1XEUA

Crystal structure of internalin c from listeria monocytogenes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
263
Chain Sequence
ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords internalin C
publication title Structure of internalin C from Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion
total genus 79
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xeuA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xeuA01
3VQ2A 3FXIA 4BSSA 2Z81A 4FDWA 3OJAB 2JQDA 4P8SA 4R6GA 4LSXA 1KOOA 3ZYOA 5FTTB 4FHOA 4KT1A 3G3BA 3M18A 4K17A 4PKIG 2Z64A 4MQWX 3OJAA 5HDHA 4P91A 3WPFA 2WQVA 3G04C 3WPGA 4QBZA 1H6UA 4PERA 5HZLB 5GMHA 2C9QA 4LI2A 1D0BA 1FQVA 1DCEA 5GMGA 2JE0A 4YEBB 1OTOA 4LSAA 3OGLB 4UFRA 1GWBA 2BNHA 4LI1A 2O6SA 2RR6A 4PEQB 1XECA 2A0ZA 4R0AA 3E2JA 1OTMA 2Y5QA 4FS7A 2RA8A 4U06A 3ZYIA 2V9TB 3ZYNA 4WP6A 3BZ5A 3UL9A 5AWBA 3WPHA 2C9RA 1YRGA 2P1PB 2FT3A 3WPIA 2WQXA 3TSRE 1P9AG 1ZIWA 4Q3IA 3RIZA 1SQ0B 2OMZA 3OGKB 1XCDA 1FT8A 4NKGA 3WPEA 4FD0A 3BCDA 3BC9A 3G06A 2OMWA 4R5DA 1NM4A 3E4GA 4R6JA 2UZYA 4R6FA 4FCGA 3UL8A 3KJ4A 4U7LA 4WYKA 3M19A 4ARNA 1OGQA 4RCWA 4CC4C 3E6JA 4GLPA 4BSRA 2Z7XA 5IJBA 1XKUA 4Q3GA 3O53A 4EZGA 2Z65A 4RWTC 4Z8GA 3REZA 5B0TA 1IX2A 5GQRK 5AWCA 4Z79A 2Z82A 2Z62A 4PSJA 5GS2B 4R09A 4V2CA 4IM6A 2JE1A 5AWDA 3CVRA 4L3FA 4CNMA 3BCFA 5CMPA 3W3GA 5CMNA 3RJ0A 3WPDA 1LTXA 3RW6A 3ULVA 4KNGA 4ECNA 2Z63A 2XWTC 3SB4A 4J0MA 4Z61C 4NKHA 2O6RA 3G3AA 4M7EA 1DFJI 4RCAB 4FMZA 1WWLA 3W3JA 4LSCA 1FS2A 3RGZA 3C6NB 4M7EC 4U08A 5AZ5A 3WN4A 4ARRA 1OZNA 2P1NB 4QXEA 2O6QA 4LXSA 4C2BB 2WFHA 3RFSA 1O6SA 2CA6A 1G9UA 2RA1A 4CILA 1A4YA 3C6PB 1W8AA 2Z7XB 1PGVA 3E3ZA 3OGMB 3ULUA 3UL7A 3G39A 4R5CA 4CC4A 1U0ND 2V9SA 1M42A 3JB9j 2XOTA 1K5DC 2OMVA 4R07A 2R9UA 4I6JB 2OMUA 3ULAA 3P72A 4AQ1A 4OQTA 1JL5A 4R6AA 3UN9A 5IYXC 3RGXA 3FAXA 4ECOA 1O6TA 1FO1A 3WPBA 4CNCA 2BEXA 2Z66A 4LSXC 1Z7XW 4R58A 3WPCA 1LYQA 2WQUA 3FAWA 4U09A 1DS9A 4L3AA 2P1MB 5IJCA 5A5CA 3W3MA 4MN8B 1OOKG 1K5GC 4KXFB 1XWDC 4XGOA 4BSUA 2OMXA 3A79B 2YA1A 4GT6A 1OTNA 4TZHA 3C6OB 4V2DA 2Q4GW 2UZXA 2OMYA 1KOHA 4AW4A 4XSQA 4R08A 3DZEA 4HQ1A 5GS0A 1M0ZA 5IJDA 4AY9X 3O6NA 4H09A 3GOZA 1IO0A 5D3IA 5ICUA 4Q62A 4CP6A 5B4PA 1H6TA 3W3NA 2OMTA 3CIYA 2ID5A 4XOSA 1M9LA 3CIGA 3VQ1A 4V2EA 1P8VA 3RW7A 5B0NA 4Z94G 4QC0A 3W3KA 3RFEA 1XEUA 2P1OB 4LXRA 4C2AB 2ELLA 3ZYJA 4Z64C 4B8CD 2C9PA 2ASSB 1O6VA 1A9NA 1QYYA 2ASTB 4PQ8A 3W3LA 5GMFA 2IFGA 4BV4R 1P8TA 1OT4A 3RFJA 4Y61B 1M10B 5LFNA 4J4LA 5AWAA 1M9SA 3PMHG 2WQWA 2P1QB 4G8AA 2V70A
chains in the Genus database with same CATH superfamily
5D7LE 5KTEH 1NCNA 5IHLB 1X5FA 4AKOA 4JM2A 1A7BA 2GAZA 2VN6A 3CFDA 3MBED 3QDGB 4PGCB 1MCOL 2DQFA 2E4FA 4YSCA 1C08A 5I18H 1YEGL 1U92A 1HEZA 3US1A 1CFVL 3GKWL 5BOZG 3EDEA 3S5YA 3O3AA 4FFVC 4Z7IA 5B3JE 1NGYB 1XDTT 2DWTA 3DV4B 4WWNA 1F6AB 3TASA 2V2WA 1AMXA 3X11A 3CSYA 3QEQB 4QF1A 4Z3FA 3LN5B 5E8OA 4JZJA 4D0CA 4U33A 1QG3A 1SOQA 2K70A 3DRTB 3G7TA 4IKLA 1J88A 1KJVA 2BHZA 4NP4L 3K4AA 4RMSA 1AS7A 1VCAA 1EDYA 3OLGA 3T04D 1MFAL 2DH2A 4PY8J 5E6SB 2EDFA 1KC5H 4UDTA 5TJWK 2AQ1A 5IVZA 5D2LE 3WXVH 1YEFH 1OL0A 3ERXA 4Q97A 3I6LE 2XWJB 5F44A 4EN3D 2Q2EB 4UTAL 3GC3A 2KS0A 4A67A 4C56D 2V5SA 4GYBA 1SDAB 3I6GB 5DQ9A 1NGXB 3QH3A 4XNXH 2D31A 1TSHA 5ACZA 4LBEA 4L3EE 5HVFB 2QDVA 4MJ4A 3L5XH 5D2NB 3UG4A 1OD7A 2Y9RT 5ICYB 5IMOB 3D3VE 1G7IA 2CLVB 3KWVA 4QRAA 1DBJL 1N10A 4QWWC 4U0QB 1JPSH 3BUPA 2IFFL 5KSAC 5TDNA 4OCWH 4YEBB 4TTDC 1KLUB 2VDOB 3D25A 4TVSa 2ENPA 4GQQA 4LDEB 3DTUB 1TQCC 3WNPA 4NO0D 4NZTM 4OCNC 2BNHA 3K6OA 5DHVH 2XWZA 4DK5A 4GAYB 1S7XA 4Y16B 1K8IB 3UBGA 1GR7A 2FQFA 5J5EA 1RZFL 5KUMA 4A2MA 2QPEB 1X6LA 4TN9A 4U06A 4YSTA 3ZYNA 1HCYA 4MDJA 1IAIL 4M61A 1E40A 3GS4A 3NSCA 2E56A 3VD0A 3VD1A 3IE9A 2EINB 5F6HJ 2WLIA 5FPIA 2G3NA 2HTKC 2JJVA 4IIZA 5BUPA 4KKNA 4LAQL 5HI4C 5I8CB 2YRLA 4MA1C 3KPPB 3P11H 3M1BB 1T7WA 1IC7H 4DJMA 4X9BA 3U7YL 5IUCA 2W92A 5MEPB 1GKOA 3QISA 1FG9C 1QLRB 3BEWA 3RWDA 3VD9A 1SHWA 5E6IC 1BMWA 2DLFL 3DGGA 1SY6A 1EEYA 1LO0H 1E4XH 5AKRA 2HJKA 4PREA 1AIFB 5HJDA 4H0HB 1I82A 5E9DD 3FTUA 5C0AA 3W11C 2HP4A 3QXWA 4HLZH 2LLLA 5D7JD 3ZTDC 4Z7VF 3JTSA 1LD9B 5KSUB 4FLQA 4DKFL 3ZRFC 1LDSA 5AB2A 2CK0L 1DVUA 1BQHB 2CNZA 2WBWB 3DXAD 4N26A 2DQMA 2C5DC 3TO4A 3RWIA 2Y5TA 4CVZA 2X4QA 4CADA 4XCEA 1MW2A 1BQUA 2NCEA 4UYQA 4G7YH 3HPJB 3GMMB 4WEBL 1A3RL 3PWPB 1S7SA 3K0YA 4YL4A 3V6ZB 1HIML 3QPKA 2BY0A 3LV3B 2ADYA 3MV8B 2YSTA 5L9DL 4ENED 1A6ZA 2H45A 4BSRA 1DVTA 5FFOA 3G08B 2EDRA 3HZYB 3PP3K 3OWRA 3KJ6H 1BBJA 3UC0H 4M43L 5D7KD 1KTCA 1ZLEA 3TP4A 1NAMB 3L95B 5FYKU 4BFKA 4BKTC 3O2WL 1FIGL 2QV4A 4JANB 4DZBA 3D5OF 5ICXA 2DDQL 1KSRA 1KTKE 3KD4A 2P24A 4YUEH 1GS7A 2W9EH 3QWRA 4H8VA 4Q56A 3WOVA 1SN5A 3MNDA 3TZVA 3WJJA 5JXED 1RUKL 4EZGA 2AKRB 4AM0Q 3K6SA 1KXVA 1ZMYA 1WA1X 3OKMA 3A0OA 3DVFA 5C0IB 1JHKH 1L9TA 1RK0A 1XAUA 2R29A 4LHUA 2NX5B 1KZYA 3UG5A 5A2JH 5A6IA 3K6FA 5I82A 5I6NA 4GLRH 3KYOA 5E56A 3R8QA 1FYTA 4QGTA 4ZUVB 5FYKE 1IKNA 2XV2A 3IKCB 4HWBA 1MFNA 1NIAA 2XQYA 4IM6A 1EK3A 2D03L 1VKXB 4Y0GA 2X4SA 3DKHA 2JH2A 2YD3A 3HBQA 3VWJC 3BO8A 4F7CA 3QUXA 1EAQA 5HYFA 5IB2B 2VN4A 3MMEB 1GC1L 3WXWL 1BQKA 5TE4L 5ILTL 2NY3D 3DTXA 3FO9A 4GI8A 1CLOL 2R1XA 2AP2A 1SOSA 5FF6B 2PABA 1I75A 1JWUA 2Z7WA 3G6JE 3LIZH 5CLYA 4LVNC 3WFBH 4L37B 5K1NA 2LOEA 1F58H 2ADGB 3BQVA 1XCQB 1QZNA 1VGEH 4HIIB 4Z7OB 1BOYA 5GISL 4YR6B 2QFPA 3FONA 3CAFA 1QSFB 4YDLB 4TVPL 2IDUA 3WCYA 2ICEA 2YSSB 3GSUA 4FTVA 5FDWA 5IP4A 4TQPA 4L3CB 5HJBA 1OQXA 1TVHB 1VRSA 5IJKC 1BAGA 2DIEA 1YUHB 3ULVA 1MCPL 2IALB 5GS0H 2C7FA 4E41A 4BQCA 4GUQA 3LN4A 3ARPA 3P9MB 5ESQB 1XB6A 4GRMB 3KM1A 4P46B 4FE9A 1AZVA 4Z7UF 3EOAA 3P9WB 4JMXA 3CHXA 1I8IA 3TT3L 5BVPL 1UATA 2JELL 4X99B 3VX1A 2WSDA 5KVDE 1T7YA 3B43A 1N67A 3OHMB 2DB8A 4NHCH 4DP2X 2Z8RA 4GEIA 3TFKC 2F8IA 2NYYD 3PCYA 3R7QA 3HE6C 3RVVC 3L3HB 3AU1B 3MKGA 3BIKB 2X4OB 4HGWA 3B7RL 4EI6B 3TN0B 3U4BH 2A77L 3J27A 4YVNA 1GGBH 3MRHA 3MXVL 4XPBL 1NMAH 4XOAA 4HSQA 4G8GA 3LH2H 1FNFA 2LQRA 4J3SA 2CMRL 4NUJB 3H7BB 3H3KA 1MCBA 3JWNC 1I8KA 2XN9A 2FEEI 5FEBA 3O4LA 1Z3GH 3S8GB 4KPHL 3HNTH 4IBVA 4RGMC 3GDCA 5KSBE 3RUGA 1I9RL 4AOFA 1T1YB 1KDJA 3I9PA 1I7ZA 4ANVA 3IJYA 2YAOA 3EYUH 1BBDH 2I27N 1M7DB 1PCSA 4PW3A 1BEXA 4UIMA 1CURA 1PGVA 1FF5A 4XN8A 4MCMA 2GEEA 2VLKD 4MNQA 1TR7A 1KB5L 2V9SA 2BFVH 5JUEL 1M42A 4KH2A 1F3JA 1GSKA 2H7WA 5GGVL 1N8OE 1THAA 3Q9QA 2I9TA 3CUPB 2P26A 3MGAA 1K72A 3FHEA 3VRLE 4WKZB 4HHAA 5ANME 3AG2B 3VXNB 4IDJL 1ZE3H 5IGXL 5KBPA 4LASH 1U9KA 1SM3L 4OQTA 3IAGC 2QR0A 4L1DA 2CALA 3IFNH 2R0LH 5FUZL 3TL5A 2XZCH 3UJJL 4ECOA 1YG9A 2E27H 3HIZA 4LL1A 5FUCC 3IFLH 4UB0L 3ARED 4MB1A 4AW7A 3PYCA 4HFUH 3IDJB 5I6XC 5I8KH 4B3VA 3HHSB 5CKAA 1T03H 1SJVA 1FV1A 1A2YB 3LX9A 1ND0A 3LRMA 4PRPD 3ZMRA 1G94A 1MCSA 2EDEA 3IPEA 2E6QA 5DJ8A 3ME0A 4CU7A 4A63A 1J1PL 4FL4B 1UJ3A 2ZQKA 4PRHB 5E00B 3WNOA 4JN2B 5EOCH 3KPLB 3GZPA 4NQCD 3IDNA 4YE4H 2EYTB 2DIJA 1SYSA 3CXDH 1EIBA 1SGKA 2BFGA 5J6HA 2QLYA 4P3CL 3ZE0F 1YQ2A 5EIQA 3WNJA 1XWDC 4U7SA 3MLVH 3VFWB 2NY2C 4W9IC 1YYML 4GFXA 2Q8AL 2NR6A 5FS5A 3ARBB 2X4TA 4OLUL 1PNCA 4P9HC 2YA1A 4GP5B 1M57B 4B95C 1VERA 2WUBH 4LDLB 1UHVA 5E8EA 5EU3B 4F9PC 1DQIA 4U7MA 4V2DA 4L8SA 3HN3A 2I60L 3DMMC 1MIML 3NCYS 4R0LB 3SGKC 3TTYA 3BJ91 5A6LA 1OARH 2X1PA 2YHGA 4WI3A 1GZQA 5J57B 4GS7C 3QEGH 3MRCA 3WUWB 1QI4A 2CJUH 4PJIB 2H1LM 3S5LB 3E0GA 3FU3A 3GOZA 3C60C 3RA7H 2X09A 1CPUA 2JK5A 3G5YA 3EH4B 5IB3B 5EZLA 3QR0A 1BJ1J 3GO1H 4HFWA 4CP6A 4MZ3A 1H6TA 3KYAA 4J6RH 4NN6C 2RFXA 4H8WH 2UY6B 4PV9A 2EUZA 1SMOA 3I84A 5ID1A 2NNRA 1ES0A 2VWEC 1H3GA 2OQJB 4U1SA 4DESA 4R7XA 1YMHB 4MRCA 4BQ9A 4GXUM 3ZPDA 3B7YA 4PVBA 3T4YB 5L88H 1NJ9A 3F5WB 1JNHB 3O3BB 2NXZD 3CZGA 4UMGA 4OLXL 3PAZA 1DLHA 1Q94A 5DSCB 4LLVB 3F7RA 4HC1H 2ITFA 2ZXGA 1NGQL 5EC1B 1OVZA 2N7BA 3RNQB 3PDGA 2IH8A 3Q2NA 1YNTB 3QEUA 1BAFL 4JL2A 5LBGA 3V0AC 2DBLL 2N0KA 2WO4A 3SKOB 3UTTD 3PDOB 1G4RA 1FAKT 4N90D 3D09A 4PRBB 3A5VA 3BAEL 4X50A 1TEYA 2YGOA 3Q5OA 5JO5A 5AKSA 1INDH 5GXBB 3G6AB 2WBJB 1O6VA 3FTGB 2ZKHH 2VABA 3FSOA 3MNZA 2IFGA 3NSDA 3Q6GH 1TZHB 1HCFX 4JM2B 5GGSA 4BV4R 2GAZB 3KPRD 4X6BA 5FYKL 4DGIH 1VAHA 3HAEH 2YEZA 4GSQA 2VKWA 3VGHA 3VXQA 2W1NA 4LKCA 1JXKA 1C08B 4Q2ZB 3K8MA 1U92B 4OJYA 1HEZB 1CICA 3HI1A 4HSAC 2IC2A 5INCB 3UDWC 3H9ZA 5AW3B 4RZCB 3V8OA 1GGUA 3ZKSD 2MTAA 1CTNA 4YHNB 2MKWA 3CSYB 3E8VA 4WFEE 3X11B 5E8OB 2B2XL 4JZJB 4AE0A 2NNFA 3CXFA 4D0CB 4D8PA 1F1GA 1KJVB 4MQTB 1XGUA 2O6FA 2A4CA 5D72H 2A9DA 2AGJH 3ZTJH 2F15A 3S4SB 3E7JA 5I0WA 5EZJA 4GKSA 5IVZB 2OJ1A 5DHDA 4MCNA 1G7PA 1Q4NX 3EO1A 1ZA6B 4V1DE 3VA2C 4MZRA 4ZMWA 2HYMA 3JYCA 3M45A 4E68A 5BUGA 4KV5F 1EGJH 1Y1DA 4JFXB 5DQ9B 1X5MA 1TU2A 3QH3B 1UD8A 4LBEB 3S0PA 4KXAA 4B9ZA 1REIA 4U2YA 5LQBL 2OI9C 5IJBC 3V0IA 4K3JH 5KVDL 1WAAF 2TSAA 2QEJA 5GRYA 3KYMA 2HT4D 2NY6C 3KHOA 3W2DH 3CSFA 2ZP8A 4U31A 1TCRA 1JF5A 2NUPA 3MLZL 4PERA 3IDYC 5SWSB 5F9DC 2NSXA 3D25B 4J3OH 2JJTA 5FK9B 1PGRB 1XGQB 2HRGA 3JV0A 2B59A 2XZZA 1IC4H 1DJIA 3H55A 1N6QL 2GSGB 1P6FA 4OD1L 1KCSL 3VFUA 2PPAA 2YUWA 4CA4A 4OH2A 2QQLL 1ZHBB 2M2DA 2ZICA 1S7XB 1M1SA 4I3RL 1IVLA 2IAMA 2HKAA 3ISRA 2WVUA 2BWIA 2G30A 1EAJA 3H7LA 3H56A 2H0JA 1BWWA 3OAZH 4OI9A 4MDJB 4M61B 5F3HA 2BVPA 5K59E 1FHNA 1IL1A 2Z31C 3O9WB 4MNHB 2WLIB 4LU5L 4WWPA 2D9QB 5GS2H 1L7TL 2ED8A 5AVSB 4TNWF 2C4FT 1KWGA 2FWLB 3RY5A 4F9LC 3BEWB 2VDKL 2RA8A 3JWNE 1EEYB 3LPOA 1NOAA 2LHAA 4GIOA 4FA8A 4QYAA 1A9VA 1IV8A 4M5ZL 5C0AB 2YBGA 5I75C 2Y7SA 2KZBA 5IVXE 2VN3A 2F68X 2NY5C 3EGSA 5KBLA 3JTSB 4YPGA 5FCSH 3UPRA 5E2VH 3DJ9A 1X4XA 2G0KA 5HDRA 4MAUH 2X6BA 1RK7A 5HHPA 3GSNA 2ZOLB 5C0RH 3ES6A 1MDTA 3C5ZA 2X3CA 4XWOC 3TO4B 5I8EB 3RWIB 3UBXI 2E59A 1Q0YL 2Y5TB 4CVZB 2X4QB 3WNNA 3GI9H 3S9DB 1OLZA 2IDFA 1OSZA 4BSWA 3SJVB 4B9CA 1MRFH 4ETQA 2OMBA 1VEOA 5KVGE 4R96B 2R4SL 2XU9A 1S5HA 3K91A 4PJDF 4R6JA 2EH8L 3HG1A 2ARJA 2XY1A 5BXFA 1DUZA 1U6AH 3LS5L 4JHAL 1H9DA 3N40P 1JD7A 1F2XK 3QZOA 3Q8FA 1CWVA 5E99H 1ZV5A 1A7OH 4UYPA 2QSVA 2CBPA 1CFTA 3KW7A 4U3CA 5HXMA 4U7LA 1JYWA 5FUCE 3Q6FA 1BBJB 2VDQL 2VISA 3ECUA 1E42A 2YK1H 3GINA 1I8MA 5DD6A 1E6OL 5MEOA 2H2PC 2FBJH 5ICXB 1NDGA 3ZKXC 2P24B 3I02A 1OK8A 2H9GA 5KOMC 5C07E 2ZYIA 4JREB 4CC4C 3U46A 2VYRE 4NN7C 3K6SB 1J1XH 2WIIB 1UXLA 3RTQD 4C58B 2QQNH 4TSBL 1CLYH 4N86A 1RK0B 2DI8A 2X4RA 1UWGL 1MRDH 3SBQA 4L4TD 1CZ8L 2VDRB 2QPDB 1CU4L 4G7VL 3KYOB 5D1ZC 1KIQA 1FYTB 3OGCA 5T3XE 1BQSA 4Z3IA 1C1EL 3ARYA 4X9HA 2X4SB 4F7CB 1NICA 3O6LH 4WLCA 6FABL 4DTGH 2HFEA 3I50H 2CO4A 3QUXB 3CZFA 4RISH 1ZLWH 5L0QC 4EZMA 4LIQE 1IX2A 2VJ0A 1RZGA 4M7ZC 5AWCA 2CO1A 1QFHA 3MRDA 3QJSB 1FFQA 3CDZB 2VXQH 4ZSOA 3DTXB 2EDWA 3FO9B 1G7JA 2JTDA 3MC0A 1JWUB 1QZ1A 4LSTH 4YX2H 4J4PD 2IADB 3PV7A 2C9AA 3L1EA 5ISZD 2WQAA 4BZ1L 3P0YH 4BFEA 3CVRA 3FONB 2VJ8A 4AI7A 1AHWC 2ICEB 1ANUA 4FTVB 4K8RH 5FDWB 4YMPA 4PB9H 1YY9D 2E4TA 4F7PA 3N44F 1WEJL 2J6WA 3E38A 4YE0A 5DHVA 2W9LA 2VWEE 4E41B 2QZ5A 2BSEA 3INUH 3BXNA 4UNUA 1WBYA 3EJUA 1DZBA 3QDHA 4XCNA 1IAKA 5T3ZD 3EOAB 4AJWA 1I8IB 4NUPA 5F0PB 5ABDE 4C47A 3P40A 4GRLA 1VJSA 3K3QA 3PFQA 3DDGA 1AI1H 5I1EL 4PGEA 1YSOA 1S3KL 3GF8A 4LCCC 1CFBA 1HQRB 1RZJH 1PZDA 4Y5XB 4A2LA 4UTCA 5CKGA 2HLFC 3OVUB 2NY0C 2YJLA 1MN4A 3O3EA 3ML9A 2MNWA 4LPUA 3MRHB 4OCXH 2BIMA 4G8GB 1OZTG 1XMEB 1UZ8A 3W5NA 1J11A 3E2HB 3QUYB 3L9RA 5BV7B 3K8KA 4BCXA 3DX8A 4ESKA 1PZUB 1I8KB 2WXJA 2XN9B 1ZTMA 3RFZC 3O4LB 3W9EA 1D5IL 3GLAA 2YPLD 3NIFE 3RUGB 4IRZA 4ZZKA 5MEND 3U7AA 1UKTA 1I7ZB 3IJYB 3WFDH 2KH2B 4KJQC 1QSZA 2BOCB 1BYOA 3BAKA 4Y2DD 4CMMA 1P7KA 4UIMB 5D71L 1IBBA 3BLBA 2P1NB 4M3JA 3RKDC 4M29A 1A4AA 3ULUF 2VO5A 5C3TA 3C9NA 4MNQB 4F93B 4C2BB 5F7YC 2WFHA 1S2EA 1PKQA 4HD5A 3A4AA 4HKXA 1W15A 1F3JB 4MVBC 1E2ZA 4Z95H 1I8LC 4N2HA 4OZFG 1ZHNB 3FQUA 4X9FA 3BISA 5IOPB 5CP7B 1Q0XL 3ISWA 5AVUB 4NUGH 5CSGA 3O4OC 5CJ8A 1PDKA 4F1SA 4WQOA 5HYEA 4K71B 5L7XL 2OXHB 2VL4A 3QIWA 4Y4KD 1ADQL 2QR0B 2LVEA 3RYMA 2H6UA 1URIA 2R59A 1LL1A 2KC0A 3BGMA 1FRGH 4OGAC 4TUKH 2XXMB 2ERJB 3UTQA 1AQHA 5HGGS 4P23C 1A9EA 5J0BA 3SGEI 1W16A 3BPLC 4LLMA 4R07A 1KN4H 5C0BA 1OAUH 1QABA 1WHOA 1SDYA 1MFVA 3A24A 3TBYA 1ND0B 2ALWA 2YAMA 4LOUC 4ZMYA 1J8HE 1N0XL 2ZG1A 5DJ8B 3U79A 2WUCH 1N7ML 1AC6A 4ZYKA 3MYJB 4I0PC 4I2XE 4NWUH 3AXHA 3UIYA 4A66A 3V0DA 4AXWA 5CD3A 3DJTA 4R97B 3O11A 1LNUA 1ZRUA 2CXKA 3IT8D 3VMOA 1NIBA 1O6TA 3GXDA 3IDNB 3MRIA 4WWOA 2OPCA 4ZK8A 5IESL 2QQKL 2W9DH 1NCCL 1A7PH 1CDJA 4JHUA 2VH5L 5J6HB 1OEZW 4EJ1C 4HZLA 1PY0A 4ZFGL 4F91B 4CNIA 1I3VA 4Z7QF 1M9WA 2X4TB 2J55A 1VPOL 4TULH 1T83C 4UT7L 1ZEAH 2AZUA 2GT9A 4AMKL 2HFTA 3H42L 5JW3H 5E8EB 4QRRA 5EOTB 4L8SB 5HYSG 1UWYA 3MACH 4AJYV 1KENH 5JYMA 4BFBD 2XZQH 3KZ8A 3DYPA 3IJ7A 1OCWH 5BZDB 4M9OA 3EXLA 3HBPA 3BGFC 3LIZA 1GZQB 5CCKL 5FM8A 1FNHA 3II2A 1MRCL 5AUMB 5J56B 5SX5H 2IDTA 2ZIDA 2W80C 4Y1TA 5AG9A 5C0FB 1GYCA 4RNRA 3G5YB 1DO5A 5D70L 3C6OB 5EZLB 4HEME 1T0MB 4HFWB 1E4WH 5HPMA 1RFDL 2CLRA 2AJYL 4PJAF 2RFXB 5GS0A 5KVGL 2FECI 1SJEA 5D6CA 4PV9B 3SDCC 5ID1B 2V8LA 3VGFA 4AQEB 4MJ6A 1J5OH 3A6OA 4MJIB 4KKCC 4GKNB 4R2GB 1UADC 4A7VA 1I9IH 1NJ9B 4LCWE 5CN3A 1BQRA 1V7NH 4OGXL 2AEIT 3M1OA 1DLHB 4RX4A 2PO6B 1NKGA 2F5BL 2Y6SC 1B9ZA 2BPBA 3MLSL 4WF7A 2XFGB 4KMLB 1CMOA 2E3VA 1PAMA 3FF7A 4G59C 3QEUB 4KH9A 4QTHA 3H9HA 3V5HB 4LVEA 4RRPG 2G2NA 1NIDA 4L05A 5DVOA 3WS3A 2VR4A 4KHTH 1CVSC 3IRCA 4J27A 3HJEA 5IM7B 3B3IB 1KBPA 3F3HA 3FNKA 2PWEA 4EI5C 1JBJA 3NACH 3FFOA 5F7EH 3L3GB 1TZGH 2VABB 2JJSC 3MNZB 1G7QA 4WY7L 2BNQA 1XEUA 1VFAA 4Y4FC 3ATDA 5E51A 5GGSB 5T3XL 1MCWW 4X6BB 4P9HL 3S37L 1JCVA 1ZSDB 2Q7YA 3VXQB 1E5UI 4LKCB 3NT0A 5GRVK 2FJGA 4LMQI 1GOHA 5DTFA 4KRPD 5DK0A 4Z64C 1CICB 3HC3H 4L4VD 4LIQL 4WW1B 1HYSC 1J05A 3IAPA 5LAPA 2RJMA 3UJIH 1MCNA 3LXCA 4W4NA 5TE7L 2J5WA 3QC6X 4PP1D 3QUKA 1OAKL 1WO2A 3HE7A 3JVGA 3HC4L 4NKOA 5IF0A 4D8PB 4DP1X 4N6RA 4AL8C 2NQ3A 1XGUB 4RMRA 4IOSA 4G2AA 2CDFA 4PJ9A 2VW7A 4KK6C 4OZ4A 3EYVA 3L5IA 2P47B 3CHRA 3PL6A 3AB0C 4M7KH 5E6ID 4JLRA 1U93A 2D7OA 1G7PB 4WWKB 3DTDA 4NQSA 2X9YA 4JRXE 3SYQA 3EO1B 3SDDA 1QSEA 1R3LA 4OT1H 1JRHL 1A1MA 4PJHA 4FADA 5F21B 2H6PB 2Y7NA 3C08H 4L1TA 1UKQA 2VZUA 2AXHA 1AGDA 4JQVA 2J57A 4PJCA 4KTDH 5C2BL 3N0PB 1M2VA 2IH1A 1P4IL 3I2CH 3KYMB 4ZFOL 4KFMA 1XF5A 1OAJA 1K5WA 4E5XG 1IRAY 3PGFH 1K4CA 4BQBA 1TCRB 2NUPB 5I0ZA 4POZD 5DD1L 1G4MA 1IUZA 1WFOA 5GGRA 3GSOB 1TPXB 4EDWH 4XN2A 1QHPA 1ZLSL 4PKIG 5ETUA 3SE3A 1KGCE 2Z64A 4PW9A 5TQ2H 5HHQA 3FPXA 4WU7B 4KZDL 2NY7L 3N85H 5HDHA 3WPFA 2H8PA 3VFUB 3HR6A 3K4DA 3FB7A 4NZRL 1Q9LB 4JX0A 4LQ1A 5FV2A 3BMWA 2EYRA 5SX4I 3NFSL 3KNBB 3MV7D 2VMCA 5CINH 2NY1D 1HWGB 3P77B 1WZ1L 1N59A 3MA9H 4YHKL 4WHTA 2WC7A 4WW2A 3EYFA 1OGAE 4WUUA 2JCCA 4FZEL 5I1IH 2QGBA 1KNOA 1NL0H 3QI9C 3KLLA 3T4AA 1GAFL 3RZCA 3SOTA 4XP1L 4P49A 4JG1L 3U1SH 1IL1B 3NQIA 4HS3A 1A0QH 3CG8A 5D5MF 5AOIA 2DJMA 2YD4A 5DMKA 2YGPA 2ZNWA 4K7FA 2AAVA 4XNQB 4KY1H 3VXPB 3LHPL 4PLKD 3SGJC 1IC1A 3IJHA 4Z0BL 3LKQA 2HRPH 2ZYRA 4FLRA 3IM1A 4OF0A 4XNMA 5F88A 1N0LA 2R23A 3ZK0A 2VDLL 3C09C 2ZG3A 4V1DD 4BEIA 3QDGD 4G7RB 1GS8A 3EGSB 3QNXA 3RPKA 2O5YH 4YPGB 3AG4B 4HC1A 5DUPH 4YHML 4YBHA 3E2JA 5HHPB 4CGUB 3AM8A 3GSNB 4KK8C 3ES6B 4Z7UE 3C5ZB 3TBBA 5JQ6H 1I7RA 4JE0A 4Q74A 4YIQB 3RVTC 3QAZB 5IVOA 2WP3T 4Z7WF 4N3TA 1OSZB 2IBBA 3QEQD 3IPBA 4OM1H 4YS4A 4XHJC 3CHQA 4BUHA 4QKXB 1S5HB 4KBPA 2ZPKH 2ZOTA 4X8XA 2P8MA 5KVFH 4QO1A 4MCYA 1VZHA 2CJ3A 3HG1B 4JVUA 3WNKA 3ETTA 5DMJB 1MREL 2ATKA 1SN2A 3GXUB 5BXFB 3MUHL 1DUZB 3LD8C 4EIGB 2AJ3A 1KCRH 1ZIWA 2E9GA 4GY4A 5LBSH 2FWOA 2F5AH 2OMZA 3Q6FB 3PHQA 4IGBA 5EUOA 2VGLM 1I8MB 5DD6B 2IVFC 1WBXB 3QUZA 3NAAL 1BFSA 3UFIA 5MEOB 3T0DA 3VI4F 1HINH 4JFFE 4UOW1 3W9DA 1NDGB 1NGPL 2H9GB 3B8SA 1I1CA 3NEXA 4X98A 3HE6D 1XAKA 1OAYH 1IC5L 2GJPA 1ZV9A 5IK3B 1JZIA 1L0YA 2E6PA 3QARA 1XXFC 2HH0H 5EPMB 4PJXA 1DBMH 2PCPA 3I9GL 4GKOA 1Q1PA 1HK6A 5FCUL 3AJ7A 4Y5YA 5A2AA 3N6YA 4N2FA 4Y19B 3DC0A 2J1WA 3CZLA 5TGBB 1KIQB 4FQ2H 3V5KA 4QRFA 2RB8A 4R26L 3JTTB 3MQIA 2GVYA 4N0FB 4RLDA 1SF3A 5LXVA 1NC4B 2HFEB 4LPVA 1EGJA 3CZFB 4P0DA 4Y16D 5E1GA 1RZGB 5BS0A 2MFNA 4NIYE 3BPCB 1KIUB 3MRDB 2Z7XA 1DYZA 2NY5L 3QJHA 4ZSOB 3V4PL 1NCIA 5DC9B 2XX1A 3WN5C 5HGAB 7FABH 1G7JB 1A3LL 2Z7ZA 4Q3GA 1HVXA 1L9QA 3GHBH 4AIOA 5DFTA 3ARDC 3SD5A 1B0IA 1JUFB 3TA3C 1E67A 4AQ1C 1U33A 2ZXQA 3GXPA 3NIDB 3GI8L 3GBNH 4HJGA 3TF7C 2MNUA 2HX7A 3BSZL 3OD3A 2C3GA 4GSXA 2O6EA 2P5WA 4HF5H 3EZ8A 4KK5C 3T1FB 5BPPA 2XYBA 2IDQA 2VQUA 1NCWL 1YAZA 3VWKC 1I1FA 2WLHA 4QEGA 2Z65C 5ALCL 2WZPA 4F37K 2QFRA 1BZQK 2HFGH 3T0EC 3ET9F 1O9ZA 2I9LA 5DHVB 4FI7A 2BSSA 3ZT7A 4I8DA 5FM5O 2IXQB 4TUUA 5DFAA 5FWRA 4AV0A 5DO2C 2CQVA 3BXNB 1NCUA 2WHVA 3FULA 4RWYH 3F2LA 4XCNB 1QA9B 2J56A 1IAKB 3Q8CA 4ONHA 1H3PH 2O4EA 1PS3A 1QEXA 3KLQA 2OJEA 4GRWF 3L17A 2BC4B 3F6JA 3L7EB 4PRNA 4Q9RH 1Z6JT 5J11C 4P2OA 3X1GA 3V6FA 4MD0A 4PGEB 1Z0MA 4TLKA 2CR0A 2DV6A 2H26A 2YAPA 2FUQA 4PY8I 1URZA 4ZQKB 4PUBL 4X4KA 4B7IA 5CJ5A 4KX8A 3O3EB 4O2CA 4NWTH 5CZXC 1YEHH 2MH4A 3X3GH 1UZ8B 3HHRB 3FFCE 1MXGA 3AT0A 3AS2A 3PWPD 5JNYA 3OKEA 4I0CC 4K5NA 3DX8B 1KJ2B 3FH8A 4N5UA 2ICES 4Y5VC 2QSQA 3FU6A 3VFGL 3W9EB 4UOQA 3MV8D 1A7NL 1YNLH 3CLFL 5T3XD 1KBGL 2YXVA 3NN8A 2XNAA 3OQ3B 4UMSA 5CCHE 1UYWH 2VUKA 3TVMC 1PL3A 5FOBA 3KMDA 1K5NA 3CMOL 1E8XA 5I0DA 1G43A 2NW3A 1INEH 1M1XB 3UAEA 5EH1A 4AV4A 1CL7I 3EH2A 3L81A 4URKA 5DJ0A 2YPKB 4G6AD 3C9NB 3EJYD 1PKQB 5EEWA 1SXSA 4HKXB 1C5CH 2R9HC 4WK0B 3BN9C 5GHWL 2GJZA 1MOEA 3LTVA 5HHOA 3K6NA 3RX8A 4LSUH 4NCC2 3WDIA 1OAZH 3FQUB 4JFVA 2JKTM 4X8GA 1FZJA 3SHSA 4ODXA 4ZUTB 2EE2A 1YMMA 4YQXL 3D18A 3Q2CA 2NX5D 3WN4A 1OE3A 2X0WA 1PDKB 1DTUA 4WNQA 4C4KT 2D8KA 5IQ7H 1FJ1A 1KEML 4I9WE 3QIWB 4RCAA 1Q1JL 4AUJA 5ITFA 4CVUA 3BGMB 5F7MC 4IRJC 4HIHB 1YPZA 4JZOB 1G9UA 4XNZB 2VC2L 3BP4A 3IEAA 3UTQB 1A9EB 4I18A 3ZL1A 3VB8A 3IFOB 5C0BB 3RX5A 5CHNA 4PJ8A 2A4ZA 5DS1A 4IIQB 3VB9A 3H9SA 5DVNA 2APTA 3UTSE 3VFTA 1KJMA 4FCHA 4PTUA 1U3ZA 4LSSL 4ZYKB 5EZIH 1OTSC 1AR1B 1JHTB 5CD3B 2EJ1A 1C5BL 3NJVA 4M8RA 3VXSB 3ULUC 1I3GH 3L1FA 4BUGA 4OFIA 3QXDB 3VFPB 1R9FA 2ZCKL 1TZOA 5ALBH 1NCAL 1A4JB 4ZUSA 5F9WB 5LLIC 5I6LA 1QSFD 4JO2H 1A65A 4XO9A 1MAJA 2ESVA 4HZLB 4YDJB 1UM6H 4CNIB 4ELMA 1UTDA 1XCTB 3QYNA 1DHKA 3W0WE 3L4UA 4YXHH 2GT9B 1U8MA 4QD2E 1JZ6A 1I1YA 4QRRB 1MFEL 4D9RE 4P46D 5F7KC 1IGMH 2VXQA 1NOLA 2YMXH 5ID0A 1X5KA 3PJLA 1A4CA 3TIEB 2D7NA 2A6KA 1EO7A 1MCWM 1LO3L 5AL8A 5I5JA 4KV5E 3QULA 4LRNH 4O51A 1CF8L 1TZIB 1WAAE 2GCYB 4NKIH 4RNRB 1BOGA 3TN0D 3PPEA 1GJIA 4KMTL 3UROR 3FCTA 4G9DA 5FYLH 5I1AA 1W0YT 5HPMB 3ZTNH 2CLRB 4Q9CA 1CD0A 3ZTCC 5D6CB 4GP4B 4HLEA 4OW6A 1G9NH 3L4XA 4KFZC 4M1GL 1QOKA 4LSPH 4JAMB 1NLBL 1JV2A 1TTAA 1DQLH 4KNTA 2F74A 4KQ4H 1OTNA 4HWUA 1AAJA 4IKIA 5IROC 3NYKA 5J1AA 1NBVL 2J72A 4RWHA 3BDBA 4HMEA 3VVVA 1N64L 5CO1A 2EE6A 2OMYA 1CDBA 3CIQA 3ZMNA 4R3SB 4XVTH 4AYMC 2B7DT 4I77H 1NFDA 5IJDA 5B1JA 2CO6A 3MROA 3H9HB 3QQ9D 3OKKB 1HE8A 4AC4A 4XPHL 2N01B 4DETA 4WHYH 4XBGB 3LXUX 5DJCA 3CN0A 3BI9X 2NTFA 3EBIA 2BNUB 3RL1A 5C7XH 2ORBH 2GITA 5HI3D 4BUQA 4ZW6A 5CEZH 1AO7A 3GMQA 4PG2C 1X5JA 5LGKA 4DH2A 3B2PA 5JW4R 4PQXA 4DP7X 4BE5A 1G7QB 4GG6A 2BNQB 4MMXA 4UZGA 4JB9L 3GSVA 3PP3H 4GQ9L 4YXLH 2ZTBA 5E5MB 5IVNA 1DQJB 5GRWA 5EU6A 1P4UA 1UD2A 3DIDA 1HH6A 4O5LH 5AVTB 4F2MB 2FT7A 2FJGB 3KW8A 2EIEA 1EVTC 5DK0B 3GB7A 5DTFB 1X7QB 3QQ4B 3DX7A 1J05B 3MBXL 2XBTA 3NEOA 3UMTA 4WDIA 3VH8G 4OBSA 2BP8A 1HILB 2ED6A 2Q7AA 3ZRSA 3QUKB 1CFVH 1NCTA 2APBA 3HE7B 4NKOB 2B1HL 5IF0B 3B9AA 4PRHD 4JQXC 1GYVA 1IE4A 4R5XA 3AT8A 4PRIA 1U95B 4BK4A 2C8NA 1J9TA 2CDFB 3PFUA 4PWFA 4W9LC 1N5YH 1O7DC 2O5NA 3ZYJA 4YDKL 2ZX7A 3PL6B 5F2FA 4ODTL 1NPJA 3HUJA 4BFRA 1U93B 2C9PA 3ARBD 3BVXA 1MFAH 4NQSB 4PJ5B 4PQ8A 4ELKA 1QSEB 4IMLA 1R3LB 2EDNA 4PJDE 5C0CE 4OU3A 3GM0A 2XC8A 2ZUYA 4PJHB 5F1NB 1SNRA 2FJSA 3ABGA 5CXPA 4UTAH 1O75A 3FO0L 6CGTA 1WIUA 3WBDA 2F1BA 5F9OL 1M2VB 2IH1B 3DHMA 5CFHA 1HWWA 1RUML 3V0HA 1XF5B 2F53B 2OKMA 4QMEA 1K4CB 4IRSA 3U0PA 3U2SA 2FVNA 2RGSA 2EDHA 1K8DA 1A9BA 2OYKA 3QUMB 3NJHA 5B21A 1DBJH 4OZIF 4X6DF 5GGRB 5AL0A 4X9YA 2IFFH 4HZAA 3WEXA 4URTB 3IMUA 3HMXL 1MHHA 2TSBA 1L9NA 2AJXH 3T0EE 5HHQB 3ZSSA 2H8PB 2VN7A 5HDOA 3TJEH 3JT0A 1BF8A 3MLUL 2EYRB 3TJHD 3NK3A 4LVOC 1YAIA 4N2MA 1BECA 2AQNA 3KXFE 2GJ6B 2RMNA 3BLKA 4S1QL 1N59B 3WIAA 3MX0B 4GKZB 4WW2B 3EYFB 4WUUB 3T0AA 2JCCB 3MBWA 1KNOB 1R24B 2K45A 3HBZA 4QCIB 4MQWX 1KIPA 3RZCB 1SVZA 4M8QA 2FJHB 4NX0A 4DNLA 2J5LB 3KLHC 4J8QA 4HS3B 1ZY9A 2WQVA 1IAIH 3G04C 3WPGA 2F08A 4UILL 3LEYH 3HBGA 4OCMC 1A21A 2EVFA 1EZUA 4EOWH 4K7FB 3QO0A 5C09A 1HNYA 4LAQH 4AL8L 5L4IA 3X12B 3IJHB 3LKQB 3QNZA 3RGHA 2WBJD 1H3VA 4XC1L 1JXGA 5KBMA 1HL4A 3U7YH 1T20A 4XNMB 5F88B 2GUOB 1N0LB 2GI7A 2JKXA 4KTGA 3WFEL 2DLFH 2R23B 2Z8VC 3E9UA 4JM2D 4LLAA 4ZODA 1WUZA 2AV1A 4M6ML 4DAGH 2Y25A 3RHWF 3UYPA 3CDGB 1K9TA 4U1JA 3CMGA 3QNXB 4HJ0C 4S10A 3VSVA 4WV1C 5DEFB 1Z66A 1DQQA 3SKMB 1XX9C 5FO7A 4F92B 2FR4A 3S6CA 5KSVB 3CC5A 4AZ8B 4NOFA 4FXKA 3ASNB 5CLTA 3UZQB 2GIMA 4MJHA 2E8YA 1DBAH 1GWBA 2LU3A 4R7VA 1NAKL 4J2QA 4FQPA 4JY6A 1BFVL 4BHUA 1T1ZA 4MCYB 2MWCA 1DBKL 3GXMA 3TXAA 4PJ7A 3LKOA 2A0ZA 4WEBH 1A3RH 2ATKB 3P73B 1XD1A 4DGUA 1EXUB 1C7SA 4XBEL 1HIMH 5HP5A 2DTSA 3QFGA 2FWOB 2OMZB 1IFGA 4GAFB 3PHQB 4K07A 4MA3A 2C9RA 2A6JA 2W60A 2PWGA 4FXLA 3QUZB 1KACB 5IHHA 2PPDA 3O3DB 4UAOB 3R1GL 4L1LA 5AW9B 4DVBA 1OE2A 4NQTA 3QA3A 2IPTH 1XV8A 3E6HB 4X98B 2NOYA 2PTTA 3O2WH 1FIGH 2JWYA 3TYFA 1P9AG 3LVEA 2DDQH 2AQSA 1JZHA 2FEDC 4CGTA 5HYJE 3ULUE 2C3HA 1CXFA 1MWAH 1RUKH 4NRXA 4Q9BA 5GZOD 2PCPB 3FT9A 1CC3A 12E8L 4NM4L 5CP3H 4ZXBC 1TJIL 2O5XL 3U1QA 1CJYA 4FQXC 5SWSD 4QRPE 3U30B 1OGTA 3K46A 3UJTH 5K1JA 3BWAB 3V5KB 1CK0L 3K71A 4R6FA 2R1YB 3SDAC 1XGRA 1JMZA 1UQSA 5BS0B 2JLLA 1XR9A 2MOQA 2YRZA 4EQ3A 3A22A 4YHZL 1CGSL 1J18A 2XQYK 1KY6A 1HNFA 4MLSA 2IIJA 1GC1H 3KGSA 1L9OA 4LLDA 1XB8A 4MAYC 3WXWH 5TE4H 3WNIA 5ILTH 3JV5A 3UAAA 3DUUA 2YQ2A 3O9WD 2AANA 1TTCA 1CLOH 4HHGA 3VQLA 1R3KA 3ETSA 4DEUA 5ADOL 1QO3A 1KMGA 1FNSL 1A22B 2P5WB 5DYOA 1BHGA 1LP9A 4MXQD 3DETC 4F15B 1I1FB 1UM5L 3EJPA 3V6BR 2Q9OA 3HG0A 3BSHA 5GISH 2K1MA 4OGYH 1EHLL 5TPWL 1OV8A 2BSSB 2VLJB 4K5MA 4TVPH 4JRYE 5IFJA 3QRBA 3TS8A 3UAFA 3FQXA 2DH3A 1MCPH 4WTQA 1MFBL 4Z7QE 3D2UB 4ONHB 2BIHA 3II3A 4MD4A 5E9NA 4BGLA 1I53A 4YHYC 4P4KA 4Y1AA 5DJ6B 4Z79A 5CMAA 4PRNB 5JTWA 5KJRH 3NDYE 4P2OB 2NQDA 3WLBA 4DUWA 3MLXH 2JELH 4QT5A 5KBNC 3EH3B 2KPNA 3ARFA 3TO4D 2RD0A 3U4AA 5GS2B 3TH2T 3OG4B 2VKXA 4I0PD 4U1LA 4CMHC 1YEEL 2WXQA 3LXAA 3M7OA 1I1AA 5MI0B 4APQA 4S0TD 2VRQA 1L3NA 4O2CB 2MQGA 3FCUB 1A5FH 4DFHA 3SJVD 4DQAA 4UUJA 3HLKA 1QKZL 1PYWA 4R4NC 3OKEB 2A77H 1SHXA 4MJ5A 4A7GA 4EPSA 4KRMB 3KH4A 3EADA 2ZOOA 1A3QA 4EZJA 1F00I 2HAZA 1D2OA 4X7EC 1VFUA 4Y2NA 1EJ6A 2CMRH 4X4MA 4C59B 3ULVF 5CJOL 2YD8A 1AOZA 4PJAE 1K5NB 1UB6B 4KPHH 1NDTA 2NW3B 2D3NA 3ILDA 3KAAA 1W0WA 1XIWC 4W9CC 1OD9A 4BQ6A 3K2UH 5DJ0B 5D9SA 4KROB 4A2FA 3KPMA 1KTRL 2G5RA 2X40A 5FHBL 2BVEA 1CGTA 3MN8A 4OLWL 5DR5L 4ALAC 2ZXEB 3LEVL 1MFDH 2P5EA 5HI5D 3ABKB 1UT9A 2DQEL 3L4YA 4F80A 2EVJA 1OGSA 2C1OA 2K6YA 2WXKA 4TNVF 2FQDA 1O7DE 5GGVH 1YMMB 3QHZL 1WCBA 4JO3L 4LCUA 3LVTA 5ITBL 4Z61C 4HBCL 5EDSA 2J6EL 2KKQA 1FYTD 4R4FL 3G3AA 1FJ1B 1P6AB 2OMWB 1HESA 5LBSA 4M7EA 1FGNL 4IDJH 3CTTA 4RCAB 4IEFA 2ODIA 5C0ND 4Y7OC 1CIUA 1YPZB 3QUXD 4V2BA 2WYZA 2Z34A 3T6WA 4RFEA 4I18B 5FUZH 4LEXL 3UJJH 2VSMB 3KGTA 3MBEA 4PJ8B 3FRUA 3AC0A 4XO5A 2WTPA 4CN6A 4UB0H 1BJ8A 1RJCA 3VFTB 1KJMB 2B9AA 4PTUB 4DCQA 1G1CA 2Q76B 4OKVA 5DRWA 5GIRA 3N1GC 2OTWA 3FRPG 4JEGB 3MODH 3JWOC 3ZT6A 1PX4A 4MA8L 2E0PA 4OF6A 3RDTA 3UBFA 1JS4A 4X6CA 3OKOB 3UERA 4ZUSB 2VZ3A 3FQWA 4GT0A 3GBEA 4FTVD 3R0MA 1MCLA 2ESVB 4U6HB 4JN1L 3OR7A 4UQ2A 4WFHD 4DGVL 4ELMB 2YR3A 2EE3A 3EDFA 4GIAA 1IGFL 1MUJA 5E1QA 5IB1A 4JDTL 1FCGA 2J88L 2BSRA 2HG5B 3N43B 4E41D 1BVNT 1U8MB 2J43A 4JZNA 1X5IA 2IQ9H 4KXCA 1HQ4A 1I1YB 2CGYA 2Q8AH 3TCTA 4AWJC 4OLUH 3CZKA 4EN3A 4HA1A 3V9FA 3P3UA 5ID0B 4TUOB 2A83B 3PWLA 3SPHA 2VN5A 4C56A 5DA0B 5E4EC 2BY2A 2HSIA 4QKTA 2JVUA 3QULB 4AYFA 4XNDA 5ABZA 1ZCRA 1QVOB 1BOGB 4UQ3B 4B41A 3A4DA 3ZDXB 3FCTB 4ZPTA 3UN9A 3VG9C 4G8GD 5I1AB 4Y2LA 3QUYD 4W9DC 1KCVL 4LEBA 5CGTA 3UO1L 4NKMB 1TTFA 1YC8A 3C2AH 32C2A 4HQQL 4MJ2A 4YH6A 3O4LD 1D9KC 2YGNA 5H35A 1CDHA 2UXVA 4OF8A 4NO0A 5LGHL 1WPCA 4CNCA 1JV2B 3QJQB 2RAMA 1I85C 4ODWA 1ERNA 2FHBA 5TH2A 5LGJA 4JCMA 2WQRA 3VFRA 4WI6A 3LB6D 1B0RA 3FSWA 3F65A 2OMYB 2AVGA 1FVEA 5J6SA 3C6LC 5IJCA 2Z92B 5I71C 4EN2A 2KDYA 4Y4HA 3ESMA 3U4EA 4OLXH 2VDNB 3FTYA 1NFDB 1BV8A 2H0PA 3UAJA 2CO6B 3K80A 4GH7B 3MROB 3QRGH 3U25A 3FB5A 3PQYA 3S3PA 3O6KL 1JZ5A 1R5WA 2UVEA 5IHUH 1NGQH 1P0SE 3D9AL 4XP4L 2Y23A 4NJ9L 2DICA 4M6OH 3K7UA 1BAFH 2NTFB 1NMCC 1IBYA 2DBLH 3ULUL 5D5ME 3SPGA 2GITB 1X5XA 2FD6L 2D7PA 4AW4A 4QDGA 4R08A 2XIBA 3BAEH 1GZHC 4N0RA 5F7FA 2Q3ZA 4HQ1A 3HRPA 1YN7B 4TRPL 1KT2A 3PAUA 3GSVB 2YQGA 3O6NA 4K7PH 4PJFB 1LEGA 1HH6B 5DHXB 5E9DA 3SSGA 2BIQA 2V3DA 3DX7B 4K94C 5ICUA 4KVNL 2DM2A 1JPFB 2BP8B 2XXGA 3IMSA 1VFBA 4YLBA 2CNYA 3F7VA 5H4ZA 4P5TA 3DX6A 1N26A 4GW4A 5MHSE 3CIGA 1A6UL 2QADB 5JHDE 4PRIB 2V17L 3CFCL 2ZNXA 4G5ZL 4Z7WE 4AGLA 3ILQC 3GMRA 2B2XH 2Y36L 2L7JA 1K6QL 4UIKL 5IMLA 3I6SA 2AV7A 1HS6A 1U8CA 3B7SA 2NR6D 3OHXA 4OCLC 3DJSA 4X7CC 4P2QB 4N3UA 4ELKB 5KWYC 4IMLB 1T5WA 2FCBA 3AVEA 4X7FC 1JGLL 1AXTL 1AD0A 2AVFA 2F58L 3EJJX 5BNXD 2J8OA 1ZJAA 5LB1A 1R6VA 5D1QC 5KYNA 1AJ7L 3QC5X 4NNPL 1KPRB 5EIVA 1UWFA 5AFAA 4E5XA 3VI4E 5LQBH 2AJSL 1OAXL 5KVDH 4IRSB 1BP3B 2BW5A 2XTJC 5FA3A 3U0PB 3U2SB 1EUUA 1K8DB 1LO5B 4L29A 4HXBL 4XHJD 2GI0A 4FFWC 1OT4A 4R6UA 3WEXB 2XWBA 3MRFB 1MHHB 1QRNE 1CBVL 3HR5A 4APXA 1V7MH 1A14L 3T8XA 4MJID 4X5WA 2IG2L 4R2GD 4YBQD 1X5ZA 1N6QH 1NCGA 3EHBC 1KCSH 2NYZA 2BHFA 4QXGL 3VQ2A 1XF3A 3UZEC 5I6MA 2QQLH 1NCOA 5HVGB 2PO6D 5CJQL 4NUQA 3MBWB 2BLFA 3O45A 3JWDC 1GHFH 1JGDA 5AZ2L 1V3LA 4LPCA 3SGEH 4OJDH 3EYQC 3K1KC 1OCOB 2COVD 1CR9L 5C09B 1L7TH 3G9AB 4EIZC 1RPUA 1T2JA 2EDLA 2HJFB 3SBWA 2ZXWB 4WTZA 3TV8A 3OX8B 1T20B 4JZJC 4PYGA 3GRGA 4PRAA 2AV1B 3WO4B 2A9NL 1H0DA 4XTRD 2N56A 2PMZA 3UYPB 1TQUA 5C0CD 4U1JB 3D4GA 4HUCA 4M5ZH 4W9EC 2EXWD 2HA1A 2D4DA 1H6UA 1R75A 2HPOA 1FFPA 3KLSA 1DQQB 1CICD 5FO7B 3WENA 2C9QA 1R3JA 1YN6A 3CC5B 1VZIA 4GAJL 4R7DB 4GRWE 1UH4A 3QE5A 3GYRA 4ZX3A 1RURL 5CWSA 4BDVA 2Y1VA 4WRLA 1LO4L 3DOIA 1A6WL 2AC0A 5DQDL 1Q0YH 2BH0A 3T77B 4DW2H 3O8XA 2ZKYA 3PJSA 3PF2A 4JY6B 5JORA 5GS1C 1FO0H 4XVUC 1T1ZB 5AENA 3I3DA 4Z78A 2HVJA 4PJ7B 3LKOB 2XA8L 3VD5A 1S6NA 4HU8A 2B77A 3WN6A 2A74B 4WWKD 3P30H 1QRKA 2OMNA 1E5YA 1UC6A 5E8PB 3ZE2B 1KULA 2GC7C 4OZHB 5DI8A 4G7QB 3REWA 1KYOJ 2A6JB 2JJUA 3BWSA 4L1SA 1J8KA 5DRZA 4D7PA 1PG7X 3SE9L 2WTRA 3GIVB 5I23A 5K5YA 5DLML 3L3OC 3BUIA 4KTYA 4ORZC 4DVBB 1E6OH 4NAQA 1FG2A 1F4HA 4A55A 3KHQA 3QA3B 4PLJD 2PTTB 3FSVA 2IWEA 4HUUB 2YEQA 3D50A 4NRXB 4H5SA 1IQWL 3I9AA 2ZWLT 4IJTA 5FGRA 4KUCF 3RVUC 4O00A 3CVHL 1FE8H 1JZGA 1OGTB 3WAJA 1YRGA 3VXRE 3B2VL 4ZRGA 4ZMNA 5JPNC 1UWGH 4N8VG 1KG0A 3VTTA 3RPIA 1J0ZA 1CU4H 3K71B 2YUXA 1HZHL 1PLBA 3KEDA 2Z9TA 3RIZA 3TVMD 1XZ0B 1P84K 1UQSB 1XR9B 1IARB 5JIIA 4UTAA 2AXFA 6FABH 1OALA 2EYSA 3AREA 4HALA 3CX5J 5E5LA 4LLDB 4XB8A 4R5DA 1F90L 1LWRA 2Y6TE 4QHMA 4JFQA 4PRPA 2LTQC 3MPCA 4LSRL 3HG5A 1RLBA 1R3KB 2DI7A 1QO3B 1Z3RA 1FC1A 4G6JL 5DYOB 4WYKA 4ZOCA 1LP9B 3DX1A 2JKNA 3VXMA 4K5OA 3EJRA 5KS9B 2PR9A 2VTFA 1NFKA 4MQ7B 3Q44A 1UGNA 5GGUA 4FNTA 3R19A 3MUY1 5IFJB 1RJZA 3ZHKA 1OCZB 3FQXB 1M6OB 5AKVA 3RFRA 2R0KL 3E6JA 1OOWA 3OKDB 3GMNB 4MD4B 2XLLA 2RCSH 4P4KB 2V8MA 4Q9QL 4XNUL 1X4YA 5CMAB 1DVFA 5JOPD 5EF1A 4MQXC 3WLBB 5C0DA 2NSQA 4N0YL 4QT5B 4KO5A 1L6ZA 3ARFB 1BD2E 3C5ZD 1SZNA 1TFHA 4G8IA 4JFHE 1LQBC 5B39A 2YBRA 3L9EA 5FHAL 5I1EH 2MQ0A 2DQCH 1I1AB 2NDGA 3RU8L 4APQB 1NUFA 4TPRH 5B4MC 3I85A 3W56A 4ANXA 4UUJB 2ZOKA 1F3DJ 2AERT 4P59L 1PYWB 1JPTL 1TMCB 3TZVC 1ZT4B 4PCYA 3WJJC 4MJ5B 3WIHL 5LAXB 4DP4X 4L0YA 4OZGE 5DUMH 2AJUL 2RQ8A 1K3IA 5IREA 1KXVC 1A6TA 1CFQB 1U8JA 1C16A 2JI3A 3X14B 4JO4L 2X89D 3UTPD 4ZNEE 5FYJU 1BFTA 2F19L 2W59A 5MP6L 1X7TA 4RETB 2F8OA 3AU0A 3M8OL 4LAJH 5JOFB 1XCXA 4NZJA 5D9SB 5A3ID 2WJ7A 3WO3B 2GFBA 3KPMB 1JZ3A 3QK0A 1U42A 3SDXE 5D71H 5SX4H 4CNMA 2K4AA 2ILLA 2V5TA 4GKLA 1OT1A 2F0CA 5TFSL 2C1OB 1JZ4A 3W3GA 3UTTA 4LPXA 5LVEA 1BXVA 1VZGA 5FYJE 3MHZA 1WCBB 4Y19D 1SVCP 2WLMA 4LCUB 2NZ1A 2WLNA 1MCEA 2NW2A 1Q0XH 3NFPA 4QXWA 1QQDA 4TSAL 3WPDA 1AXSA 3RURA 4D2NA 2WWNA 1LTXA 1QLFA 1YEKL 1FSKC 4IEFB 4JRYD 5L7XH 2DY2A 3S3DB 1NC4D 1XXDC 1PLAA 4JHBA 2X44D 4U1HA 1NC2B 2F7IA 1ADQH 4KKLD 4RFEB 1AGFA 2OR8A 2Z63A 1XCWA 3QHFL 3ULVC 5D1QE 4QNPE 3MBEB 4P4RB 2WCPA 3FRUB 2HFFA 4LL9A 4HD9A 4DCQB 4YSQA 1U4FA 1HHJA 1E65A 1E2WA 1MWAA 1T04B 2OTWB 2XTJE 3GSXA 4N0UE 1N0XH 2OZNA 1DQDL 2FX9L 5CP3A 4FMZA 2NXYC 3LKRB 1E4XI 3RDTB 3QIBB 5I17B 4X6CB 3NJJA 1S8DA 4W4OA 1AANA 5B8CC 3RGZA 1DVZA 2ZXBA 3CN1A 3NK4A 3MJWA 4U08A 3FQWB 3BMVA 4RMVA 3T2OA 3OR7B 4UQ2B 1Q72L 5IESH 2QQKH 1NCCH 2EDBA 2VH5H 1KBWA 2BSRB 5EF3A 2PW2A 1KCKA 4ZFGH 3HB3B 4AH2A 3VXOA 4JZNB 1CT8A 5J12C 4OCRH 1HQ4B 4MCZA 3BKJL 3JWNH 2J8UA 4NBYB 4AMKH 4LHJB 4LE8A 5I76A 3H42H 3RI5F 4FJ6A 1AGBB 3WGVB 3WG7B 1UWEL 1CB4A 1DANT 3QFJA 2BS71 4Q6IA 1CDCA 5K39B 4UWQB 5I1DA 5KN5B 1TYRA 2Z1KA 1FZMA 4AYFB 5CCKH 3D07A 4XMZA 1FGVH 2PTUA 4ALAL 2BOBA 4ICXA 4XZUA 3ZT5A 5A16A 1MRCH 3VO0A 4ZPTB 1KV3A 2PUQT 4K55A 3JB9j 4PIBA 3VGGA 1DCLA 3C8KA 5D70H 4HUKB 5I1CL 1MCIA 32C2B 4QJ5B 4WI0A 4E9VA 4OZIE 1JF6A 5H35B 2XJKA 3LPWA 4X6DE 1RFDH 2ZD0A 1FH5L 1UASA 2DMHA 2AJYH 4XPAL 5KVGH 3TESA 1QD0A 3CK0L 5KVMC 5TH2B 5LGJB 3KLKA 3VFRB 2ICCA 5D7LA 2X87A 3IE4A 1B0RB 2PCFA 1S9VA 1FVEB 2VR5A 3AY2A 4DQOL 2ROYA 3FXIC 3CGTA 4FXTA 3QZBA 3VSUA 1UXWB 4Y4HB 3U4EB 3VRIB 4OGXH 5AEAA 2WYTA 3FB5B 3PQYB 1RIVL 4XX1E 5CJXA 2F5BH 1HEHC 1ZIAA 5I9QB 4FLHA 4LSXC 4B27A 4XPFL 2OW7A 1H5BC 4GLRI 3D39E 4PJGF 5ENWA 1WUNT 3JWOL 3TIDA 3HHMA 3OSKA 3GSQA 3L3DA 3M46A 4LFHG 5CEXA 4BXVA 5A5CA 1UJ3C 5T33L 1NZRA 4YXKH 3QRLA 1TJGL 3QIWD 4MNGA 4AQOA 2H1XA 3H0TA 1T4KA 1JNJA 1KT2B 3RGVC 3V0EA 3NCMA 3FSAA 3LZOA 1LEGB 1QBML 5D2LA 5E8NA 4WY7H 1EO8L 5E9DB 5T3XH 5LNDA 3BYYA 4P9HH 2QVMA 3S37H 1CFNA 2PF6A 5C0BD 2XWCA 2UZXA 2VMFA 4FC3E 3NCXA 2A3TA 1OPGL 3AMLA 1DFBL 1SQMA 3B9KC 3AROA 2FRGP 5D96C 3WHXB 4LIQH 1AR1D 1VFBB 2G5BA 3F7VB 5FKPA 5IT2L 3KLHD 4E9WA 4P5TB 1BZ7A 3DX6B 2FATL 5GS3A 3VXSD 3BWUC 4H1LG 4NQEE 4PS4L 2ZP9A 4CDHA 3D3VA 2Y7LA 1OAKH 4A68A 3GMRB 2EIJB 5HGHA 3EOYG 1NDMA 5IMLB 4AY0A 5I5MA 2AV7B 4KI5D 5DCCA 4JJHA 1Q9KA 2YMTA 4FCAA 5AKTA 1NGZA 4N8PA 4BKLA 1MFUA 2FO4A 2NZ9C 1QP1A 1KELH 3WS6A 1BIIA 1QBBA 2XWDA 4NJAL 4PJBA 1T5WB 4QRRD 4HWZA 1T0NA 3BDYL 1M05B 1HJBC 3NDZE 2JI2A 3SB3A 1U3HC 1TOXA 3NIGB 3HNVL 4M7JL 3PRZA 3S98A 2WY3B 3ZN6A 4PVLA 4S1DC 5CLWA 3OKLA 4E5XB 4JDVA 1I7UA 1CE6A 3UYOD 4XHQA 2FJUB 3NRQA 2Y06L 1SEBA 1P4IH 3VU2A 3W3KA 4L29B 3VD4A 2WJ5A 1JHLL 5D4QA 3EFOA 3N3EA 4FMFA 1KEGL 2XKNB 2XWBB 4JCLA 2XPGA 3UBXA 2K7PA 2OTUA 4M1DL 5B38G 1EFXA 5I6OA 1BM3L 4HETA 4L4TA 3HRZA 3HR5B 1F1DA 5CZVL 1RSFA 2K6WA 5HHME 4OI8A 2FLMA 1ZLSH 3SE4A 3T8XB 4X5WB 4YLCA 2NY7H 3KPQB 2EABA 3W3LA 1XF3B 1Y1UA 2N59A 4NZRH 3V52L 4PJHF 4U6YB 3NFSH 4F7MA 5LKNA 4O02L 2DYPB 4X6EA 4K94L 4ZAKA 1EEZA 1WZ1H 3O45B 2UWEE 4PJCF 4UQDA 4YHKH 5DJXA 4AK1A 1FNLA 4FZ8H 5D4IA 3FUIA 1H8LA 5H2BA 5JHLL 3W3BA 4J4PA 2VLRE 2VJXA 4XP1H 4JM4L 4JG1H 2WVSA 3RVWC 4NAMA 2BRQA 2WB7A 5IHBA 2WXGA 4G83A 3WIFA 2C4XA 3FTZA 3O3UN 1LEIA 4FDWA 5FYJL 4UBDD 3LHPH 2JQDA 4P8SA 3KWWA 4GAGL 4Z0BH 5G4NA 2BNQD 2EKSA 3Q8AA 4PRAB 3DJZA 1H0DB 4AEEA 3FMGH 1A66A 3TEZA 4MS8D 2WOBA 1ACYL 3APMA 4UTBL 1FNAA 3F12A 3BVTA 2HWZL 4JPQA 4U6XA 3TBSA 2N7SA 2EVGA 3MREB 1V5JA 1R3JB 1YN6B 3P4OA 1GXEA 5JHAA 3G3BA 2DEWX 4WW2F 3IMVA 4WSJA 3M18A 2JCCF 3ZHDA 2AABL 4DVRH 4BDVB 1PJ9A 3HE7D 4L18A 1F2QA 4OD3L 4MSWB 2ICWJ 2IANB 3O8XB 3PJSB 3T65A 4IOSD 2DQIL 2HVJB 3PL6D 2R4RL 3FOLA 1WA0X 4NKQB 4NZTL 3WE1A 3PWJA 4PJ5D 3IGLA 1QSED 4K4KA 3REWB 2KYIA 3ZOAA 3NJKA 4IU3A 3NZHL 5E6RB 3UTZA 5MENA 3HS0C 5DRZB 3U48A 1IJNA 3ULVE 1E0OB 1PG7L 5IQOA 3NQKA 4P5KA 4AEIL 4Y2DA 1RKRA 1FG2B 3S34L 1MIEL 1AXIB 2WANA 2IAMC 5F3BA 2F53D 4JFDB 1GOGA 1NGPH 2APVA 3JWDL 2MCG1 3UGUA 3OZ9L 4H5SB 1SVBA 1UD4A 3NA4A 3VVWA 3ARGC 1IC5H 2JE8A 4LI1A 5ES4B 4M4RB 4QRSA 1OTUD 2X70A 4C4UA 3RLSA 1EV2E 3I9GH 3N40F 1AYOA 4MBRA 1KG0B 2AJZA 2EE0A 5FCUH 3IDUA 1VACA 3QIUC 4ZS6C 2VW4A 2X12A 4QJ4B 3ZYIA 3FBKA 3AABA 5CM1A 2OSYA 5EC2B 1SXZA 3RWCA 4Y4KA 4HEPG 4EZLA 4R26H 1BW8A 1ZGLA 1ZVHA 2XN9E 1DLFL 2GJ6D 3RVXD 3GXIA 1TJHL 1KFAL 2AXFB 5EUOF 4M1CC 3R4DA 4F7TB 1E2VA 1QTYT 1LMKA 2EYSB 5G55A 3AREB 4WUUD 5ADPL 4QHMB 2NY5H 3Q48A 4JFQB 3V4PH 4PRPB 3VTMA 2WQXA 2Y72A 4Z7AA 5IEHA 4HWEL 1EEUA 1A3LH 4FX5A 1KYAA 4Q3IA 2ZXAA 3O6FC 5CD5D 1RK1A 1EZVY 5IKCB 4MNQE 1TVBA 4HJJH 4PJXF 3L13A 3GI8H 3VXMB 1AKPA 4ZW3A 2O6PA 1C12A 3TEUA 4H20L 4W9HC 2IPUG 4HZ1A 2OL3L 1K85A 1NCWH 1AVAA 1K4DA 4HPOL 1RJZB 1FYHB 1DP0A 3B83A 5KYYA 1K3ZA 2IJ0C 3IXTA 1JPEA 5EOCJ 1JNNH 4ODSL 3BT2H 1JVLA 2BSCA 3U7WL 2P49B 4G6FB 5GZNC 4OVVA 2RACA 5KJ7E 3UL8A 3PAYA 1OB0A 3DA0A 1E3XA 5KSBA 1SOKA 4PSRA 1DVFB 4DP6X 4ARNA 1KUMA 2L7QA 3WY3A 3A21A 1BMZA 4G8IB 4JDZA 5LBVA 5B39B 3BH9A 3Q0HA 2GEQA 3DO3A 2PPEA 2QHRH 5BMFH 1RU9L 4NENB 2ZWSA 4NC2B 1OHZA 2IMNA 2ZOKB 1XFPA 4J3OF 4PUBH 2XBZA 1TT6A 4LSQL 2IAAC 3PGCA 2WWKT 2E7BA 4NGHL 1U8JB 1C16B 3WJMA 5GGQL 4NO5A 1XKUA 1WZLA 5AOMA 4PJEF 2GBTA 4H26A 3BH4A 1A7NH 3CLFH 3P2BA 2K8MA 5I16A 3NGBB 1FH2A 1RUAH 1PAZA 3QUZD 5EORL 2YA0A 3QXTA 5CGYC 3CMOH 5DJDB 5B0TA 4NPYA 5DEGA 4TLUA 2R56L 5IBLC 3GBDA 1ZGLM 1JDCA 3F7PC 1H9VA 4JFPA 3DVNB 4Q7DA 5EIIG 3NTCL 4KKAD 5CCJA 5GHWH 2UZIL 1Q0EA 1JDDA 1FO0A 3CDCA 4P5MA 4FNLL 4CSZA 3QZWA 2P1YA 5TD4A 2VXSL 1RD6A 2CPCA 4HIEA 1Z5HA 4ERSH 2NW2B 3NFPB 2VAAA 1QQDB 3IDXL 4YBLC 4X8JA 1WQVT 4YQXH 3KPOB 1QLFB 4P57A 3V0WL 5KG9A 2MHAA 1SDDB 4U1HB 1ZLUK 3B9DA 1BVKB 1FFRA 4FKEA 3TM6A 1Q1JH 1ZPUA 1AGFB 2P9RA 5CMPA 4PB0L 1KCLA 2F61A 1TYJA 3F7YB 2HFFB 3H1ZA 4PY7A 5E8DL 4AGMA 3PNRB 5I73C 4O2EA 1PZAA 2Y69B 3WV0A 3ZE1B 4TTGA 3GSXB 5TQ0L 3BH8A 4LSSH 4GRLC 5J3HD 4N1CA 2LR4A 4NFDA 4KNGA 4J3OD 1C5BH 2F18A 4RGOL 1Q38A 4WNSA 4LCYB 4HJTA 5I1JL 4DN4L 2YKLH 2ZCKH 1KBBA 4KZCA 3IU3B 1NCAH 4IOFD 2BS8A 2DQDL 4FXGC 3MLWL 2VLJD 5AAMA 4UQBA 4K23H 5E6IA 4AH2B 2IBZY 3VXOB 1CT8B 2BM3A 4FQ1L 5EN3A 3ARTA 1JZFA 4MCZB 3MZTA 3TCXA 2DYRB 2DQJL 3D2UD 1AQKH 4MYWB 5I76B 1NUDA 2H2SC 4DO6A 1MFEH 2D3JA 3CHSA 3A67H 3U82B 1CLZL 4KKBD 4M00A 4P2OD 3QFJB 3ZHNA 3CFEA 5HGDA 1OZNA 5GS2D 1FZMB 1FVDA 4MTMA 4D8OA 3IBEA 3MJ7A 4HUWA 3GHPA 8PAZA 1YYLL 2BOBB 4OKDA 5A16B 1VESA 2OJZL 3PU7A 2J12B 3RFSA 3H85A 4CILA 1BJ1H 1H8NA 3U2IA 4XOEA 3VE0A 5HHVH 3A4FA 5IBTH 2DTML 4YFLI 5I15L 1CDIA 4L8CA 4ELMF 3TNNA 1HHHB 2N4IA 4M1GH 4W6WB 5D7LB 1NLBH 2PCFB 4XXWC 3KH3A 2AQRA 3ECWA 1AG0A 3QO1A 2A0LC 1A8ZA 4AENA 3ULVL 2Y7OA 4KROD 3A4EA 1N64H 2WV3A 4PBXA 3S8FB 5I30L 4JKPL 3P0VL 3AWEA 3KVDD 5AW0B 4A2HA 2OXGA 3QCUL 2VZ1A 1IM9D 4ZUWA 4M3KB 4ZTPL 1CF1A 5ENWB 3RHWK 2WWMC 2ED7A 3H2QA 4N8CL 4XPHH 3BKYL 3TIDB 1DQVA 3ZDXF 3N1PC 3GSQB 3D06A 4JCWA 3L3DB 3SYOA 5CEXB 1B3JA 2H1PH 1G7MA 5BJTA 4YFEA 2QSTA 4MB4A 5BRQA 4A7QA 1TQBB 3PUCA 5DEZA 2J4WL 4CL7A 2E74C 1JGVL 1U41A 2BEXA 3CFJA 1IBDA 4H7VA 1QR1A 1T66C 4YR6A 5D2LB 5E8NB 4G8FA 4LDOB 3V9EA 3RILA 3SPVB 5DVMA 4RFOL 5EOQH 4GQ9H 4V1DA 3QDGA 1YO4A 2UZXB 4L3AA 3VH8B 5L2KE 3ZDWA 1ED3B 2Y1ZA 2BSDA 2OSXA 4AYDC 3TH4T 5F6IB 4LLWA 1KB5B 2ENQA 2G5BB 4I48A 1F02I 4U1MA 5FKPB 5E94A 1OOKG 4JHZA 1NFDF 1BZ7B 3DV4A 2PXYC 5DT1L 4NDMA 1J12A 1I4FA 2OTPA 2PWFA 1A6VL 2AMUA 4IBUA 4BSUA 1J1OL 4RMUA 3D3VB 3ELAT 3EJTA 1I3UA 2B1HH 3LN5A 3SQOH 4JO1L 1NDMB 5TF1L 1TVDA 3K4ZA 4E9XA 1NGZB 2K3TA 4YDKH 2FO4B 3VMNA 3DZEA 5IIEB 2VDRH 4ODTH 1BIIB 1ADQA 4GG6F 5IJKA 4I5BB 4JVPA 3QPQC 4HWZB 1T0NB 1WS8A 4YDZA 3X3FL 2AW2A 2XWJA 3BVUA 2OCJA 4OM0L 4XP9L 2JFCA 5E2UH 4H4NA 4YO0B 2ZP0T 4LXFA 1HKFA 2DKSA 1NGXA 4OQTL 3UL4A 3ZZQA 4W1TA 5I6PA 2WXFA 5HDBF 3OKLB 4BH8B 4ABQA 1AE6L 1I7UB 3FO0H 1CE6B 4JDVB 1VLXA 4C57C 4KUZH 2OMTA 5TE6H 5F9OH 1SEBB 2WO2B 4JKLA 5ICYA 1KCBA 1Q9WB 3HE6A 2HLAA 4PVNA 4ERSL 2CLVA 2X1QA 2Q3XA 3EFOB 5G4OA 1H8OA 5INDA 2XPGB 2P5PA 2OTUB 1KLUA 1EFXB 3U36A 4IJ3C 2EICA 4FQHA 5BW7A 1EANA 3DK2A 3HRZB 2O1AA 3TWCL 3HMXH 3WMQA 1AMYA 3HUJF 4NSKA 4M56A 5JZ7C 2PYFA 1D5MA 3F83A 4GUPA 3IFPA 1FBIH 5KOVC 2ZF9A 1ESOA 3MLUH 4GAYA 4WNJA 43CAA 3DX2A 1K8IA 2VR6A 4F7MB 4DEPB 5IVXA 5D7IE 2EXSA 4QRTA 4GBXC 5FFLA 4S1QH 4X6EB 4NFCA 4ZAKB 2WO3B 2BSBA 4L2LA 4KJWC 4X5RA 5DJXB 5FLUA 1J8SA 3MJ6A 4BFJA 3MV9E 1WZKA 1W72L 4M93B 5H2BB 2B16A 2YPVL 1BZOA 4O4YL 1QATA 2DYSB 2EDTA 1HXYA 2G75A 1XF2B 3OMZA 2ARJQ 2ENJA 3RWHA 2CUAA 1L4IA 3GXFA 4RFNB 3RX7A 3WIFB 3IGKA 4IBSA 5HVHB 2VB5A 4XWGL 2WPGA 5DMGD 5MEPA 1ZTXH 4NP9A 4XCYA 3KWWB 4PWJA 4AL8H 3SOBL 2EKSB 3U0WL 3VMPA 4WSKA 1ZE3C 3FSZA 4PJ9C 5MERB 3WFEH 2KHAA 4G8AA 1HEJC 1BA9A 2AXWA 4M6MH 3VGBA 3F12B 4IBQA 5J89A 3HZVA 2OW6A 3TBSB 1CD9B 3ZRCC 4JJ5A 5KSUA 3SDDC 4OCSH 1XSKA 6TAAA 4EUPG 3LN9A 1I7TB 4LSVL 4DP8X 5DURD 2UZPA 1RH8A 5L6YL 5DZ9A 5C07A 4G3YH 5HD8D 1RHHB 2WKOA 4Z7NF 4PRID 4N1EA 4LCIL 1WFUA 3ALWA 4KXBA 1NAKH 3S35L 3SGDH 3ZDYF 2KBGA 4KT1A 1BFVH 4HIXH 3STZA 1MY7A 3MGOA 3V6ZA 3PWJB 3CZNA 1DBKH 3OJAA 2BDNL 4G9FE 4P2QD 3LQZB 3HG3A 1PX8A 4IU3B 2B14A 2Z64C 4XBEH 3KYKH 3UTZB 2EECA 4F9PA 2V6HA 1ZK9A 2CO3A 4LVHC 1L9SA 1FFNB 4KO7A 4Y2DB 1CXLA 2H5UA 4MQXD 1UZ6F 4N6QA 3VRJA 3SGKA 4BSVA 4FKKA 1QWUA 4BBWA 5EBMA 4JFSA 1F45A 5F3BB 1JGUL 5GGVY 4IRSD 2C9SA 5I1HH 5D93C 1BSIA 4WO4C 3CFKA 1KCWA 3G6JB 2VLRD 2CXGA 2QKIC 2EZ0C 3D08A 4JPVH 3T4AC 1HU8A 2X70B 1P4BH 3J2PA 3ZMEA 5JPMC 3EGXB 3LNEA 4NM4H 4JM0A 1TJIH 2O5XH 2AJZB 5EZOL 1JWMA 1VACB 4PJ7F 1JK9A 1EHKB 1JI1A 2QKSA 2YZ8A 4OGZA 5BZWB 3RIFF 5J13C 3T2QA 2HXAA 5F0JB 3RWCB 1S3RA 4HSCX 3IKCA 3HG2A 4H8WC 4Y4KB 3ZE2F 1CK0H 5IMMB 4UFRA 2ZAIA 3EG9A 4EQ2A 3CFQA 3BQUC 3QPXL 2IWGA 4B96A 1FVCB 3TGXA 4UF7C 5JHBA 2EDYA 4ZO9A 1CGSH 2MPAL 4R0AA 1OTMA 2CA4A 4XOBA 3PE9A 2Y0SA 4ZFOA 1DBBH 4BHUI 1J5CA 3AM8C 2ADIB 3BZ5A 3M1CA 1GGCL 1TVBB 3GBML 1ITBB 2ADGA 2HX8A 1XCQA 5C09D 4WCYL 4ZX6A 4HIIA 5ADOH 2Y2WA 1IM3B 3V4UH 4WFGD 3ML8A 1AGCA 2ZXCA 4FQJL 1U58B 4ELDA 1CGUA 2CCVA 3INOA 3IS1X 1J0IA 3UYRL 1K4DB 2GK2A 4HT1H 3MRBA 1GZPA 4FAAB 5KYYB 2NNXA 3IXTB 1EHLH 5TPWH 1OAQH 1PKOA 5A2BA 4QHKI 1HL5A 2KQNA 4H40A 5ESQA 1X3DA 1HSBA 1H3TA 3ILPA 4GRMA 2YQBA 5KSBB 1MFBH 4P46A 3OGKB 1N68A 4YN3A 1IBGL 1XMWA 1XCDA 1FN4A 1LILA 4IGBC 4JDZB 4N87A 4EAEA 1ACCA 2ZSWA 5CNHA 4LP5A 5DZPA 4DP0X 2L04A 3UDWA 3BIKA 2NXYD 2X4OA 1Y18B 4OIIL 4EI6A 1ADWA 1I9EA 1VCBC 1IMHC 1B6DA 1LP9F 5EO9A 3X1FA 1Z5YD 2G2RA 2NTSP 1I1RA 1QKZH 2VDKB 4RCWA 3HVNA 1SYVA 2HMIC 4NUJA 5ANMB 3FUJA 3H7BA 4NO5B 4I1NB 4OGQC 2YD0A 4JW3A 1U21A 1WVZA 4Y5YC 4H26B 1R19A 3ZVVA 1YA5A 4A2GA 1E6JH 4ZOEA 3VGAC 5CJOH 2QPSA 3JSSA 3T8VA 1BGXL 1ETJA 3VFMA 5AVZB 2NYKA 2QVKA 2FLBT 4NN5C 4NPYB 4RQQB 2OZ4H 2VXUH 5ESAA 5GQBA 3IETB 1EAOA 5IJBA 1C8QA 4XCCL 4PU2A 2DAVA 2OR9L 5FHBH 1J8HA 1R17A 2XKSA 4G80A 4AUYA 5DR5H 2EUXA 4PHZA 3QZWB 1Y6MR 2WYHA 3CBKB 1F56A 2DQEH 5KSAB 1CDGA 4RWTC 3LZFL 4WKZA 2VAAB 5EMYA 4PJGE 5GQRK 5IW3A 4K9JA 4X8JB 3AWGA 4A7GF 5LDUA 3QHZH 1TQCB 1QSVA 2CHWA 4P57B 2ZYSA 4LOFA 4N1HB 3JV4B 5KG9B 2MHAB 4HBCH 2J6EH 1T21A 3NJMA 4R4FH 3LS4L 1J9SA 2WXNA 4P2RE 4XVJL 3WFCL 3NSYA 2VDQB 4H8UA 1KYOK 1JPGA 3OBAA 2Z8WC 3IDJA 1ILSA 2FSDA 5E70A 2GY5A 3FRPB 3W39A 5I18L 4JVWA 2RALA 5HY9A 4N2NA 3IN2A 4PRHA 5C70A 1FCCA 4JN2A 1XGYL 3KPLA 3GLDA 4MA8H 5EU4A 5EWIH 4MA1B 4FI8A 1TXKA 3RJ0A 2P80D 4HEMA 1L9RA 2APWA 4F9LA 3FFDA 5E6IB 4JN1H 4DGVH 3EUUA 3RGVD 2CAKA 5D7SH 4JDTH 2J88H 3HKFA 2JI1A 4YZFF 5E2WH 1KC5L 4WFFD 4P4KD 5IW6A 5BRZE 4ECNA 5JMRA 3DX4A 5FO9A 3QZLA 4U1GC 4YL9A 3HEIB 4LCWA 3V4PA 3CFEB 1FA4A 4J0MA 4UZSA 3ARFD 1EZSA 4U1KA 2JTYA 3CX5K 1KGWA 1QNZL 1FVDB 4NB7A 3MJ7B 4HUWB 4WZ9A 1I1AD 4XNXL 5DXWA 1EA9C 3P3YA 4JGMA 1UXSA 2F1AA 3QJFA 4A6YL 2BP5M 1WZAA 3W3JA 3V5DB 4X6CF 3WEBA 4X5XB 1G7LA 5KYWA 1V27A 5AZ5A 4PCTA 1TENA 1LK3H 2H3XC 4WI9A 4ZQTA 4L8CB 1KCVH 4OCWL 3TNNB 4WK4B 4GINA 2Q2LA 4AG4H 1MVUA 2AEPL 4H88L 2IV9A 5LGHH 3L45A 2OQJA 1YMHA 4OCYH 4J3UA 4J23A 2AITA 3V4VL 3ZL2A 3T4YA 2RA1A 4XAWL 3O3BA 1DUYB 1X9LA 1RUQH 1HAUA 4S1DD 1AZBA 4LLVA 2MMXA 1W8AA 3ATEA 4N2IA 2QT6A 4HH9B 3RNQA 1NMBH 1N8ZB 1WGOA 2VXTL 4J3XA 4CC4A 4PJCE 3O6KH 2FHFA 2G5UA 4XP4H 3PDOA 5K9JL 2MOGA 4XN5A 5DD3H 1Q90A 4PRBA 1G7MB 1LE9A 1G6RL 2Y7QA 3BN3B 2GTZA 1NGWA 3QWOA 5DS8A 1JN6B 2FD6H 2H0EA 3CFJB 2WNKA 1QR1B 1XWVA 2DF3A 3QQNA 3UC2A 4G8FB 1NC2D 1TZHA 2MCAA 4TRPH 1QPPA 1LO0L 4JRXA 5C6TL 4V1DB 4XMLH 3VWJB 4GQRA 4MZIA 2WBXA 3FAXA 3DHJA 1F42A 4Q2ZA 2D3LA 1KB9J 4KVPA 1AFVL 4WI5A 4LLWB 4I48B 4AQAA 4U1MB 5C08E 5E94B 1KGIA 5CUSH 5INCA 3SYCA 4RH4A 4A2EA 2CDEA 3N1MC 4NDMB 1I4FB 4RZCA 5D4HA 4XO8A 2JCCE 3RDTD 3QIBD 4YHNA 4LVNB 4Y1SA 1P1VA 1F3RB 2IO5A 3GNML 3TEWA 1A6UH 3UH8A 4F2FA 4U09A 3GJEA 4E9SA 2V17H 1ZHLA 3CFCH 4HX1A 4G5ZH 1BQHG 2Y36H 3UEQA 3S4SA 1WITA 3KPSE 1K6QH 4UIKH 2P43B 4EMZA 3FPYA 3MRQA 3U9UA 5FR3A 4K8RC 3HB3D 5F7UA 4O58L 1K5GC 1IZJA 2MCMA 4QRQB 4OFDA 5AWNH 4OV6F 5ICZA 2OMXA 1ZA6A 3MO1B 2VAJA 1UXMA 4DPBX 1ZVNA 4QXUH 1PZCA 2F58H 4C83A 4JFXA 2E47A 5LGYA 1NEZA 3OLIA 2CWRA 1UCBL 3KJ6L 1HZLA 4XSQA 4OJFL 3PV6A 1TLKA 1AJ7H 1DVXA 1OGAA 1X6NA 2J3SA 2OMTB 2VW6A 4JGUA 3T0VA 3HE6B 5G5DB