4PSJA 5AZ5A 4CP6A 3GOZA 1M10B 4P8SA 4KNGA 4Z79A 3M18A 3E2JA 3ZYNA 3UN9A 4XOSA 4AY9X 3ZYJA 3O6NA 4C2BB 3WPBA 3G04C 1O6TA 4WP6A 3OGLB 2CA6A 3DZEA 2O6RA 3ZYOA 2Y5QA 3UL9A 2P1QB 2BEXA 2OMXA 3W3KA 2V9SA 4LSCA 2A0ZA 4R6GA 3OJAB 4PEQB 1XWDC 5CMPA 2JE0A 4LXSA 1M0ZA 3C6NB 4QC0A 4Z8GA 4B8CD 5A5CA 3PMHG 3CIGA 3RFSA 4FCGA 5IJBA 2JE1A 2WQVA 4CC4A 2JQDA 1OTOA 4PERA 2ELLA 3ULAA 4WYKA 3ZYIA 1OGQA 3E3ZA 4BSRA 5CMNA 1FO1A 3G3AA 4C2AB 1PGVA 1H6UA 4M7EA 4FHOA 2RA8A 4QBZA 5GS2B 4PKIG 3WPIA 2P1NB 2OMWA 1WWLA 4L3FA 4V2EA 5D3IA 4CNMA 4Z61C 5IYXC 2ID5A 2OMZA 4U06A 2Z66A 4ECOA 2UZXA 3JB9j 4Q3GA 4HQ1A 4K17A 5IJDA 3BZ5A 3UL8A 4LSXA 1GWBA 4MN8B 3E6JA 2OMYA 4KT1A 4H09A 2ASSB 3RJ0A 4Q3IA 4R6FA 4LXRA 1KOHA 1OTMA 4FMZA 2Z64A 1M9LA 3WPDA 1G9UA 4RCAB 3RW6A 4U7LA 4RCWA 4R5CA 1XCDA 2O6QA 4CILA 3RFEA 4CNCA 4R09A 5GMFA 3WPGA 2WQXA 4U08A 5HZLB 3UL7A 4AW4A 1O6VA 2RR6A 3G3BA 2Z7XA 4EZGA 4J0MA 4TZHA 4IM6A 3VQ2A 3WPCA 1P8VA 3G39A 2XOTA 2WQWA 1O6SA 2OMVA 4CC4C 3RGXA 4Y61B 4Q62A 5GMGA 4ECNA 3FXIA 1OTNA 1W8AA 2R9UA 4Z64C 5AWCA 2WQUA 3M19A 2Q4GW 3E4GA 5GS0A 4XSQA 1Z7XW 1ZIWA 3REZA 2V9TB 1LTXA 4KXFB 4R6AA 1D0BA 3OJAA 4QXEA 3C6PB 3CVRA 3RIZA 4FD0A 3WPHA 2Z63A 1OZNA 4BSSA 1U0ND 1QYYA 1M9SA 2BNHA 4Z94G 2Z81A 1DS9A 4LSXC 3C6OB 5B4PA 3VQ1A 3W3NA 2P1OB 3RW7A 4ARNA 5B0NA 4G8AA 4YEBB 3OGMB 3TSRE 4BSUA 4R5DA 2P1PB 4UFRA 3A79B 5AWDA 1P9AG 3ULUA 1FQVA 1K5GC 3G06A 3OGKB 4R6JA 3WN4A 3W3JA 4XGOA 4PQ8A 2Z65A 2O6SA 4NKGA 1H6TA 5HDHA 1XKUA 2UZYA 4FDWA 4BV4R 4RWTC 4I6JB 1JL5A 4LI1A 3WPFA 4GT6A 3KJ4A 5FTTB 1A4YA 2XWTC 1A9NA 1DFJI 2IFGA 5LFNA 5AWBA 3W3MA 1XECA 2FT3A 4OQTA 4FS7A 2ASTB 3O53A 2P1MB 2WFHA 3ULVA 2Z82A 4NKHA 4U09A 1P8TA 1K5DC 4GLPA 1YRGA 2OMTA 3W3LA 1XEUA 5B0TA 5GQRK 5IJCA 3RGZA 1FS2A 4M7EC 5GMHA 3CIYA 4R58A 3SB4A 4ARRA 4L3AA 4R07A 4R08A 2Z62A 2OMUA 3RFJA 4R0AA 4MQWX 4P91A 4V2CA 3P72A 4V2DA 1SQ0B 4LI2A 2Z7XB 4J4LA 1DCEA 4LSAA 1FT8A 1KOOA 1OOKG 2V70A 3WPEA 5AWAA
chains in the Genus database with same CATH superfamily
3W3GA 1IO0A 4PSJA 5AZ5A 4CP6A 3GOZA 1M10B 4P8SA 4KNGA 4Z79A 3M18A 3E2JA 3ZYNA 3UN9A 4XOSA 4AY9X 3ZYJA 3O6NA 4C2BB 3WPBA 3G04C 1O6TA 4WP6A 3OGLB 2CA6A 3DZEA 2O6RA 4NZRM 3ZYOA 2Y5QA 3UL9A 2P1QB 2BEXA 2OMXA 3W3KA 2V9SA 4LSCA 2A0ZA 4R6GA 3OJAB 4PEQB 1XWDC 5CMPA 2JE0A 4LXSA 1M0ZA 3C6NB 4QC0A 4Z8GA 4B8CD 5A5CA 3PMHG 3CIGA 3RFSA 4FCGA 5IJBA 2JE1A 2WQVA 4CC4A 2JQDA 1OTOA 4PERA 2ELLA 3ULAA 4WYKA 3ZYIA 1OGQA 3E3ZA 4BSRA 5CMNA 1FO1A 3G3AA 4C2AB 1PGVA 1H6UA 4M7EA 4FHOA 2RA8A 4QBZA 5GS2B 4PKIG 3WPIA 2P1NB 2OMWA 1WWLA 4L3FA 4V2EA 5D3IA 4CNMA 4Z61C 5IYXC 2ID5A 2OMZA 4U06A 2Z66A 4ECOA 2UZXA 3JB9j 4Q3GA 4HQ1A 4K17A 5IJDA 3BZ5A 3UL8A 4LSXA 1GWBA 4MN8B 3E6JA 2OMYA 4KT1A 4H09A 2ASSB 3RJ0A 4NZTM 4Q3IA 4R6FA 4LXRA 1KOHA 1OTMA 4FMZA 2Z64A 1M9LA 3WPDA 1G9UA 4RCAB 3RW6A 4U7LA 4RCWA 4R5CA 1XCDA 2O6QA 4CILA 3RFEA 4CNCA 4R09A 5GMFA 3WPGA 2WQXA 4U08A 5HZLB 3UL7A 4AW4A 1O6VA 2RR6A 3G3BA 2Z7XA 4EZGA 4J0MA 4TZHA 4IM6A 3VQ2A 3WPCA 1P8VA 3G39A 2XOTA 2WQWA 1O6SA 2OMVA 4CC4C 3RGXA 4Y61B 4Q62A 5GMGA 4ECNA 3FXIA 1OTNA 1W8AA 2R9UA 4Z64C 5AWCA 2WQUA 3M19A 2Q4GW 3E4GA 5GS0A 4XSQA 1Z7XW 1ZIWA 3REZA 2V9TB 1LTXA 4KXFB 4R6AA 1D0BA 3OJAA 4QXEA 3C6PB 3CVRA 3RIZA 4FD0A 3WPHA 2Z63A 1OZNA 4BSSA 1U0ND 1QYYA 1M9SA 2BNHA 4Z94G 2Z81A 1DS9A 4LSXC 3C6OB 5B4PA 3VQ1A 3W3NA 2P1OB 3RW7A 4ARNA 5B0NA 4G8AA 4YEBB 3OGMB 3TSRE 4BSUA 4R5DA 2P1PB 4UFRA 3A79B 5AWDA 1P9AG 3ULUA 1FQVA 1K5GC 3G06A 3OGKB 4R6JA 3WN4A 3W3JA 4XGOA 4PQ8A 2Z65A 2O6SA 4NKGA 1H6TA 5HDHA 1XKUA 2UZYA 4FDWA 4BV4R 4RWTC 4I6JB 1JL5A 4LI1A 3WPFA 4GT6A 3KJ4A 5FTTB 1A4YA 2XWTC 1A9NA 1DFJI 2IFGA 5LFNA 5AWBA 3W3MA 1XECA 2FT3A 4OQTA 4FS7A 2ASTB 3O53A 2P1MB 2WFHA 3ULVA 2Z82A 4NKHA 4U09A 1P8TA 1K5DC 4GLPA 1YRGA 2OMTA 3W3LA 1XEUA 5B0TA 5GQRK 5IJCA 3RGZA 1FS2A 4M7EC 5GMHA 3CIYA 4R58A 3SB4A 4ARRA 4L3AA 4R07A 4R08A 2Z62A 2OMUA 3RFJA 4R0AA 4MQWX 4P91A 4V2CA 3P72A 4V2DA 1SQ0B 4LI2A 2Z7XB 4J4LA 1DCEA 4LSAA 1FT8A 1KOOA 1OOKG 2V70A 3WPEA 5AWAA
chains in the Genus database with same CATH topology
3W3GA 1IO0A 4PSJA 5AZ5A 4CP6A 3GOZA 1M10B 4P8SA 4KNGA 4Z79A 3M18A 3E2JA 3ZYNA 3UN9A 4XOSA 4AY9X 3ZYJA 3O6NA 4C2BB 3WPBA 3G04C 1O6TA 4WP6A 3OGLB 2CA6A 3DZEA 2O6RA 3ZYOA 2Y5QA 3UL9A 2P1QB 2BEXA 2OMXA 3W3KA 2V9SA 4LSCA 2A0ZA 4R6GA 3OJAB 4PEQB 1XWDC 5CMPA 2JE0A 4LXSA 1M0ZA 3C6NB 4QC0A 4Z8GA 4B8CD 5A5CA 3PMHG 3CIGA 3RFSA 4FCGA 5IJBA 2JE1A 2WQVA 4CC4A 2JQDA 1OTOA 4PERA 2ELLA 3ULAA 4WYKA 3ZYIA 1OGQA 3E3ZA 4BSRA 5CMNA 1FO1A 3G3AA 4C2AB 1PGVA 1H6UA 4M7EA 4FHOA 2RA8A 4QBZA 5GS2B 4PKIG 3WPIA 2P1NB 2OMWA 1WWLA 4L3FA 4V2EA 5D3IA 4CNMA 4Z61C 5IYXC 2ID5A 2OMZA 4U06A 2Z66A 4ECOA 2UZXA 3JB9j 4Q3GA 4HQ1A 4K17A 5IJDA 3BZ5A 3UL8A 4LSXA 1GWBA 4MN8B 3E6JA 2OMYA 4KT1A 4H09A 2ASSB 3RJ0A 4Q3IA 4R6FA 4LXRA 1KOHA 1OTMA 4FMZA 2Z64A 1M9LA 3WPDA 1G9UA 4RCAB 3RW6A 4U7LA 4RCWA 4R5CA 1XCDA 2O6QA 4CILA 3RFEA 4CNCA 4R09A 5GMFA 3WPGA 2WQXA 4U08A 5HZLB 3UL7A 4AW4A 1O6VA 2RR6A 3G3BA 2Z7XA 4EZGA 4J0MA 4TZHA 4IM6A 3VQ2A 3WPCA 1P8VA 3G39A 2XOTA 2WQWA 1O6SA 2OMVA 4CC4C 3RGXA 4Y61B 4Q62A 5GMGA 4ECNA 3FXIA 1OTNA 1W8AA 2R9UA 4Z64C 5AWCA 2WQUA 3M19A 2Q4GW 3E4GA 5GS0A 4XSQA 1Z7XW 1ZIWA 3REZA 2V9TB 1LTXA 4KXFB 4R6AA 1D0BA 3OJAA 4QXEA 3C6PB 3CVRA 3RIZA 4FD0A 3WPHA 2Z63A 1OZNA 4BSSA 1U0ND 1QYYA 1M9SA 2BNHA 4Z94G 2Z81A 1DS9A 4LSXC 3C6OB 5B4PA 3VQ1A 3W3NA 2P1OB 3RW7A 4ARNA 5B0NA 4G8AA 4YEBB 3OGMB 3TSRE 4BSUA 4R5DA 2P1PB 4UFRA 3A79B 5AWDA 1P9AG 3ULUA 1FQVA 1K5GC 3G06A 3OGKB 4R6JA 3WN4A 3W3JA 4XGOA 4PQ8A 2Z65A 2O6SA 4NKGA 1H6TA 5HDHA 1XKUA 2UZYA 4FDWA 4BV4R 4RWTC 4I6JB 1JL5A 4LI1A 3WPFA 4GT6A 3KJ4A 5FTTB 1A4YA 2XWTC 1A9NA 1DFJI 2IFGA 5LFNA 5AWBA 3W3MA 1XECA 2FT3A 4OQTA 4FS7A 2ASTB 3O53A 2P1MB 2WFHA 3ULVA 2Z82A 4NKHA 4U09A 1P8TA 1K5DC 4GLPA 1YRGA 2OMTA 3W3LA 1XEUA 5B0TA 5GQRK 5IJCA 3RGZA 1FS2A 4M7EC 5GMHA 3CIYA 4R58A 3SB4A 4ARRA 4L3AA 4R07A 4R08A 2Z62A 2OMUA 3RFJA 4R0AA 4MQWX 4P91A 4V2CA 3P72A 4V2DA 1SQ0B 4LI2A 2Z7XB 4J4LA 1DCEA 4LSAA 1FT8A 1KOOA 1OOKG 2V70A 3WPEA 5AWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W3G A;  1IO0 A;  4PSJ A;  5AZ5 A;  4CP6 A;  3GOZ A;  1M10 B;  4P8S A;  4KNG A;  4Z79 A;  3M18 A;  3E2J A;  3ZYN A;  3UN9 A;  4XOS A;  4AY9 X;  3ZYJ A;  3O6N A;  4C2B B;  3WPB A;  3G04 C;  1O6T A;  4WP6 A;  3OGL B;  2CA6 A;  3DZE A;  2O6R A;  3ZYO A;  2Y5Q A;  3UL9 A;  2P1Q B;  2BEX A;  2OMX A;  3W3K A;  2V9S A;  4LSC A;  2A0Z A;  4R6G A;  3OJA B;  4PEQ B;  1XWD C;  5CMP A;  2JE0 A;  4LXS A;  1M0Z A;  3C6N B;  4QC0 A;  4Z8G A;  4B8C D;  5A5C A;  3PMH G;  3CIG A;  3RFS A;  4FCG A;  5IJB A;  2JE1 A;  2WQV A;  4CC4 A;  2JQD A;  1OTO A;  4PER A;  2ELL A;  3ULA A;  4WYK A;  3ZYI A;  1OGQ A;  3E3Z A;  4BSR A;  5CMN A;  1FO1 A;  3G3A A;  4C2A B;  1PGV A;  1H6U A;  4M7E A;  4FHO A;  2RA8 A;  4QBZ A;  5GS2 B;  4PKI G;  3WPI A;  2P1N B;  2OMW A;  1WWL A;  4L3F A;  4V2E A;  5D3I A;  4CNM A;  4Z61 C;  5IYX C;  2ID5 A;  2OMZ A;  4U06 A;  2Z66 A;  4ECO A;  2UZX A;  3JB9 j;  4Q3G A;  4HQ1 A;  4K17 A;  5IJD A;  3BZ5 A;  3UL8 A;  4LSX A;  1GWB A;  4MN8 B;  3E6J A;  2OMY A;  4KT1 A;  4H09 A;  2ASS B;  3RJ0 A;  4Q3I A;  4R6F A;  4LXR A;  1KOH A;  1OTM A;  4FMZ A;  2Z64 A;  1M9L A;  3WPD A;  1G9U A;  4RCA B;  3RW6 A;  4U7L A;  4RCW A;  4R5C A;  1XCD A;  2O6Q A;  4CIL A;  3RFE A;  4CNC A;  4R09 A;  5GMF A;  3WPG A;  2WQX A;  4U08 A;  5HZL B;  3UL7 A;  4AW4 A;  1O6V A;  2RR6 A;  3G3B A;  2Z7X A;  4EZG A;  4J0M A;  4TZH A;  4IM6 A;  3VQ2 A;  3WPC A;  1P8V A;  3G39 A;  2XOT A;  2WQW A;  1O6S A;  2OMV A;  4CC4 C;  3RGX A;  4Y61 B;  4Q62 A;  5GMG A;  4ECN A;  3FXI A;  1OTN A;  1W8A A;  2R9U A;  4Z64 C;  5AWC A;  2WQU A;  3M19 A;  2Q4G W;  3E4G A;  5GS0 A;  4XSQ A;  1Z7X W;  1ZIW A;  3REZ A;  2V9T B;  1LTX A;  4KXF B;  4R6A A;  1D0B A;  3OJA A;  4QXE A;  3C6P B;  3CVR A;  3RIZ A;  4FD0 A;  3WPH A;  2Z63 A;  1OZN A;  4BSS A;  1U0N D;  1QYY A;  1M9S A;  2BNH A;  4Z94 G;  2Z81 A;  1DS9 A;  4LSX C;  3C6O B;  5B4P A;  3VQ1 A;  3W3N A;  2P1O B;  3RW7 A;  4ARN A;  5B0N A;  4G8A A;  4YEB B;  3OGM B;  3TSR E;  4BSU A;  4R5D A;  2P1P B;  4UFR A;  3A79 B;  5AWD A;  1P9A G;  3ULU A;  1FQV A;  1K5G C;  3G06 A;  3OGK B;  4R6J A;  3WN4 A;  3W3J A;  4XGO A;  4PQ8 A;  2Z65 A;  2O6S A;  4NKG A;  1H6T A;  5HDH A;  1XKU A;  2UZY A;  4FDW A;  4BV4 R;  4RWT C;  4I6J B;  1JL5 A;  4LI1 A;  3WPF A;  4GT6 A;  3KJ4 A;  5FTT B;  1A4Y A;  2XWT C;  1A9N A;  1DFJ I;  2IFG A;  5LFN A;  5AWB A;  3W3M A;  1XEC A;  2FT3 A;  4OQT A;  4FS7 A;  2AST B;  3O53 A;  2P1M B;  2WFH A;  3ULV A;  2Z82 A;  4NKH A;  4U09 A;  1P8T A;  1K5D C;  4GLP A;  1YRG A;  2OMT A;  3W3L A;  1XEU A;  5B0T A;  5GQR K;  5IJC A;  3RGZ A;  1FS2 A;  4M7E C;  5GMH A;  3CIY A;  4R58 A;  3SB4 A;  4ARR A;  4L3A A;  4R07 A;  4R08 A;  2Z62 A;  2OMU A;  3RFJ A;  4R0A A;  4MQW X;  4P91 A;  4V2C A;  3P72 A;  4V2D A;  1SQ0 B;  4LI2 A;  2Z7X B;  4J4L A;  1DCE A;  4LSA A;  1FT8 A;  1KOO A;  1OOK G;  2V70 A;  3WPE A;  5AWA A; 
#chains in the Genus database with same CATH topology
 3W3G A;  1IO0 A;  4PSJ A;  5AZ5 A;  4CP6 A;  3GOZ A;  1M10 B;  4P8S A;  4KNG A;  4Z79 A;  3M18 A;  3E2J A;  3ZYN A;  3UN9 A;  4XOS A;  4AY9 X;  3ZYJ A;  3O6N A;  4C2B B;  3WPB A;  3G04 C;  1O6T A;  4WP6 A;  3OGL B;  2CA6 A;  3DZE A;  2O6R A;  4NZR M;  3ZYO A;  2Y5Q A;  3UL9 A;  2P1Q B;  2BEX A;  2OMX A;  3W3K A;  2V9S A;  4LSC A;  2A0Z A;  4R6G A;  3OJA B;  4PEQ B;  1XWD C;  5CMP A;  2JE0 A;  4LXS A;  1M0Z A;  3C6N B;  4QC0 A;  4Z8G A;  4B8C D;  5A5C A;  3PMH G;  3CIG A;  3RFS A;  4FCG A;  5IJB A;  2JE1 A;  2WQV A;  4CC4 A;  2JQD A;  1OTO A;  4PER A;  2ELL A;  3ULA A;  4WYK A;  3ZYI A;  1OGQ A;  3E3Z A;  4BSR A;  5CMN A;  1FO1 A;  3G3A A;  4C2A B;  1PGV A;  1H6U A;  4M7E A;  4FHO A;  2RA8 A;  4QBZ A;  5GS2 B;  4PKI G;  3WPI A;  2P1N B;  2OMW A;  1WWL A;  4L3F A;  4V2E A;  5D3I A;  4CNM A;  4Z61 C;  5IYX C;  2ID5 A;  2OMZ A;  4U06 A;  2Z66 A;  4ECO A;  2UZX A;  3JB9 j;  4Q3G A;  4HQ1 A;  4K17 A;  5IJD A;  3BZ5 A;  3UL8 A;  4LSX A;  1GWB A;  4MN8 B;  3E6J A;  2OMY A;  4KT1 A;  4H09 A;  2ASS B;  3RJ0 A;  4NZT M;  4Q3I A;  4R6F A;  4LXR A;  1KOH A;  1OTM A;  4FMZ A;  2Z64 A;  1M9L A;  3WPD A;  1G9U A;  4RCA B;  3RW6 A;  4U7L A;  4RCW A;  4R5C A;  1XCD A;  2O6Q A;  4CIL A;  3RFE A;  4CNC A;  4R09 A;  5GMF A;  3WPG A;  2WQX A;  4U08 A;  5HZL B;  3UL7 A;  4AW4 A;  1O6V A;  2RR6 A;  3G3B A;  2Z7X A;  4EZG A;  4J0M A;  4TZH A;  4IM6 A;  3VQ2 A;  3WPC A;  1P8V A;  3G39 A;  2XOT A;  2WQW A;  1O6S A;  2OMV A;  4CC4 C;  3RGX A;  4Y61 B;  4Q62 A;  5GMG A;  4ECN A;  3FXI A;  1OTN A;  1W8A A;  2R9U A;  4Z64 C;  5AWC A;  2WQU A;  3M19 A;  2Q4G W;  3E4G A;  5GS0 A;  4XSQ A;  1Z7X W;  1ZIW A;  3REZ A;  2V9T B;  1LTX A;  4KXF B;  4R6A A;  1D0B A;  3OJA A;  4QXE A;  3C6P B;  3CVR A;  3RIZ A;  4FD0 A;  3WPH A;  2Z63 A;  1OZN A;  4BSS A;  1U0N D;  1QYY A;  1M9S A;  2BNH A;  4Z94 G;  2Z81 A;  1DS9 A;  4LSX C;  3C6O B;  5B4P A;  3VQ1 A;  3W3N A;  2P1O B;  3RW7 A;  4ARN A;  5B0N A;  4G8A A;  4YEB B;  3OGM B;  3TSR E;  4BSU A;  4R5D A;  2P1P B;  4UFR A;  3A79 B;  5AWD A;  1P9A G;  3ULU A;  1FQV A;  1K5G C;  3G06 A;  3OGK B;  4R6J A;  3WN4 A;  3W3J A;  4XGO A;  4PQ8 A;  2Z65 A;  2O6S A;  4NKG A;  1H6T A;  5HDH A;  1XKU A;  2UZY A;  4FDW A;  4BV4 R;  4RWT C;  4I6J B;  1JL5 A;  4LI1 A;  3WPF A;  4GT6 A;  3KJ4 A;  5FTT B;  1A4Y A;  2XWT C;  1A9N A;  1DFJ I;  2IFG A;  5LFN A;  5AWB A;  3W3M A;  1XEC A;  2FT3 A;  4OQT A;  4FS7 A;  2AST B;  3O53 A;  2P1M B;  2WFH A;  3ULV A;  2Z82 A;  4NKH A;  4U09 A;  1P8T A;  1K5D C;  4GLP A;  1YRG A;  2OMT A;  3W3L A;  1XEU A;  5B0T A;  5GQR K;  5IJC A;  3RGZ A;  1FS2 A;  4M7E C;  5GMH A;  3CIY A;  4R58 A;  3SB4 A;  4ARR A;  4L3A A;  4R07 A;  4R08 A;  2Z62 A;  2OMU A;  3RFJ A;  4R0A A;  4MQW X;  4P91 A;  4V2C A;  3P72 A;  4V2D A;  1SQ0 B;  4LI2 A;  2Z7X B;  4J4L A;  1DCE A;  4LSA A;  1FT8 A;  1KOO A;  1OOK G;  2V70 A;  3WPE A;  5AWA A; 
#chains in the Genus database with same CATH homology
 3W3G A;  1IO0 A;  4PSJ A;  5AZ5 A;  4CP6 A;  3GOZ A;  1M10 B;  4P8S A;  4KNG A;  4Z79 A;  3M18 A;  3E2J A;  3ZYN A;  3UN9 A;  4XOS A;  4AY9 X;  3ZYJ A;  3O6N A;  4C2B B;  3WPB A;  3G04 C;  1O6T A;  4WP6 A;  3OGL B;  2CA6 A;  3DZE A;  2O6R A;  3ZYO A;  2Y5Q A;  3UL9 A;  2P1Q B;  2BEX A;  2OMX A;  3W3K A;  2V9S A;  4LSC A;  2A0Z A;  4R6G A;  3OJA B;  4PEQ B;  1XWD C;  5CMP A;  2JE0 A;  4LXS A;  1M0Z A;  3C6N B;  4QC0 A;  4Z8G A;  4B8C D;  5A5C A;  3PMH G;  3CIG A;  3RFS A;  4FCG A;  5IJB A;  2JE1 A;  2WQV A;  4CC4 A;  2JQD A;  1OTO A;  4PER A;  2ELL A;  3ULA A;  4WYK A;  3ZYI A;  1OGQ A;  3E3Z A;  4BSR A;  5CMN A;  1FO1 A;  3G3A A;  4C2A B;  1PGV A;  1H6U A;  4M7E A;  4FHO A;  2RA8 A;  4QBZ A;  5GS2 B;  4PKI G;  3WPI A;  2P1N B;  2OMW A;  1WWL A;  4L3F A;  4V2E A;  5D3I A;  4CNM A;  4Z61 C;  5IYX C;  2ID5 A;  2OMZ A;  4U06 A;  2Z66 A;  4ECO A;  2UZX A;  3JB9 j;  4Q3G A;  4HQ1 A;  4K17 A;  5IJD A;  3BZ5 A;  3UL8 A;  4LSX A;  1GWB A;  4MN8 B;  3E6J A;  2OMY A;  4KT1 A;  4H09 A;  2ASS B;  3RJ0 A;  4Q3I A;  4R6F A;  4LXR A;  1KOH A;  1OTM A;  4FMZ A;  2Z64 A;  1M9L A;  3WPD A;  1G9U A;  4RCA B;  3RW6 A;  4U7L A;  4RCW A;  4R5C A;  1XCD A;  2O6Q A;  4CIL A;  3RFE A;  4CNC A;  4R09 A;  5GMF A;  3WPG A;  2WQX A;  4U08 A;  5HZL B;  3UL7 A;  4AW4 A;  1O6V A;  2RR6 A;  3G3B A;  2Z7X A;  4EZG A;  4J0M A;  4TZH A;  4IM6 A;  3VQ2 A;  3WPC A;  1P8V A;  3G39 A;  2XOT A;  2WQW A;  1O6S A;  2OMV A;  4CC4 C;  3RGX A;  4Y61 B;  4Q62 A;  5GMG A;  4ECN A;  3FXI A;  1OTN A;  1W8A A;  2R9U A;  4Z64 C;  5AWC A;  2WQU A;  3M19 A;  2Q4G W;  3E4G A;  5GS0 A;  4XSQ A;  1Z7X W;  1ZIW A;  3REZ A;  2V9T B;  1LTX A;  4KXF B;  4R6A A;  1D0B A;  3OJA A;  4QXE A;  3C6P B;  3CVR A;  3RIZ A;  4FD0 A;  3WPH A;  2Z63 A;  1OZN A;  4BSS A;  1U0N D;  1QYY A;  1M9S A;  2BNH A;  4Z94 G;  2Z81 A;  1DS9 A;  4LSX C;  3C6O B;  5B4P A;  3VQ1 A;  3W3N A;  2P1O B;  3RW7 A;  4ARN A;  5B0N A;  4G8A A;  4YEB B;  3OGM B;  3TSR E;  4BSU A;  4R5D A;  2P1P B;  4UFR A;  3A79 B;  5AWD A;  1P9A G;  3ULU A;  1FQV A;  1K5G C;  3G06 A;  3OGK B;  4R6J A;  3WN4 A;  3W3J A;  4XGO A;  4PQ8 A;  2Z65 A;  2O6S A;  4NKG A;  1H6T A;  5HDH A;  1XKU A;  2UZY A;  4FDW A;  4BV4 R;  4RWT C;  4I6J B;  1JL5 A;  4LI1 A;  3WPF A;  4GT6 A;  3KJ4 A;  5FTT B;  1A4Y A;  2XWT C;  1A9N A;  1DFJ I;  2IFG A;  5LFN A;  5AWB A;  3W3M A;  1XEC A;  2FT3 A;  4OQT A;  4FS7 A;  2AST B;  3O53 A;  2P1M B;  2WFH A;  3ULV A;  2Z82 A;  4NKH A;  4U09 A;  1P8T A;  1K5D C;  4GLP A;  1YRG A;  2OMT A;  3W3L A;  1XEU A;  5B0T A;  5GQR K;  5IJC A;  3RGZ A;  1FS2 A;  4M7E C;  5GMH A;  3CIY A;  4R58 A;  3SB4 A;  4ARR A;  4L3A A;  4R07 A;  4R08 A;  2Z62 A;  2OMU A;  3RFJ A;  4R0A A;  4MQW X;  4P91 A;  4V2C A;  3P72 A;  4V2D A;  1SQ0 B;  4LI2 A;  2Z7X B;  4J4L A;  1DCE A;  4LSA A;  1FT8 A;  1KOO A;  1OOK G;  2V70 A;  3WPE A;  5AWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...