1XEUA

Crystal structure of internalin c from listeria monocytogenes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
263
Chain Sequence
ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords internalin C
publication title Structure of internalin C from Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion
total genus 79
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xeuA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xeuA01
1A9NA 4LSXC 3WPHA 4AQ1A 2Z82A 4KNGA 3RGZA 1OZNA 4FDWA 4XOSA 3O53A 3VQ2A 4R6AA 1QYYA 2Z81A 5ICUA 5GQRK 1DFJI 4CC4A 4BV4R 1XKUA 4Q62A 5AWDA 4BSRA 3ZYJA 4BSSA 3CIYA 1XECA 1OT4A 3ZYIA 4RWTC 4J0MA 3RIZA 5B0NA 5AZ5A 4V2CA 3OGKB 1WWLA 2RA8A 3ULAA 1M9LA 2OMTA 3CIGA 2ID5A 2Z7XB 2P1QB 1PGVA 2Z63A 2ASTB 4ECNA 4IM6A 4RCWA 1G9UA 5B0TA 4R09A 1NM4A 2R9UA 3G39A 2XWTC 3ULVA 2Z7XA 3WN4A 2V70A 2OMWA 2P1PB 3ZYOA 4J4LA 1YRGA 4Z79A 3RGXA 1KOHA 2O6RA 2OMUA 4FHOA 5GMFA 1Z7XW 2ASSB 2Y5QA 3REZA 3M19A 1IO0A 5IJDA 1OOKG 5CMPA 5FTTB 4V2DA 4XSQA 2OMXA 3UL9A 2Z66A 3RW7A 2Z64A 4R5CA 3E4GA 3WPGA 1O6SA 2RA1A 4P91A 3KJ4A 1P8TA 3ZYNA 4C2AB 2A0ZA 4PSJA 3W3NA 3FXIA 1JL5A 5LFNA 4U7LA 3DZEA 2WFHA 5AWAA 4L3FA 4LSXA 4R58A 2WQVA 1DS9A 3G3BA 5GS2B 3JB9j 4Z61C 1KOOA 3BC9A 3E6JA 1SQ0B 1U0ND 5GMHA 1D0BA 3C6PB 1FO1A 3BCFA 4B8CD 4MN8B 1K5DC 1LYQA 1XWDC 1W8AA 2FT3A 4QC0A 4CNMA 4GT6A 4CP6A 4AY9X 4QXEA 5CMNA 2OMZA 4LI2A 4U09A 4CNCA 3CVRA 4LI1A 1ZIWA 2JE1A 1GWBA 3SB4A 4Q3IA 3A79B 3WPFA 2YA1A 1XEUA 2ELLA 3RJ0A 4LSCA 2O6SA 4FS7A 3ULUA 1FT8A 3UL8A 4G8AA 4R0AA 4M7EC 4MQWX 4PQ8A 1P8VA 1O6VA 3UN9A 5AWCA 4C2BB 1FS2A 2BEXA 4QBZA 5AWBA 3RFJA 2C9PA 4PERA 1A4YA 3WPBA 3W3LA 5B4PA 4LXRA 2V9TB 2CA6A 4EZGA 4Z64C 4Q3GA 1OTOA 4L3AA 3G3AA 3OGLB 2JQDA 5D3IA 4LSAA 4LXSA 2O6QA 4KT1A 1M42A 1M10B 4WP6A 5HZLB 4KXFB 3W3GA 4R6GA 2RR6A 2Q4GW 2Z62A 4Z8GA 4U06A 4FMZA 2V9SA 3FAXA 2OMYA 4WYKA 2OMVA 1K5GC 3G06A 2WQUA 2IFGA 4CC4C 3VQ1A 3M18A 2WQXA 2XOTA 4Y61B 3PMHG 3RW6A 4NKGA 1OTNA 4GLPA 3BCDA 1O6TA 1H6UA 3P72A 2P1MB 1P9AG 3RFSA 5GMGA 1OTMA 4HQ1A 4PEQB 4R07A 4I6JB 2C9QA 4U08A 1IX2A 4ECOA 3TSRE 5A5CA 3W3KA 2UZXA 4AW4A 3WPIA 2WQWA 4PKIG 2P1OB 4P8SA 4Z94G 4XGOA 4R6JA 4NKHA 5IJBA 3G04C 4CILA 4TZHA 1M0ZA 3WPDA 3BZ5A 3GOZA 1M9SA 4M7EA 4ARRA 5IYXC 3OJAB 4R5DA 2JE0A 4H09A 4FD0A 1LTXA 3E2JA 4K17A 2Z65A 4R08A 1OGQA 3WPEA 3OGMB 2UZYA 3E3ZA 3C6NB 3OJAA 2P1NB 1FQVA 5IJCA 4OQTA 4YEBB 1DCEA 2C9RA 4R6FA 3UL7A 3W3JA 1H6TA 3O6NA 3C6OB 4FCGA 5HDHA 3W3MA 5GS0A 4RCAB 4BSUA 4ARNA 3RFEA 3WPCA 1XCDA 2BNHA 4UFRA 3FAWA 4V2EA
chains in the Genus database with same CATH superfamily
4OJFL 1LO4H 2V7HA 4FXKC 4ZS6C 2VR5A 5I1JL 1FJ1B 1QASA 3NVQA 1P1ZB 1BAFL 1QAWA 4LKXA 4LO9A 4R7VA 1MHEA 1RL1A 2DQEH 4XB7A 4XOBA 4G83A 2VXQL 1MPAH 4KRMB 4IGBA 3U83A 5FO7B 3MRCA 4KKCC 3HI5H 3TIDA 2KLSA 1EAJA 3J07A 2WTRB 4APXA 4L4TA 5KSVB 5SX4I 2DBLH 1DFJI 2J73A 1K85A 3EJTA 1FYTB 4MQXC 4JFTA 4UZSA 1XKUA 1CGUA 3KPLA 5EO1A 3UAJC 3DMMB 4YK4C 1AGBB 3U9WA 5GGQL 2P49B 3CZNA 4H88H 4S1QH 1I1YB 5I71C 3LQZB 4DGIL 4DK3A 4OCYH 4G8GB 1MVUB 3TZVA 1KLFB 3DVFA 4HUWA 4M4PA 4Y16A 4ZAKB 3H56A 4OFYA 1N4XH 5D5MB 3IK2A 4ZUTA 5AVSB 2NSQA 4XBPB 4F7EA 1TU2B 1X5HA 3LH9A 1TJMA 4MXQD 1D5ZB 2MJWA 1BJ8A 1IGIH 2OL3B 3RWEB 2R56H 3KR3H 1D5MB 1MQ8A 3RIZA 1TCRA 3BWZA 3VXNB 1OCWH 3BKMH 4EDWH 4YXLL 2WZ5A 5C08D 4LT7A 2IADA 5AW1B 1Z9MA 3FZUC 4P57A 5IJKA 1FN4B 2CKNA 1QLFA 1FC1A 2HUEA 4A7QA 4UM8B 3QDHA 1RHHB 3G5YB 1NUGA 3FF8A 1OT2A 4YSTA 2HT2D 5LG1A 1AC0A 4EF3A 1UURA 4WWOA 5B3JE 4XNXH 1WISA 5JA9A 1UG9A 2K8QA 3NFPB 5JHDD 3T2LA 4PLJD 3UMTA 4HIHA 2OQJA 5FR3A 3R8BB 3GLZA 2HVJA 3GT6A 4OZIB 2B39A 2XWTC 2IPUK 3L4UA 2X4UB 2WO4A 2CZNA 1R3KB 2JFCA 2YQ2A 3MRDA 1TMCB 3L3GA 4UV7H 4RGMC 3HMXA 3PXHA 5BV7H 4U7SA 5FA4B 5CCHE 2B59A 3Q7JA 4C56B 3MPCA 3STLB 3G9AB 1V7NL 3GPEA 2M1KA 3AXLB 4E9RA 2FK9A 1XB6A 5I1LB 1YEJL 4P99A 1A5FL 3LMJH 2YMTA 5CJQL 3C5SA 3SQOL 4BXSV 3Q8FA 2OMUA 3RDTD 4WW2B 1XGUA 1OAJA 3DVIA 5I15H 3Q5TA 3H6AA 4IMKA 4L3ED 3S48A 5SWSE 2FBJL 4NC1E 4WY7H 1JWMB 3D18B 5GGSA 3V5KB 4WFGE 5CUSH 2ICWJ 1RJZB 1P9MC 4X8CA 4PG2C 3SO5A 5F0PB 3BN9D 5C09B 4M1CD 1N5AB 4OGYH 4DUXA 5DZLA 4DPAX 1BV8A 1KFGA 3ALWA 4ZNEE 4A7SA 5CP3H 2XYBA 4O51A 1JXKA 3BH4A 2XVKA 2OKMA 3TASA 4P9HH 3K0WA 2L0DA 3ULUL 3Q8CA 4ZW5A 3X11B 1MDAA 3O11A 5C0AA 3C2AL 1V3JA 2RA1A 4JHAH 3RBSA 1NANI 5DJ2A 5HYSB 2I32A 4TVPD 3PWLB 3MRRB 1IKFL 3K1KC 4E36A 1F4WL 2ZUQC 1O5DT 5FECB 5LGJA 1KPVA 3ARFA 5ELIA 4EJ1C 1E8XA 2LV4A 1XAUA 5GXBB 1PIFA 2P4AB 3JXAA 1I4FB 4KXZI 4XCEB 3VXUA 4UTBL 3MROA 1FA4A 4ODSL 4GAJL 4BE5A 3QIWB 4F33A 3QUZA 1MIEL 1D5XA 1OM9A 3SDDC 3T77A 1KTLB 5EF3A 3LKOB 3L9RA 1EAOA 4XC3H 4YFLI 4A2HA 2ZCLH 2Y6SD 1MAJA 5GSRA 4OTXL 4NPYA 5DWPA 5IMOA 2VN6A 1JF5A 3TJHD 3BQUA 2O30A 4QGTA 5AVRB 1QLRB 1IEAB 1MVFA 4B8CD 3OX8B 4QYOA 4A6YL 3GHEL 4MA7H 3FUIA 4WWID 4J3XA 4HMEA 1GJIA 5BO1L 1MUJB 3MUY1 5HY9B 3TFKC 3VU2A 1OQOA 5FO8B 5IMMB 2X70B 4KX7A 4MAYB 4OD1L 2WJ5A 5GRJH 5E70A 2HTKD 4FQXC 3MRNB 4F8QA 4UDUA 4KZDH 2CIIB 4NNYB 1Y6KR 4WI5A 3N5AA 3MV7D 4LI2A 3SYOA 5K69A 1TETH 3SDYL 4FG0A 2CMRH 5TE4H 1JMZA 2VXSL 3IYLW 3VRJB 4BZ1A 4C54A 2XFGB 2XA8L 2HCZX 4WWPA 4MWFA 4LBEA 1YVLA 1QBLH 3CD4A 3L3HA 3O3EB 5FOBA 5I66B 2WNWA 2FWOA 5D96B 1CR9L 3FS9A 4OLYH 3AU1A 3HI6L 4OJYA 5IJBC 1NIFA 2ZX8A 1Q1PA 5EULV 1U21A 2K6WA 2H1PH 3PQYB 3NSDA 3CX5K 3L8QA 4F93B 5EZOH 5TQ0L 4FQQB 2XJKA 1N3NB 3OR7B 1AR2A 2WXHA 2DLEA 2NY6C 5L8JB 4AMKH 3VXPA 2EDMA 1WJ3A 4XRCA 3LN4A 4EMZA 1GH7A 1NWOA 4MLSA 3QHFL 5KYYB 4U1IA 5DC0A 2Z35B 1I1FA 5E99L 4N9GB 4WF7A 2BEXA 5CINL 5HHVL 5EU6D 3APMA 4HU2A 4GI9A 4G9DA 1DHKA 2NYKA 3ULVF 1BVNT 3OKKA 4YHIA 1IZKA 4N8VG 2CM6A 3TA3C 2CGYA 2XPYA 3K74B 2Y5TB 4YDZA 3OAWA 3SKMB 4HJ0C 2XVLA 2A6IA 4UOQA 2VXTL 3BGAA 5F3BB 3GSVA 1XD0A 1SY6H 3OQ3B 3W3LA 4GUPA 2X4TB 3JWDH 4GKOA 1TQCC 4OZ4A 3CAFA 3BO8A 2J5LC 3CHSA 1B9KA 3IFLH 1HH9A 1EMTH 3MX0B 3PV7A 4RAVA 1TIUA 4YXKH 3T4AB 1SHMA 1QSFB 2BWQA 3HC0B 3KPMA 5D1ZC 1I9RL 2HA1A 3B4NA 4EZGA 2NW3A 3SCMD 5GS0C 5I8KH 3O6ML 4CW1A 1SFDA 2YSTA 3Q1SL 4H8WC 3G3AA 1LO0H 3DX9A 3MGOA 5JORA 1IEHA 3OKLB 5FYLH 5IOPB 2YGQA 3A22A 1BQHB 3EAKA 1OM3L 2VZSA 2YPLD 2DJ4A 3JTBA 2YJQA 4JK0D 4Z7QB 2O6QA 3T6XA 4FABL 1I82A 1QFWH 1I8LA 1UD3A 4UT6L 4Y5XB 3FMGH 3TNNA 1IBHA 1JHLH 1FBIL 1L7IL 1W0WA 4LIQH 4LLMA 1S7UB 4DPBX 4Z8FL 4M62L 3RNQB 3HZYB 2ODIA 3QARA 3LSOA 4OCWH 1BM7A 4M6ML 4PTTA 2W0LA 3SZ6A 2OTUB 2AGJH 5HYEA 4N5ED 4NRYB 1XH3A 2YRLA 5AZUA 4A7TA 4OUUA 2FX8L 4GT7A 3S36X 4PCYA 4MDRA 1EERB 2NY0B 4XP5L 4FFWD 3G5XA 4MGXA 4I0PD 1FVEA 1FRGH 2ZOUA 5FUZL 1SYSB 5T1KB 2AK1L 2IFGA 2N56A 3K4ZA 5B7EA 5CJXC 5DJ0B 1F00I 1H15A 4TPRL 1EAQA 3LXUX 4QGYA 5D7LB 3B9DA 5E94A 3S36H 1JV2A 2HFEB 5EBGA 3DX0A 2FE0A 2J1ZA 5HGGS 1A6TA 4KZEH 4OLUH 2RALA 5HBBA 4XO9A 3ZUNC 5JOFB 4R9HA 4FA8A 2CHZA 1FCCA 2ZWZA 3QXAB 3KLAB 4JGUA 3ZTDC 6PCYA 3DMMC 1DVQA 1KN2H 3QJUB 5IT2H 4PEQB 3BP4A 4FQPA 5ISZB 4ZAKC 1QR1A 5DO2D 2GJJA 2P7TA 4JM2B 1NCCH 3IDXH 1PNCA 5KVEH 4KKAD 2BVPA 3CXHK 4J4PD 5D7LE 3G6AA 4LDOB 1CE6A 3FB5A 2P9RA 3MLYL 5HVWA 3KWWA 4ZTPL 1ETJA 4CVZA 2O5ZH 3VNYA 1OPGL 1QBMH 2YMXH 4P48A 2FHBA 3IRCA 3UC2A 2WINB 3SPCA 1N9PA 5A40E 3QULB 3B3IA 1H3UA 4AIZA 4ZMLA 1SGKA 2NY2B 3VSUA 1KTBA 4NC1C 1JTTA 1ANUA 1ML0A 2V5SA 3OTTA 5ISZE 3FT2A 1OAKL 1JD7A 1V5JA 2VDQL 2VRKA 2Y7LA 1ICTA 25C8L 2DQDL 3F83A 1QSEE 1IV8A 2KLRA 2JE0A 4PR5B 3GI8L 4U6VL 1NIDA 3AG1B 1I31A 3KPTA 4K17A 5DQ9B 4XWOC 4JO8A 1DFBL 4HWZA 5E7FA 2VUKA 4QRRA 1YUHB 2G0LA 4PJAF 2VDRL 4NT6B 1ZA6A 4K2UH 4BDVB 1OT1A 2NQ3A 2X5PA 2WBKA 4Y1AE 3CSTA 4KO6A 4LQ1A 4X9HA 3PHOA 4KO9A 4WW2C 1D5IH 4Y0GA 4G82A 2ZCHH 3C8HA 4B7LA 4YEBB 3DSNA 4RMUA 1H8NA 5ABAA 2WXGA 3GRGA 2FEEL 4RMSA 4LLWA 4Y5YB 4AUUA 4E41D 4WFED 3SBPA 4F58L 2NZ1A 1XCXA 5TPWH 3VI3E 5E4IA 2QVIA 3IGAB 1NAMA 3IFPB 3QUMA 3WXVH 1INDL 4BSUA 4R2GB 4XP6L 2WBJD 5IIEB 3WXWL 4JFQA 1QPXA 1ACXA 1ODUA 2ZKWA 2QGDA 4G5AA 4GRLB 1IC5L 4HXAL 4NKMA 5DD5H 5I1EH 5KVGH 3APFA 4YHYB 4GW4B 2XN1A 2DIJA 4AYDC 3MRBA 1H8SA 1ZIWA 1A9NA 2RHEA 4G6KL 3HAEH 2MKWA 4H0LC 3FN9A 3HZVA 1U8JA 2EILB 1TCMA 1CD0A 2AKRA 5DJYB 2PO6A 2X9YA 2VDPH 5AZEL 1C8PA 3U36A 4W9EC 3WHE0 2MRYA 3BIKA 2WV3A 4WNSA 5EZLB 5E2TH 3BAJA 4PJ7F 43C9A 1J9SA 4HHAA 5E2VL 2PR4H 2FBOJ 1RZIA 4OZGF 4QHNA 1J12A 4N0CC 4OM0L 4HS3B 3QIWC 4QJ5B 4ZS6D 5D1QB 4YDVB 1NZRA 1IAOA 5A2LH 5B39A 4RRPA 5BXFB 2XI9A 4EIZC 3IU3A 2VZVA 1KT2A 3UZVB 2H26A 1RZKL 1VEPA 4LP5A 3ULSB 5J12B 1C7TA 1TZGH 2A6DB 1H5BB 2IOOA 1PGRB 4RIRB 4DZBA 2CNYA 1S5IL 1KV3A 2HJKB 4X6DA 1KTDB 3GMQB 4HUXB 4Y88A 4A7VA 1U8LA 4RQQB 1FHNA 3AQYA 4AI7A 5KTEL 2QV2A 1WZKA 5DZJA 5GRVL 4ERSH 5KS9E 4MQXD 3IM1A 2WVTA 3MLXH 1MW3A 1VADB 1DQDL 5J06A 4N2NA 4MAYC 4PRDA 1DUZB 3UAJD 4AEHH 1P5VA 2EIZB 4QCIB 1J5OL 2NLJA 4MNQE 4RESB 4J0MA 5D1QE 5D2LB 3RY6C 4AW7A 4EN3A 4C4KO 5E2WL 1YYCA 4QOKB 2J2ZA 4HUMB 3BUPA 1RIVL 1E9OA 1X3DA 4LNRB 4KI5E 5DA4A 4PHZA 3G04B 4NQTA 3DUSB 3QZOA 5JIMA 4ZMYA 5KW9L 4N26A 2F08A 2JI2A 1KGUA 3OD3A 4RX4D 3B8SA 5SWQB 1BZ7A 4FJ6A 4U1HA 1TYEB 4GQQA 1UM6L 5EOQH 1AKJD 4HAGA 3RL2A 1EHLH 4R09A 3FFDB 1HHIA 1KNOA 1LDPH 4IU2A 3STBA 4HXBH 1HZHH 4EUPA 3U1PA 4TULH 2X2YA 4YQXH 3C6LA 1MVYA 5D96C 3FNKA 5FYJH 1G0YR 1PZ3A 3BSZA 4UCFA 3PFUA 3BVNB 2VN5A 3DVNA 4GAFB 4HEPG 4DQAA 2FLRT 2OMWA 5G2NA 3S2CA 3N0PB 3HCVB 2PW2B 2H2SD 5CGBA 5D2LE 4IRSA 3ARBC 2AK4A 3FYIB 4JFED 4QOKE 3T1FB 5ADOH 3RWIA 2R2HA 4Q8BA 3RILA 4LVHB 3CDGA 1AD0B 2CJTA 2PUQT 5EA0L 1ZLVK 4OFIA 4J3TA 3TPUB 4H40A 2H6PA 3TT3H 3SDXF 4TL4A 3VFOB 2WUCL 1S3KL 4Z3IA 4Z7WB 2RIKA 4BQBA 2ZKHH 5IHLB 2BSEA 2QADB 5C6TL 1Z9OA 2A4EA 3OJDA 2ZAHA 3VB9A 1BF2A 3IT8D 4OJFH 3HG4A 4KXCA 3T3MF 2H0JA 4AITA 5FUCE 2AEQH 4ENZA 3QDAA 4Y2DD 4EO5A 1UJTA 4PJ8B 2VLRD 1I9IL 1JGIA 3KLHC 2VXQH 5HJDA 3KEDA 2W0PA 4JDVB 3S5LG 1S9KC 3T4AC 4WW1B 4BGLA 2VLMD 1PX8A 4MDIA 1PQZA 3FO1B 3QNZA 1P8TA 2EP6A 1HKFA 4ZFFB 4C83B 1OCCB 4PIRF 4FADA 1CT8A 4Z0XA 1N59A 4DCQA 2R8SH 1NPNA 1NEZG 2V9RA 2K9UA 3B1TA 1VESA 2VWEE 3DV6A 1SDAB 1RUAL 5AYTA 3EH3B 3JYBA 1KJ3L 3GMRB 4L3CB 4OIAA 2GAZA 4Y5XC 3ZBMA 4I1PA 3PWNA 4QY8B 1IE4A 5DJXA 4WNQA 5IMKA 3US9A 5C92A 1VSCA 4CGUB 5JNYB 3JB9j 3SD5A 3ATFA 3LKSA 1NCBL 5TDNA 4M1DL 4R4ND 5ALBL 4YXLH 4AMXA 3ME0B 2YAOA 4FULA 2NY0C 1J1OL 1XCQB 1ZSDA 1K9TA 4L8SB 1TTGA 3J8F7 4B0MB 4J3OC 1TQSA 2OLDA 2OR7A 2AMGA 2XWZA 4JBSA 2E5EA 3H7BB 5DGRA 2DI9A 1SJHB 1JDDA 4PJ6A 4FRWA 5F7DA 4CNMA 2K8MA 4CP6A 1WG3A 1MDTA 5CZXC 1CL7L 2VR8A 4QRPB 5IM7B 4RETB 5DU7A 3W11C 1YMHB 5C07E 3GZKA 5DSCA 3GSXA 4L48A 2XPGA 1HK6A 3RAJL 1XF5A 3MI6A 1SPDA 3LD8B 3CSGA 2GJRA 4IS6A 5I19L 4G8FB 2JE1A 4UOW0 3ZL2A 2WLLA 4KGJA 3TFKD 1RJYB 2DTMH 2BSRB 2IOMA 1MREH 4UQIM 5DRWA 3VFGL 3NYKA 3O41B 4BFIA 1V8HA 1U8IA 4DN4L 1HSBA 1YEJH 4FQXD 3US0A 3X13A 1OW0C 2P8LB 5HHOA 4B97A 3RUGF 5F1IB 4JM2C 3MNDA 4WWNA 1CE1H 4ZMZA 1XB3A 2VABB 1MG3C 1T3FB 2CRMA 4XH2A 3AACA 2FBJH 2Z8VC 4JG5A 2UWEF 2B2XL 4PWJA 4QRPE 2BNRD 2EEBA 1N68A 1SJVA 3PWPA 4W6WB 3ZZSA 4CVUA 5T1DL 1OSPH 4FI6A 4ADGA 3V55A 4M7JL 1JDAA 1Q4NX 3H9HB 1ZGLP 2XC8A 4XP9H 1P8VA 3VD2A 1LQSR 4JMNA 5DLMH 1HVXA 4D0BB 4OI8A 5I1CL 3HG1D 2XIDA 2WXLA 3ULUH 4QBZA 4A66A 4CMHB 4M8UA 1YMMD 1FFQA 2GC4C 2A73B 1VIWA 3ULVH 4Z95L 1NGPH 1G94A 3MRMB 3HNSH 1IKFH 1R9FA 3O2VL 2F8VA 2I9TB 4MHHI 4XNMA 3WCYA 1ET5A 3WPBA 4YHMH 4NBZB 2D03L 2XN9A 3ZHNA 2I07B 2CLVB 2KMWA 1KCRH 4D9QD 3T5WA 5LJYH 4HW6A 1INEH 3MRKA 5FC9A 3Q8EA 1XO8A 1YNLH 4ODSH 1CF1A 1JCKA 4XXDB 2H32A 4QRTA 1E3FA 5D6DA 3IDMB 5C2UB 4XN2A 2CA6A 1DSFH 3DXAD 1MAKA 5K9OB 4NZ8A 2HWZL 2PETA 2R4SH 3HR5B 4DP4X 3LNIA 1WIOA 5LB1A 2D2CC 2F68X 4U3SA 1K8IB 3DIFB 3M1OA 3NACL 4Y9GA 4Y5YC 1F8TH 4Q2ZB 4LSAA 4AQ8C 2ZUSA 1BMGA 1WZAA 2G5UA 2GK0B 2BZDA 1W0YT 4FNPA 4YSAA 2UXVA 1MF2H 2GIMA 4KY1H 4LL4A 4EBQH 3A6CL 5I1KL 3GHEH 4LQFL 3GMMB 2Q1EA 5DHEA 1M6UA 3RVXD 5C0GB 5GS0D 1NKRA 3ARPA 5BO1H 4LPTA 4R2GC 4NYLB 3KHOA 2EZ0C 4IK7A 5C86A 2B15A 2OCFD 1U8MB 3GRBA 4GRLC 1R34A 5F7BA 2J6WA 2JK5A 3EJPA 3QUYB 4L1HA 4MZ3A 1JXFA 4YHYC 3NP4A 3QEQB 4GJTB 4PJXA 4Z77B 4YSRA 1YRKA 3MV8A 1EUTA 4KAQH 4UM9D 4JMXA 4LFHD 1RXLA 1J8RA 4GMSL 4UI2A 4LCIH 4UTCA 5DA0B 5LAXA 4XMWA 2OI9B 2XA8H 3NCEB 1B2YA 3CC1A 2FIKA 4X0KB 3OC8A 2EVGA 4K71B 2DJSA 2WO3B 3S35L 3BQVA 3N1MC 2E76C 4TVPL 1FNGA 1H0DA 1MJUH 2DJMA 2L4OA 2ZKMX 1QRNE 3G6DL 3LN5A 4L29B 4WSJA 2OYPA 3VO0A 1EJFA 4YSDA 2F5BL 4NO0B 5D1QC 3WD5L 5JO5B 4DEWA 5JZ7C 2HG5A 3HI6H 4JRXB 3RY5A 4JHZA 1XGRA 4UOW1 3JWNH 1P4BL 3DWTA 4LSUL 4AZUA 1YQVL 4X6CF 2PNDA 1IAMA 1XCTA 3MLVL 1XSJA 4R90H 4ELMA 1RURH 4RWYH 1P9AG 1Y18A 5J12C 4FKKA 4CBZA 4D9RE 2ZSVA 1H5BC 1NDMB 1T6VN 2BPBA 3IDIA 1RIUL 2AMUA 5LBGA 1EAPA 4K4KA 4XCYA 4OD3H 3F64A 5ACMA 4Q52A 4RMQA 4UU9B 1ZLSH 3T0WA 3L81A 2XU9A 1I1AB 3KYMB 5CINH 5HHVH 1GC1C 5IQ7L 1J18A 4ECOA 3RA7L 2EXWC 3HZMB 3DMMD 1OP5K 1EZVX 3F7PC 3KPNA 1ROCA 5JXEA 4CRPA 1EWHA 2ED7A 4L37B 4ZAKD 2DM3A 1UT2A 3QDJA 4M1GL 3BAWA 3MOBL 3FONB 2XPZA 1UC6A 4CKQA 3G04C 1C12B 3QQDA 3GSWB 4J27A 3WOVA 4NZFA 3MJ7A 1Y07A 4PW3A 1BM3H 4XHQA 1TR7A 4GUOA 3DOSA 5EZJA 2O72A 5F3FA 3GOZA 2ENPA 1M71B 3QEHA 4P5TB 3U0TB 3NJNA 3UC0L 3GLDA 1OHZA 1A6WH 3EW3B 4RISH 1E67A 3WIHA 1R3IL 3OKDB 1IRAY 3O6MH 5E8OA 4ODVL 5FUCC 3APDA 4OI9A 1E9PA 4BQCA 3IVKB 1FORL 3UGXA 5CP7B 2YXFA 4DKDC 1AMXA 1JUFB 4RMWA 1OM3H 4D7BA 1FL6B 5F1OB 3EJYC 4FABH 4HSAC 3SGEI 3DO4A 4WFGD 1CICA 4WO4A 1PZDA 4M93B 4UT6H 4PWFA 5BW7A 2X4QA 4KHXH 1FZKA 1L7IH 4EZJA 2J8UA 3RNKA 4M9OA 4CMMA 4U6XA 2C4XA 3BAXA 4KNQA 4N4YB 3VXTA 5LCVL 4C56D 1QW9A 3SBQA 4N2KA 4XWOD 3MA9H 4ZW6A 3V8CA 3MLUL 4ES9A 3DTXB 2QADC 3FYEB 2N0MA 1JOIA 2FX8H 3C12A 3GIVB 3MZTA 4YLCA 4N8UA 5DS8A 2VWEC 1QMUA 4YBQC 3CH1A 2EACA 1TOXA 2ADJB 5ANMB 4YOKA 3A4FA 4X5LA 4UTAL 1GGYA 5AW6B 3KYNA 3DK2A 2NNXA 1D9KA 1MHPL 4PJ8C 2V7HB 3L9EA 4FHJA 4YH6A 3V4VH 3N2JA 3QVAA 4TPRH 3N3EA 3ZZQA 1C9SA 3FUKA 1FVCB 3CN4A 3D3VE 4LKXB 4ZXBA 3CMOL 3D1MC 1AGEA 1VCBC 3WPCA 2YGPA 4L23A 1MHEB 1OANA 3KVPA 4MQSB 1FC2D 3PAUA 5C71A 1ZSHA 2DM7A 3BIAX 2BC4A 2FNWA 4IGBB 4JRYB 5A2IH 4FFTA 3TIDB 3Q2LA 2LW3A 4PMFA 3MREA 4APXB 4L4TB 3JWOL 4IDJL 2J6EH 5EZIL 2NOYA 2K0RA 4DVRL 4GNKB 4OCXL 5F89A 4HOXA 5ANME 1MCRA 2P5WA 3KPLB 4LZKA 5EO1B 2CDFA 1JZ4A 1QYYA 1FFOA 2BS9A 4X5RA 5EPMA 1K2DA 3S88L 4IOFC 3CVBA 1Z9LA 4HUWB 4POYA 4Y16B 2QHLA 3PGFL 1EGJA 5AB1A 3HI1A 3JWNG 1AY1L 2YAHA 4L2LA 4ZUTB 4F7EB 4AG4L 2KQNA 4FQHA 2VDMB 1XAKA 4XNUL 3RE0A 3H8NA 4R4FH 4JJHA 4IKJA 2ZZUT 4N0CD 3KGSA 3LKPB 1QBBA 3ZYJA 1PYWA 2FLMA 4L8SC 2DQ6A 1TCRB 2XV0A 4L4TE 4PJHA 1ZAGA 2YSSB 1PY0A 1Z5HA 2IADB 2HP4A 3I50H 3SBWC 2ZAIA 1KXQE 4P57B 2RFXA 2Z4QA 4R97B 1DJYA 1QLFB 1YEHL 3AG4B 4B9IA 5T33L 1BFSA 1B2WH 1FGVH 1HS6A 4I85A 3UX9B 3CFUA 3S34H 1KY6A 4TSCH 3IFNH 1OGAA 5MHSD 2DQDH 3DDFA 3GI8H 5HGBA 3V7AE 4HIHB 2OQJB 3I02A 4ODXA 2AANA 2OMTA 5AW4B 2HVJB 3UTPD 2WBWB 1QA9A 1X5AA 1DFBH 3VXRE 5A6IA 5IVXA 3HNVL 1I85A 3OHXC 3L3GB 4MAYD 5JR1L 2IWFA 4PGZA 2XFXA 1T5WA 4KKQA 2B59B 2Z8SA 1VGKA 2Z7YA 3FSAA 3L48A 4BHUA 1WHOA 2WXMA 1CG9B 4HZAA 4JVPA 5F0JB 3BH8A 3C5SB 3CMGA 3QISA 4JO3L 2O5NA 5CIPA 3TTSA 2P1PB 1XGUB 1R1CA 1MCLA 1RJLA 1U9KA 2EDFA 4J4LA 4B0MM 3NJIA 3HE7A 4XNDA 3S7GA 5IFHL 5GGSB 3I6GA 5CJ5A 4BH7A 1W80A 3GD1C 4PVLA 3B9KB 3U6RA 4ZX3A 4R7NA 1INDH 1KOHA 2O6RA 4XP6H 1CD1A 2RQEA 4N3UA 1BQKA 4FHOA 3PQYD 1KXTA 2AQRA 4CMHC 4PREA 1MHHA 2W38A 1PZBA 2YBGA 3WTXA 3TT1L 1BOYA 1IC5H 4O51B 3ARBD 5DYFA 3RWDA 4Z7NE 4G6KH 3O11B 4R84A 5C0AB 4ANXA 5IJDA 1XH0A 1GHFL 5D55A 3EYSH 5FHAL 2RMNA 3ZTCC 1SMAA 5C9JA 2BO0A 5CD3A 4FFZH 5DJ2B 4XOCA 3O2DL 4YX2H 3C5JA 2X89A 2DF3A 2DWYA 2YGOA 5L88L 5LGJB 4K5MA 3NRQA 2FRGP 1B0GA 1KPVB 3ARFB 5I24A 2DQJL 3LPOA 1MJ8H 1OVZA 3FUHA 2Y7MA 2IEPA 1T66C 2HRGA 2R0WL 5GRWA 3NRPA 4K9JA 3NT0A 3JYCA 4QRBA 1X9UA 1UEYA 3QRGH 3I9GL 3Q48A 3VXUB 3CFTA 3HMWL 1SBBA 3AS3A 1EZLA 3A3YB 2GITA 4F33B 3QUZB 1D5XB 3KLHD 3MBXL 4WCYL 3T77B 4JM0A 2LABA 4C4UA 3ZIMA 2SODB 1QFUH 3L9RB 2EYRA 3RIAK 1WPCA 4JPKL 5AYQA 5GSRB 1IT9H 3ZJAA 4UQ3A 4NPYB 3DX4A 1OD7A 5IMOB 1CFNA 3BQUB 2YFNA 5C0CA 1RKRA 3HOGA 2F19H 4BWTA 1PNDA 1RK1A 4HWBL 1MFBH 3FRUA 2P52A 4UB0H 1EXUA 4OZHF 3S8WA 2H2PC 4LB8A 4QYOB 1A9VA 2WPGA 1MFEL 2PP8A 4FFVC 1J7VR 2JV6A 4U1JA 3VYNA 1J5OH 5EO9A 1E28A 3SJVE 3AXIA 1BD2A 3QUYC 2YN5A 3RL1A 4AOFA 3E6JA 1C1EH 3P0GB 3VXUE 1U0ND 5DEZA 1RIVH 1D0BA 4ZODA 1W6LA 2Q7NA 5IHZA 3QWRD 3FTZA 4UDUB 3ZPDA 1II4E 2ARJA 2C1OA 2OI9C 5JYMA 2UX6A 5EN2A 2QMKA 3WIIL 1I7RA 1BBDL 2OXGB 1G4RA 1AP2A 1URLA 2EO7A 4XXCC 3CZEA 5KYXA 2JQZA 5MEPA 2NY0D 1MIML 5HI4D 3TEUA 1MCWW 4MWFB 5F2FA 4LBEB 3SKOA 4J3OD 4DK5A 5FOBB 1E5UI 4J6RL 3QR1A 3TBSA 4U09A 5T1KD 1A6VL 2FWOB 1LEGA 2JXMA 3QJSB 4K8RC 5DRZA 3AU1B 3FQYA 3M86A 4HPHA 2WO2B 4LCVA 3QR2A 5D7LD 1EO7A 5BOPA 3GTTA 1XBRA 2ELLA 2JJTA 4W9IC 1WGVA 3QPKA 4N6QA 2XIBA 1A14L 1CFVL 3MJWA 1I1AC 3D85A 4HWNA 1LDSA 2WUCH 3VXPB 2PKDA 4XRCB 3LN4B 3QYMA 5T1LD 2P3YA 1E5ZA 2PWGA 4J23A 3GIZL 4PUBH 1DBJL 4RGNE 2IF7A 5C3IA 4IU3A 3GSUA 4U1IB 4WTQA 5DJDA 2YD2A 2X28A 3HNTL 1DR9A 4G9DB 3L5JA 4M5SA 4M7EC 5ISZD 4PQ8A 3OKKB 4YHIB 4JM2D 4J3SA 2WANA 2MCG1 4IYKA 4HJGA 2IANE 2FATL 3HFML 1QSED 4LXFA 4TLTA 4EVNA 5ADPL 3SDXA 5CS7A 1JZ5A 2A6IB 3GSVB 1SN5A 2XY2A 3NOIA 1UFUA 1BIHA 3VD3A 2O61A 4XNQB 4P5TC 4GUPB 4X4KA 1A3LH 1S8DA 3Q2VA 3IJ8A 4OZ4B 1CFBA 3BO8B 4HS6B 1CXHA 2HKAA 1HH9B 3MLTA 5EU7E 4PERA 1ZJBA 3DHPA 4NKQB 2X4OA 4FJZA 4BFFA 5GRZA 2HX8A 4WWKA 4Y1AD 5EORH 4NBXB 4FX5A 3NFSH 2GEEA 3KPMB 1RUQH 2Z0BA 3NZUA 1P7HL 3EOAA 3DETC 2NW3B 3LZOA 4XMTA 4NI6A 4U2ZA 5B4PA 4CW1B 3P3YA 1RUAH 1G1YA 3K8LA 3QPXH 1Q38A 1K4DA 3DX9B 3MGOB 1KJ3H 3N43F 4M93C 4Q58C 4ILDA 5JORB 5E9DE 3LH2H 2ZD0A 1E4HA 1CN4A 1C8QA 1L6PA 4HALA 1NAKH 2W8CA 3ISWA 3HHRB 1SLVA 3GZPA 1W0WB 4AUYA 1NCBH 3OGLB 4LLMB 5EOCH 1JPSL 4RBPH 1DL7H 1TYJA 1J0YA 1AO7A 3S3BB 3LSOB 4M48L 1P5UA 3E8UL 1UATA 3NH7L 4PTTB 4AL8C 1DBMH 4U49A 2VDNH 4KT1A 2YLKA 4G5ZL 1XH3B 4HISA 4OGXH 1IAII 3NCMA 2XJLA 1Y1UA 1ZIBA 2JKJA 4FAAB 1UA7A 3VFWA 3ARUA 3PAZA 3GNML 3G5XB 2H6OA 1WHPA 3PWJA 2G3MA 2QPFA 1FVEB 3L1GA 1CL7H 1LK3L 1X5GA 4G72B 1RFDL 1TYRA 3NIDE 4PVNA 4F9PA 4PPTA 2HH0H 1TVBA 2ZX5A 4PJEF 1DLHA 3WKML 1QD0A 1H15B 3DGCR 1CCZA 4LSQL 1T1WA 5E94B 4IGBC 5FLUA 1JV2B 2AXGA 5CCJA 1G9NH 4R2GD 1TNNA 2R9HC 3IMVA 3NJVA 3SN6N 2EZ0D 1Z9PA 2CA4A 3BGMA 3M8OH 1A6TB 2EDWA 2EVJA 4DN4H 1KSRA 2VMDA 1O7SA 3FQ2A 1JVOA 3FRPA 1AACA 3ZT6A 4P5SA 1XTMA 5HJBA 3D34A 5CEYA 5LGYA 4Q7DA 1NC2B 4XPFH 3D87B 4IEFA 3KWTA 3BP4B 4HJUA 3TZVC 5J6GA 2VC2B 4Y16C 1DSYA 1QR1B 2B2XH 1Q0XL 3TV3L 3W9DA 4OKVB 1FIGL 2P7TB 5E6IB 1NL0H 1ZLUK 1TJXA 3ZGHA 2ZTBA 3W37A 2BVPB 1KIUA 4KVNH 4JKPL 4YUEL 1Q94A 1F42A 4MZIA 3G6AB 3QA3A 1CE6B 1R46A 3FB5B 5D1QD 1TJHL 5CLYA 3KWWB 4CVZB 1KLGA 4JCWA 2XWCA 2QV4A 3ZE1E 3OB0H 2HSIA 1ID5I 5IJKC 1LO3L 1K3ZA 3V95A 5FV2A 5ACLA 3MZGB 4FZEL 5BS0E 1CGXA 4GRWH 3B3IB 3PAVA 3MJ8A 3O2VH 3WE6A 4FCHA 1WEJL 1G9HA 4HJTA 4XMZA 4P8SA 3TH2T 4DHLA 3FT2B 5DUBA 5LG6A 2O26U 4GYBA 2UZPA 2Z93A 1KGCE 2X6MA 4JY5L 1KDIA 4XO3A 5DD1L 1XB8A 3VTAA 2XXGA 4FQIH 4E9SA 4FKHA 2V5MA 4WJG3 2FJSA 4HWZB 4QOKD 1XF1A 4QRRB 1SOXA 3SKUD 3ESUF 3FPYA 3QP3A 4YHZH 3GB7A 3V4LA 3OBAA 1ZA6B 5CWSA 2X1QA 5HVHB 1HH6A 2HWZH 1AFVL 2VO8A 5CSZA 1LTXA 2R1YA 2G2NA 1NGZA 4IMKC 3LIZA 1CURA 1XXDC 3M07A 4Z7VF 1AZBA 3DSNB 1N6VA 3SE9L 4HF5H 2GJZA 5I1KH 1E65A 3RYMA 3C6NB 4DEUA 3B9KC 3DDGA 1DANT 4I18A 4LLWB 1OTSC 1D2OA 2DICA 4OZFH 2FX7L 2IBBA 3II3A 3RZCD 2AJ3A 5CFAA 5EOTB 1GOGA 4LHUG 4AYBA 4DGVL 4WHTA 1NAMB 3QUMB 3IKCA 1AAJA 3OC5A 5LKNA 3EJYD 3HKFA 1A3ZA 1K3IA 1L3NA 4JFQB 3N1QC 4PH8A 3S35X 4LP8A 4G8IA 5C0EA 3VACA 5C2BL 4JY4A 3NA9L 4NKMB 4GMSH 4UNTA 4EXPX 5GGTL 1FLRH 3MRBB 4KVCL 2FYVA 1MCCA 2OFQA 3NJKA 1KIQA 1U8JB 4WGKA 3LV3A 1C16A 2AKRB 2PO6B 2QADD 3ARFC 3BWUC 4TVPH 4XZ4A 3U36B 3G6DH 2YR3A 3BIKB 1N18A 4X7FC 5AKVA 4YBQD 1JYWA 2VLJB 4HHAB 1Z5LA 2VZOA 4U1LB 1RZIB 4QHNB 5IB2A 1EBPA 2FQEA 4W9CC 1P4BH 3DK0A 4Z1PA 5FGSA 4PJ8D 1YQVH 5C0RH 4YHPA 3BI9X 2X9ZA 3QUZC 5EN3A 4DERA 1T21A 2EDLA 1IAOB 2Y7QA 3RGVA 3WFBH 3A6OA 5GGUA 4DF9A 3K6DA 2B3RA 5B39B 2FJGA 3ESNA 3P3SA 3IU3B 4E9QA 1KT2B 1WVZA 2V3EA 1IQWL 5AUMA 5T5FL 2H26B 2BH0A 5HDQH 3FL7A 3BQUC 3WLBA 1WAPA 4CVWA 5IQ7H 4Z18A 3C5ZD 3OPZL 5GZOD 2QDWA 3B5TA 4DZBB 4B3VA 4K3DL 4LCUA 2HAZA 3J7HA 1WAAF 4X6DB 4S1RH 1XD1A 3ZTEA 2VDLB 4X6CA 1U8LB 5L6YL 3WTUA 1VZGA 3L17A 1GJUA 3OWRA 3MRIA 4PRDB 5KUKA 2Y1VA 4XVTH 1P5VB 3TNMA 1A65A 1TTAA 5C07D 2NLJB 4YN3A 4IOFD 4ODUA 4NZTM 1VZIA 4PS4H 3ETSA 2J2ZB 2XTLA 3K4AA 2X05A 1A9EA 1N12A 2QLVB 1E9OB 1OKEA 4KKLC 2C3HA 2IWKA 5I1GL 1ZV2A 2X41A 2X87A 3GM8A 5JIDA 2F5AL 4RGNC 4Q56A 3UC0H 3EUDA 1BZ7B 4U1HB 3K8KA 2BSDA 2NXZB 3RL2B 3LQAL 4ODVH 5EIIG 4UDTA 1HHIB 4IU2B 4EUPB 4X6DE 1FORH 4EIGB 4XMXA 3C6LB 2E4FA 1BVKA 2ZYIA 1E8ZA 3DVNB 1MFMA 2E0PA 3PFQA 5E7BA 2OMWB 2P43B 4QRPD 5FAAA 1A4CA 1RZJC 3V7MA 1BF5A 1NMCB 2W9EH 2Z7UA 4WI7A 2DLFH 1VPOH 3HBPA 2XXFA 4BCZA 3RWIB 2R2HB 3ELAT 3OKYA 4MJ6A 1P7KA 3A6BH 2KZKA 1CXKA 3OPUA 3U7AA 3MLUH 4ZUWA 4W70A 2H6PB 3LNFA 3BPOB 3ZMEA 1H3XA 2HLAA 3N9GL 3NCYP 4HLJA 4RZKA 2MIZA 3SDCD 4UTAH 3OJDB 1MHPH 5E8NA 3Q8AA 1Y1DA 4E0RA 2JQMA 3IETA 1VFOA 1CTNA 4PG9A 2EXYC 5CP3A 4OZFG 1KFAL 4TF4A 5C8JA 1UWEH 1MLCA 1DJSA 1UVQA 3HC3L 2AK4E 5CKAA 3SHSA 3QG7H 1A6PA 2Z9TA 3NBNA 4EAEA 1DFXA 3HRZA 5D93B 4JDEA 1T7XA 5D2NE 1IC4L 2CBQA 4GSUA 3TFBA 3QGVA 3JWOH 4MDIB 2DI7A 2ZT9C 3H2PA 1PQZB 3PWVA 3QNZB 4IDJH 3RVVC 3AMLA 3CCHB 1GY2A 3NJMA 1CT8B 3TX4A 4Z0XB 1N59B 3V5DA 4D0CB 4WVRA 4DCQB 3B2VL 4HYTB 2E9BA 1WV7T 3D0VA 5CZRA 4E9WA 3S88H 1YC7A 2GTQA 3DV6B 4AGMA 1E7UA 4ELKA 1I8LC 3FKUS 2GAZB 2V8LA 3AUWB 3PWNB 4WI4A 4XOAA 1ULVA 5KSBE 5H4ZA 5HDBE 2F7PA 4JO4H 5DJXB 4AG4H 4WNQB 5IMKB 3EYFA 3UADA 4FJYA 2LU7A 1JGUH 1E40A 2CKBL 7PAZA 1T66D 2WFHA 3LKSB 1YNKL 2DIAA 2ZJSL 5H2BA 5TDNB 5T8IA 2BERA 7FABL 3B2XA 1HHKA 3JT0A 2JELL 4GXVH 3UYOD 1OV8A 1ZSDB 5AOZA 5IB3A 5E1HB 1YEHH 4ALAC 5T33H 3VDAA 4F8NA 5G5DA 3V0JA 2AERT 4YZFE 1N64H 5F7DB 5SV3A 2EVIA 1GZQA 3CZKA 4TQPA 2R0KH 2ENJA 5JMRA 5EDXA 2YMOA 4GO6B 6CGTA 1QRND 1XZ0A 2RR3A 1BXUA 4ONHA 1FO1A 2DPKA 5DSCB 2XPGB 5B4MC 3CZUB 3ATEA 4FFVD 2WGNB 4RGOH 5JR1H 4P2RA 3QSKB 3ABKB 4IS6B 1H8OA 5JIPA 2WLLB 3QUYD 5A2KH 3HHSA 3QEQD 5DRWB 1ZLDA 4GP8B 4CJ0A 1J0JA 2XBTA 4BFIB 1U8IB 3H85A 4M6AA 2ZX9A 1HSBB 3E6FA 4MS8C 4I13B 3X13B 5HHOB 4MASA 2EUVA 2CDGA 3FB6A 3HKZA 4NERA 3CSPA 4OFDA 2EC9U 4XH2B 4GO8A 1GJWA 1KJ2H 3PF2A 1NICA 1T7YA 4PRHA 4WU5A 1YEKH 3PWPB 4NO0D 3ZL4L 1M6OA 4AM0A 5CZKA 1SHXA 4JRXD 4G1EA 4X99A 3ZU8A 1PD0A 4K8RD 2B3IA 2OSLA 3AU0A 2GSIA 2AEOA 1JVKA 2I25N 5B3JF 3REWA 3A47A 5CLTA 2G3ZA 3EG9A 4N0RA 1Q72L 4TLSA 5TF1L 4G8AA 5FHAH 1GHFH 5CJ8A 4JFZL 5FUOH 3QJVB 5D5MF 2D9CA 3MXVL 3QG6A 1P84K 4TRPL 5IB4A 2PP9A 1I1AD 5GGRY 3AITA 1Q90A 3S8FB 4XNMB 5DGQA 1X6LA 1L7TH 2BIMA 1NUNB 1SY6A 4ZFQA 3UEQA 3SPJA 2XN9B 4MXWL 3LNEA 3JZ7A 2R0WH 3A4DA 1U42A 1HXYA 5T3ZE 1WS8A 2YAFA 5HI3C 3MRKB 1XXFC 4UNIA 3B2PA 1T1XA 3RB5A 5HVHC 1XMEB 2J8HA 2KHAA 2H32B 4QRTB 2N1TE 2E75C 3F2LA 4WCYH 4WK0B 3QXDB 3VFSA 4BM7A 1JFQL 2N1KA 5IBLD 4P59H 4QT5A 3GJFH 5I18H 1ZT1A 4P5TD 4WQOA 4OZIF 4U3SB 3KL3A 1EX0A 2AJVL 1RVFH 3I2CL 3LS5H 3NJJA 3V4PL 4OFPA 4YBHA 1VRSA 2A99A 3RX7A 2APSA 3ZO0A 2BCMA 3EJRA 2GC7C 1FNSL 1A7OH 1G0DA 4U6HA 2R7EA 3DETD 2ICEA 3EGXA 4X4ZA 5INCA 1XGQB 1JWSA 5LBVA 2BIOA 4CGTA 3MCLH 1J88A 1AE6L 4FF9A 1LP9A 4WW2F 5EU5A 1Z3GL 4W93A 5KBKA 1UM5L 1SLXA 2JK5B 2ZCZA 1M2OA 3FOMA 5L8LB 2W65A 4PJXB 1N70A 1HWHB 2XZCL 2JKLA 4X7DC 3QWQB 3MV8B 2AQPA 2XVGA 1DJZA 2VMFA 3PREA 3FQRA 1DDHA 4X4XA 4Y7OC 4KXFB 1L9QA 3W3GA 4XPGH 4W4NA 2PO6C 2WW8A 5LAXB 1LL1A 4KUZL 2X1PA 3TF7C 1MIMH 2XQYG 2FIKB 1T6BX 4U06A 2ADFH 1DVZA 1FNGB 3LN5B 2OMYA 3GBLA 2ARJQ 5EC1B 2Q3AA 3MN8A 1UKQA 2HG5B 1B0IA 1QPPA 2CIKA 1CTOA 1XGRB 1UGKA 3MMEA 3TYFA 4DUVA 2QVKA 2VQTA 1XCTB 3ABMB 3O6KL 5GRUH 5LXGL 1YEFH 4ELMB 2EDTA 4MKMA 3DO3A 1Y18B 2OMNA 4LLYA 3MLSH 1CFVH 4IGBD 1A3QA 2W1NA 1QACA 1IFGA 2R9HD 2R51A 3IDIB 4GG8A 3CHRA 1EAPB 2X1XR 4XCYB 2N7BA 1FF5A 2FZ3A 4L4TD 5D4IA 2HXAA 1U33A 2RBLA 3EJSA 1NLDH 1QHOA 3HNTH 4KU1A 4M5ZL 2H9GA 4K9EC 4NQCA 3UMNA 2EEDA 4YR6A 3HB3C 1KPUA 3KPNB 4NRZA 5GMGA 1MWAH 3FU0A 3QAZB 4FXLA 4EN3C 2FATH 4GAYA 2DM2A 1B0RA 4OF6A 3TZVD 1T22A 4Y16D 4FQCL 1ITCA 1E6OH 3QDJB 3VXMA 2EDBA 3TJEL 4OFYD 1FI8C 1NJ9A 1N10A 1LNUA 4ELME 2A6KA 3QQDB 2IV9A 3PYCA 1W72H 5DD3H 1HHHA 1T0MA 1TLMA 4JPQA 4QI3A 4WSGA 1WITA 2WQWA 1DYZA 3L08A 2NXZC 3DOSB 1DJXA 4HIEA 5EZJB 5EH1A 2AJYH 4LPYA 5LNEA 3QEHB 1BVOA 4MD5A 4G6ML 4ZOEA 2OPCA 1LHZA 3FHQA 4RRPM 2CPUA 5BRPA 3C6LC 4DN3L 1S7SA 3LRLA 5E8OB 3ISRA 1E9PB 5B1BB 1HAWA 3P2TA 1NMCC 2JI3A 5FPIA 2XTJB 4KK6C 4IRSC 2CXKA 2M26A 3ARED 1JHTA 1PCSA 2PYFB 3QDJE 3FCBA 1CICB 4WO4B 4TV3A 4LPUA 3SZKC 3GXDA 5C0NC 2X4QB 2PPEA 3GF8A 5E6ZA 1CWVA 1FZKB 1ZTMA 3B9AA 3ZQXA 2J8UB 4F92B 3RNKB 3AGVA 3QQ4A 5DZAA 1JPSH 2AFNA 4U6XB 4CMMB 5DVKA 4WJ5A 1U8CA 1YSOA 1C08A 4M48H 3BPOC 3VXTB 2O6DA 4OJDH 1KB5L 1ZANL 3E3ZA 2AXHA 4XPTL 2EH8L 1K8DA 5DS8B 5LBSH 3QS2A 3GLAA 3TPKA 2IDQA 1KLUA 2I69A 4MB1A 4L0YA 1PS3A 2EIBA 3KYNB 1D9KB 2XTJE 1FO0A 4OQTA 2AHIA 2NUPA 3HJEA 1SYVA 4NP9A 3ARSA 4PJCA 4ZSOE 1LO2L 3SYAA 5A2BA 1NMAH 4I5BA 4JN1L 5D1ZI 4LSQH 4ZXBB 5LAPA 3RI5F 1DBBH 1AGEB 3QORA 5GPRA 4AEFA 3UL7A 5D93C 1QG3A 2XV3A 3HAEA 1V05A 2FJHA 3N40F 2JKSA 1CDYA 3X1GA 5DJ6A 4FCGA 5HDHA 3RJOA 3W3MA 1NCIA 2AJUH 1EIBA 1T5KA 4ZQKA 2O5YH 5T1MA 5KVDH 1FCGA 3MREB 3IEAA 1SJEA 3LVEA 4LDEB 1A7QL 4NSKA 5IHWA 3AFLA 1Z7JA 5C0AD 3TM6A 2IDCA 4RFOL 3KBHE 4PJEA 4N2LA 1THAA 5F89B 2O5XL 4Q9BA 1R6VA 2P5WB 2CDFB 3AROA 3B34A 2FGZA 3TV3H 7TAAA 1H9DA 1FFOB 1FIGH 5EPMB 5E56A 1BVNP 1K2DB 2EC8A 4NOBA 3SGDI 3V52H 2ED9A 3IJHA 4X0NA 1DQMH 4L1DA 4YUEH 2R29L 4F9LA 4UT9A 1RZFH 1XIWA 3HI1B 3NABL 3SJVD 3T08A 4HCRA 1CC3A 4FQHB 3VXUD 3J27A 1TZAA 3NTCL 2EDHA 2PYEE 3ZOAA 3SKJH 2HLFC 2FO1A 1PYWB 3QUZD 2F8IA 4XN9A 1TEFA 3LYRA 5TK4A 5DO8A 4PJHB 4Z7QF 5K39A 1AXSA 3EBAA 3FFOA 5F88A 4AJWA 4CSPA 1EFQA 1TEYA 2RFXB 2Z4QB 3PXJA 4HQQL 4OH2A 4OLZL 5H4YA 5D7SL 5HYQA 4Q0XH 3MXWH 3RTQA 1MJ7L 3Q0HA 1OGAB 1G0XA 3KBEA 2WHVA 2R2BA 3ML8A 1PFOA 4KQ4L 5DD1H 5HGBB 2MCMA 2AC0A 4G7VH 2YD1A 1NUFA 2RCSL 1FL5A 2KYIA 2YQ3A 3CNKA 3I02B 4ODXB 1QA9B 3UTQA 4HIQA 5IVXB 1UXLA 3N04A 4JFXA 2XZQH 4J3OF 3FO2A 2XFXB 1T5WB 1VGKB 1ORSA 1E0OB 4LASL 4PJHE 1CPUA 2WP3T 4KKLD 2XRAL 1PBYA 2X4RA 1PGVA 2Q76B 1JZFA 3BH8B 3N0AA 4NQDA 4RGND 2RB8A 4PJGA 4X8JA 5B1KA 5CIPB 3SE9H 5FV1L 4NX0A 1RJLB 3DOIA 3FT1A 3EGSA 5J89A 3HE7B 5J4MA 2UXFA 2VJ0A 2OYLA 3CLFL 1AJ7H 3I6GB 4BH7B 3U6RB 2LE9A 4F2MA 4R7NB 3TLRA 2IAND 1CD1B 1IIKA 4QAMB 4IRZA 4NO2A 4UIMA 1SHWA 2GTZA 5HHXL 1KXTB 2D7OA 2Y06L 3CHPA 4PREB 4HCIA 1BYOA 1MHHB 5I5JA 4ZI8A 3NA9H 1OSYA 3EIFA 4HUKB 1D7BA 4JM2F 1AIFA 1L9MA 3RWDB 2A4ZA 3WMQA 4KVCH 1OLLA 4ESKA 1EV2E 1F3JA 3B5GA 3QHZH 1DVYA 5C9JB 1FZJA 4LOFA 4PD4K 5CD3B 5IW6A 3K2UH 1BG9A 3C5JB 2VXQA 1UB5A 3KLKA 4ZK8A 2BWIA 2BOBA 4WLCA 5LVEA 3D69A 1WFIA 1B0GB 4I9WE 4PJAE 1ASOA 1PX4A 5E00A 1N6QH 2OZ4L 4MSWA 1G7LA 4K5NA 4N1EA 1BEYL 3T2NH 2XICA 5D6DC 3RY4A 2EICA 3T0VA 1I9JH 5I82A 3UJIL 5F93C 4Z5RA 1JV5A 1SQMA 4Z3EA 1K4CA 1PL3A 2GITB 2C9SA 1HJBC 4NCDA 4ZOBA 3OZ9L 2MNWA 2JB5L 1MFCH 3AT0A 2N7SA 2EYRB 3TURA 1ETA1 1KDJA 2BXZA 3OPZH 2XZAH 2EVFA 3ZZLA 4LLDA 3VD4A 1E2ZA 3IE4A 3SGKA 4UQ3B 4JQXA 1CFNB 5C0CB 3RVVD 4A2MA 3W3NA 1RK1B 4ZZFA 5L6YH 3FRUB 4JG0H 1EXUB 5INDA 3BZFA 3C60A 4DGWC 4U0RB 1A0QL 4U1JB 1VAHA 5GS0H 4Y4FB 1E28B 5EO9B 1BD2B 1MXDA 2QKSA 1AHWA 1EFXA 5HI5C 5CN3A 2VE6B 4KMQA 3KLQA 4N2GA 3I6KA 3BD4A 3U79A 5IHZB 1LEIA 2F5AH 1F41A 4RLDA 4JRWA 3GBNH 3ZK0A 2PXYA 5F7KC 2C1OB 1F3DJ 1VACA 3QCUH 5EN2B 1I7RB 3LQAH 1EEZA 2BVUA 1QQDA 1MRCL 1KGWA 2BHYA 4WFHD 5CGTA 5KYXB 5MEPB 1XF4A 3VWJA 3QYCA 4G80A 4TL5A 1OE2A 2CHWA 4L18A 1SVCP 1MFUA 3SKOB 1ZVHA 1ZV9A 1KZQA 1I75A 5KYUA 2CSPA 3TBSB 1WTLA 2MMXA 5JIHA 1JGEA 1LEGB 2JXMB 4IM8A 5AW7B 1BD2E 3F5WA 3V2AR 4HLEA 1IEBA 4P5KA 3GM0A 3X12A 3Q6FA 4N0YH 1E43A 1CBVL 5I30H 2J44A 1XGPA 3U30B 2V37A 2FWUA 3VH8A 3JUZA 5IUCA 4NUQA 3D85B 2JNZA 1WWAX 3AM8A 1JZHA 4HMCA 3B9VA 3N9GH 1U58A 1YYLL 5BS0D 3F7KA 3GSUB 3QAZC 5DJDB 5JXEC 4AENA 2C3VA 4DNLA 3U4KA 2DLHA 4FLQA 4MS8D 2FGWL 1DZ0A 4W9DC 3EHBB 1KUMA 1KFAH 4N24A 4HH8A 5CBAA 2WWMD 3KPOB 3Q5OA 3ULUA 3CQQA 4HJGB 1P4UA 3HC3H 1HEJC 1X5IA 4V33A 1ROWA 4EVNB 4NUGL 4B53A 3DBXA 4GG6F 4HUUA 4AJVA 1GZPA 1MEXL 2FTAA 5BZWA 5IWLA 3VU1A 2O61B 3CWGA 1IC4H 4PP1C 4J2XA 5FCUL 1S8DB 5DK3A 3SY0A 3MLTB 2GB2A 1E90A 3SOBL 2X4OB 1CVSC 3OJ2C 1RSFA 3M7OA 4WWKB 4MKTA 1OB0A 5D2LF 3IBEA 4EQ2A 2XTJC 3K6OA 4UTBA 5E8PA 3MODL 2WCSA 3HS9A 4DW2L 4NZJA 5EDSA 1K4DB 2ADIA 3NUKA 1CICC 4WO4C 5AL8A 3SEPA 4MRCA 5BW7C 4R4BA 1UXSA 4OCMC 2XDHA 2WZ0A 3ZDXB 3WTTA 3ALXA 2V5YA 3D33A 3EYQC 1QWHA 3SDXE 4TMPA 2CKBH 1JPTL 1WA0X 1ZHBA 4RVBA 3WFZA 1H3PL 3TWCL 2UYLA 2KZ1B 2ZJSH 4M61B 5HI3D 2E7MA 1GMIA 3WS6A 5GJTL 3RZWA 4A6YA 1P5UB 4IQHA 2ZWNA 3GMNA 1FSKC 3ZRSA 2ZWKA 1HU8A 1M2VA 2V5RA 1ECYA 1GCYA 1D9KC 1T4WA 1TITA 3BAEL 3VFWB 3G5WA 3PWJB 3L1EA 4BXVA 3WDJA 4ZXBC 2WMPA 2I26N 4ZX4A 3FQUA 3H2QA 2IALA 2X9XA 4HEMA 1TVBB 1DLHB 3ZDXE 4BSVA 1BFOA 5JW4R 2ZCKL 4Z7WF 2WOBA 1CO1A 1T1WB 3S4SA 4AIEA 2AXGB 5BZXA 1MNUL 1U0QA 1LEKA 4DH2A 1OOWA 2L3BA 3BGMB 1AO7E 2GTWA 2HRPL 2NQDA 3R18A 1F90L 1AXIB 1PMYA 3MLRL 4GQPH 5HYJA 2F58L 1X5KA 4YBLB 4PIBA 2I27N 1T6WA 2KS0A 2YD0A 3FRPB 4LFHG 1F1AA 2WIIA 2EIEA 5DJ8A 5CEYB 1YNTA 4IEFB 5J6GB 2PO6D 1YJDC 4AE0A 3W9DB 4B7IA 5J7CC 4W68A 3F84A 3HLAA 2DKSA 3MACL 3ZL4H 1RMFL 2BOLA 1UKSA 1KIUB 2VERN 2X6UA 1VA9A 4GP4B 1EA9C 2DQCL 4XAKE 5BPPA 2H0EA 5IQOA 2E7LA 3QA3B 3K6NA 2J71A 3PMHG 1GYCA 3SDAA 4FHKA 1KLGB 1OK0A 3UP1A 2BRRH 3N91A 2DLTA 4KO5A 1A3RH 1Q72H 5TF1H 4GAGH 3WN6A 2JKXA 4B27A 7CGTA 4TSAL 3FT3B 1UOKA 3RFSA 4AM0Q 5FM8A 4P2OD 3GRWL 3MJ8B 1F6LL 3WE6B 1Q1JH 1H3GA 2XSKA 4MXWH 5K93A 5B38A 3NDZE 5DUBB 4U08A 2X4NA 1D5BA 1P4IL 2MQ0A 2Z93B 1ZV5A 5BRQA 3QIBA 1I85C 2NNCA 3HB3D 5KJ4A 3VD0A 5E6RB 2JI1A 1NGWA 4N8PA 4EN3D 1OSEA 1GAFL 5D7KE 3OLEA 3EJUA 4DGYH 3MJ9L 3B7SA 4K5LA 3RUGE 3GB7B 2IGFL 1U3ZA 4QHUA 5CWSB 1HH6B 5FM5M 3IN2A 1BPLB 4NO3A 3RWEA 5AKTA 5CSZB 3INUL 4XN8A 1A7RL 2R1YB 3UIYA 1KGYE 1NGZB 4Z6AT 1AOHA 4AV0A 4UT6A 5FYKU 3HE7C 2X7LA 3CQPA 5DVMA 2GJZB 3VI4A 3ECBA 3C6LD 2K7QA 4I18B 1I7ZB 1NFDB 4M3JA 3KPSA 2AJ3B 4HK3J 1HCYA 4JJ5A 1KGIA 5F9AC 1AE6H 4WHTB 3IKCB 4IRSD 5JYLA 2NY5L 2AK4D 3Q1EA 4XPAH 2F53E 1V7ML 1E5BA 3GSOA 1TDQA 3DHMA 4L5FE 5C0EB 4G8IB 1I8MA 5C0ND 4JY4B 5AOIA 5IJDC 2A0LC 4YHOL 5IROA 2PWEA 5A7EA 1F5WA 2OYMA 3FT0A 1MRDL 3STLA 1BOGA 2EINB 2HN7A 3Q3GA 1GKOA 3ESVF 1KIQB 3AXLA 4KZ0A 3U9PH 2YKKA 4XVUC 2QGBA 3LV3B 2BSED 2RACA 3O4LA 4N0UE 1C16B 4NDMA 2VR7A 1Q0YL 3FFCE 4PWHA 3L4TA 3QJFA 3ZE2B 1XX9C 2VXVL 3QJTB 4E9XA 5HHQA 2YD4A 1Z5LB 4WKZA 5B8CA 5IB2B 3NMEA 4N1HB 4XP1L 3FTXA 4YHPB 2AI0H 2ZF8A 4WTZA 3UABA 4B9KC 2V33A 1T21B 2LT9A 1KJMA 1LO5A 5GGUB 1SOSA 1TT6A 2BVTA 3OSVA 4OIBA 2FJGB 2VDKB 2Z91A 3NEXA 1UOWA 5EBLA 2V3FA 5AUMB 4BK8A 5LNGA 2NRDA 3V0WL 3WLBB 2QSCL 1J5CA 1QP1A 2VTFA 2X42A 4NJ9H 2IFFL 1OTTC 5IESH 1CQYA 1BA9A 4M5ZH 1ES0A 3F00A 4LNVA 4LCUB 4NBYB 3MRJA 1KBWA 4U0RC 1T03L 4PB0L 5HYSA 4Y4FC 2FECL 3HFFA 4MJJA 5HDRA 1ZHKA 2ZG3A 3TCLA 3TCTA 4BD4A 5DT1L 2LVEA 1FNHA 4DFIA 3UROR 4X4MA 4ODUB 3N1FC 1SEBA 2APXA 3D2UA 3EFDH 2VLLA 5DHYB 3WS3A 1A9EB 1TNMA 2QPEB 2ZP0T 2PCPA 4YE0A 5JOPE 4MB5A 4QRFA 4HWEL 4OLWL 4R5XA 5ALCL 3VFPA 4DN3H 1KXVA 2HLFD 4MB4A 5AALA 4UDTB 5LWYH 1ITBB 1CFSA 3FDWA 1A7PL 4X6CE 1OT4A 4X7SL 5BV7B 3GJFK 1BVKB 4J3OH 3NAAH 1E4XL 4OBSA 2W07A 3VXSB 4LKCA 1UM4H 2NY1B 1IEAA 1YEDA 5DHVH 5FYKL 4P2QA 2JJTC 3NJGA 3U30C 3IMTA 1QTPA 5IMMA 4Y2LA 4LEOA 4X6FA 1NCHA 1M9LA 4MJ6B 1MJJA 4JAMA 1I53A 1P7KB 3GINA 4NAMA 1MH5A 3A4AA 4ZUWB 1OP3K 2J12B 2PW1A 2RQ8A 1A6UL 4ZDHA 4RCWA 1BQUA 2UVFA 2HLAB 4FP8L 4WHCA 5C0BA 4XX1E 5KSUA 4MMXA 1CYWA 5I8EA 1HAUA 1GYUA 2AJSL 5MP6H 5E8NB 2XWXA 2BNUA 2CBOA 5EUKA 3IETB 4E0RB 4PG9B 4MJ2A 4NGHL 4F2EA 4ZPTB 3QQ3A 4AEIL 1LO2H 2O6SA 2YRZA 3JV0A 3KLLA 3NSFA 5C8JB 3PL6A 1MLCB 3FUEA 1UVQB 5CEZL 3F65A 2GVYA 1R5VB 5T3ZD 2KI6A 3RKPA 5J1SC 4K94C 1U93B 4ZMAT 3ZE0B 3GQFA 3CFQA 3OMAB 2HFFA 2WBXA 1PVHA 2WCGA 3HRZB 3P40A 5I0WA 1JVLA 1U3HA 4JDEB 4WWKC 4XMLL 5FGBA 1P2CA 1SN0A 1U6AL 1NDTA 2HMIC 4KH9A 3PWVB 1A7QH 1HL8A 1UD5A 4JM4L 4WNJA 3IDJA 4LSPH 3IE9A 2HT4C 3BKYL 2FHCA 3V5DB 5F1SA 3BIBX 4WI2A 3RQ3A 3D0VB 3RJDA 1DJHA 5D6CA 5MENA 4CVXA 4L3EE 4YO0B 4ELKB 2I7SA 2C8NA 5JUEL 3RWFA 1MFDL 2BY3A 4AX3A 2B9AA 4HV8B 2K6YA 4Y1SA 3Q44A 2IGTA 3EYFB 4JO5A 3ZE0E 3NTCH 4O58H 1P5UC 3UXFA 4F57L 5GHWH 1UH3A 3IJEA 4H0GA 1SVBA 5H2BB 3VG0H 1S6NA 1MCPH 5ID1A 1HHKB 2QLYA 3QNYA 4G6FB 5IB3B 4HQQH 3BFWA 4LGRB 4F9PC 3I74A 3KBFA 1JL5A 1UYWH 1QSFA 4QDGA 4OV5A 1VGEL 4U2YA 5K9QG 1GZQB 1IBFA 3KPPA 2XX1A 4KQ4H 3RURA 3TWYA 2RCSH 1XZ0B 1NC4A 3O0RL 4C47A 5KBPA 4ONHB 3H2WA 2EKSA 3AWGA 3B5HA 3OHMB 1BQHA 3U46A 2J56A 3IJYA 3QZWA 3P2BA 2F0CA 4LGSB 4P2RB 3EF4A 4JVUA 1NFKA 1BBJA 3S3CB 4U1NA 3BKJL 4YBLC 2O6EA 5KZCB 5T3XL 3HHSB 3MUGA 3NRFA 4JKMA 1I8IB 5ESQA 3MV8D 2JKRM 3UTTA 4XNYH 2VZTA 5LN8A 3E6FB 3NJLA 5I28A 5IY5B 1EEQA 4FC3E 3TV8A 1HZLA 3MOAH 5DFVC 2CDGB 1CF8H 3FB6B 4YHKH 5K1VA 2KPNA 3LXBA 5AW8B 2YA0A 4J3OG 1L9NA 2JJSA 2ITCA 4PRHB 4WU5B 3L4CA 5I0YA 1M6OB 1G6VK 2A9DA 4AM0B 2D7NA 1LO4L 3BMWA 2QVFB 4G1EB 4NP4H 3FQXA 3GJEA 3KNBA 4QRSA 5DJ0A 5I6PA 2Y06H 5HHXH 2PTUA 4CNCA 3DIVA 3L9YA 1E8YA 2CUMA 2JJUA 2GSIB 2DQEL 1HE7A 3CLWA 2E6PA 2YA1A 4CA4A 9CGTA 2WB1A 3REWB 1NCDH 3EG9B 1MPAL 4LOUD 5CD5D 4KBPA 4KNTA 4G9FE 2D3LA 3G5VB 3QG6B 1RJCA 4XCFH 5IB4B 3JTTA 3UCQA 3T0EA 5DURD 2DBLL 4FLRA 1Q9LA 2A9AA 2WWNA 4O2FA 4PJBA 4ZT1A 1BLNB 1X9QA 1OWRM 3SO3C 4PRHE 2FIRT 3KCWA 3TH3T 4EN2A 5JXED 1HXYB 4H88L 3FTSA 4S1QL 3BPCB 3QDJD 3UJIH 4HGMA 1O6VA 1T1XB 2IH3A 2YKLL 4RAUA 3BHBA 2JE8A 4ACTA 1A4KA 1N4XL 4J28A 1IBZA 1OB1A 1FS2A 4URKA 3L6FA 5D7IA 4F24A 3VFSB 3SE3A 3I84A 4QT5B 1AI1L 1OE3A 1ZT1B 2R0LH 3KR3L 3VGAB 4LHUA 1TVHA 1OCWL 3BKML 2X6BA 4EDWL 4I18C 4H5SB 4NQXA 1WTGT 4FYQA 3FCTB 5EU6E 5CNHA 5FIEA 3MNVA 3IBOA 3OKEA 4U6HB 4I3SH 5I75C 2XTJD 2ICEB 3EGXB 4FYRA 2PPAA 5INCB 1KIPA 4P2CG 3HN8A 1DP0A 1A25A 1UB6B 3EKCA 2NY4B 4ETQA 1MFAH 4TQ8A 1HSAB 3JQOB 1R33A 1CICD 4WO4D 4NZRM 3KXFA 1OIOA 4LARH 1LP9B 2MPVA 5EU5B 3MSPA 3PDDA 5A2JH 3OGOE 4LU5H 1DDTA 2W65B 3EYQD 5BZDA 2V9TB 4KC3B 1VHPA 5DQ9A 2QTEA 3IS1X 3VMOA 5A6MA 4L3AA 4UV7L 3FQRB 1DDHB 4X4XB 2ZSWA 4E9VA 4LPCA 5FF6A 5D3IA 1FGNL 3DUUA 1MRCH 2Y22A 4JB9H 4URTB 4FHBD 3R0NA 1NLBL 5H37A 4HOWA 3K71A 4JFOA 4FFYH 4KQ0A 2FT8A 5DZVA 3W38A 3LMJL 1M42A 4WP6A 3J2PA 3MRLA 1D9KD 3UTOA 1SXZA 2OMYB 5C3LD 4XN7A 2IPUG 3DLQR 4OV6F 5I15L 1FDLH 1KYOJ 2XY1A 2CIKB 4NZDA 1J1XL 4WEMB 3RGVC 4Z23A 4WY7L 3MMEB 4QHPA 3TYFB 4DO6A 1RH8A 1CBVH 3IGAA 3F85A 1R5WA 1UWYA 4LLYB 3WJLA 4OGYL 2HYMA 4BFNA 2A9BA 1JZ8A 3BWUF 4I2XE 5EG6C 4MLIA 4FNTA 3N50A 1WQVT 3N85L 3VQMA 2MEJB 4ZW7A 3F04A 2CA3A 3KDPB 3B83A 2H9GB 4NQCB 2FGWH 4YR6B 2A2QT 2J4WH 1KPUB 4NRZB 1TXKA 4Y61B 1IM9A 5KVFE 4BWUA 5E4EB 4GAYB 1B0RB 1S46A 5FGCB 1T22B 3ATDA 4NUGH 3RPIA 3VXMB 1RLWA 2IDFA 4MCNA 1NJ9B 1R17A 2GIXA 1UENA 2A6KB 3QFGA 4XPBH 3SY6A 4HS3A 5KG9A 5FCUH 2QZQA 1HHHB 1T0MB 5EUOA 2QZ5A 4BQ8A 5CN2A 3NIFB 5FFOA 3QQNA 4PM1A 4HKJB 5AD0A 4HIEB 3K46A 1PPIA 3WNMA 2YAQA 2CR0A 4MD5B 5BRZE 3ORJA 3NCWA 2DOCA 3MODH 4APQA 5BV7C 2NDFA 5AVYB 5IMLA 5JXAL 5DK0A 2ZCLL 1KPRA 3FUDA 1U8QA 2UZXA 2NY1C 4GG6A 4JDTH 3EYVA 2FHFA 1OGAD 1A1MA 1WA2X 4KY2A 4RFEA 5FGCE 3IPFA 1DN0A 3AWEA 4XGOA 1JPTH 3HG0A 1H3PH 1AGDA 3QQ4B 1M0ZA 4P4RA 4WJ5B 5B7MA 1RUKH 1U8CB 1C08B 3NIFE 1J8HA 3D06A 1CI3M 1TO4A 1EJ8A 5L2JA 2F8XC 5GRJL 1E5AA 1OK8A 1EHXA 2P24A 4KZDL 3CFBA 3TONA 2G4GA 1XSKA 1K8DB 5IHUL 2MQGA 2CMRL 1KLUB 2I7OA 1QFHA 4XNAA 3ATAA 4G59C 4P9HC 4GUQA 5M95B 1FO0B 4AMWA 1YYMH 2NUPB 3TN0A 4DFHA 1AQHA 1ACZA 4PJCB 2UZYA 1RPQA 3P2DA 4I5BB 4BSWA 3BVNA 1GYAA 1QBLL 3QORB 3HRZC 4O9HH 4AGOA 3B7UX 1MNUH 3HAEB 3HCVA 2FJHB 2KT6A 4OLYL 5AYUL 1NEZB 3T1FA 3R1GL 4KPHH 5DJ6B 4B95C 5LQBL 2H1PL 4ZQKB 2X1WL 5T1MB 3CHQA 5EZOL 1SJEB 1BWMA 3HRPA 3ARWA 3CN0A 4NSKB 5DC4B 1LWJA 2MPAH 3QH3A 2A0LD 2CM5A 2YK1H 1FAIL 4A7UA 1PD6A 5KSAA 3FU6A 4UMGA 3KW8A 3D12B 2X89D 3G7TA 3OG6B 1QHQA 1RMFH 3IJHB 4PJCE 5E0QA 5IZ7A 3WELA 1D6VH 3REVA 1TJGH 3S2AA 3P9MB 3R19A 3ZR5A 2PLTA 2Z82A 1F6FB 4YLQT 3CBJB 4LAQL 3UZEA 1P84J 5E95B 4TSAH 1GRWA 5HPMB 2XVBA 4WK2B 5K39B 1AXSB 5F88B 4YXHH 4PJEE 4BQ6A 2F61A 4RZCA 5HYQB 4R6AA 3QJOA 2Z81A 3RTQB 3T65A 5CILH 4M8QA 1TTCA 4P0DA 4X98A 1OTTD 3D4GA 4WEBH 4XP4H 2VL5A 2R2BB 3ILQC 3VGDA 1LO0L 1FL5B 3CZJA 1BD2D 1J87A 5FYLL 4S1DC 3T6WA 3MJ9H 3GLEA 4JFXB 3LXAA 4LL1A 2IGFH 3FO2B 2WWOA 2YLHA 5J9PA 4FKEA 3FMGL 1ORSB 5HJGA 3RPKA 1JHLL 3V0GA 1ZPLA 1A7RH 3ZDYB 4AJ0A 4R96A 3CG8A 3UBXI 4OJEH 2PPCA 3D05A 1KOAA 1ZT4A 2L8AA 3O81A 3MRFA 4NQDB 4PJGB 4X8JB 4XVJH 1B4JH 1NCWL 2AGJL 3L1OL 5F3HA 1NUDA 1IAIM 1WYJA 3EGSB 1FAKT 3KCPA 4KROB 1FHGA 2GPZA 4N2AA 2E9GA 5LCVA 4XT1C 4K7PY 2RA8A 3P30H 4KVPA 3Q05A 3ULAA 4A63A 4F2MB 1Z0MA 4AQEA 4NQEA 3ZKMD 4UIMB 2GTZB 1TPXB 3FOLB 4ZOAA 3AXHA 3FN0H 4M02A 3PNRB 4UTAA 4G8AC 4A04A 4ADJA 2FUQA 2BVOA 4YHOH 3HG5A 4XBEH 1AIFB 1CDUA 2XUWA 5BOZG 1MRDH 2ZXDA 4HA1A 3D85D 3WEBA 2IJ0C 1F3JB 4OLUL 3NJFA 4N8CH 3FH7A 1FZJB 2V70A 2VJXA 4PJGE 5IW6B 1O7DE 1BGXH 2NR6A 2AZAA 3JWDC 1UB5B 2VXVH 3KBPA 3WFDL 4NHCL 2BOBB 1XMWA 3QWNA 1E42A 1TEGA 3D69B 3FCUB 3LRKA 4QO1A 3CVHL 5E00B 4MSWB 2E6QA 3R8QA 1P6FA 1G7LB 4D3CH 4DKFL 4JFHE 4F2ME 3RLSA 2ZXWB 3I6LE 5KVEL 3H55A 2B08A 2YD8A 4Z5RB 1JV5B 1XR9A 3OJMB 1K4CB 1A1OA 4Z7VE 4ZUSA 2NY7L 4K3HA 1Z7XW 2A9MH 2OTPA 4M00A 3VGAC 3U9UA 2LTQB 1NBQA 3QRLA 2HTLC 4JQVA 2NTSP 2O5ZL 4AK1A 4DQOL 3WEXA 1ZGLA 4LLDB 2YMXL 4JO2H 2HMID 3UG3A 3Q9QA 3OR6A 3PIQA 2F74A 2ICEC 4QTHA 3ZY7A 4AUJA 5IHBA 1J9CT 1KEML 1BZ8A 2W94A 2HT4D 1SBSL 2NY4C 2D3VA 5INDB 5DRXA 3BZFB 3WEMA 3WPGA 3C60B 4KRPB 4I1RA 4JFVA 3NZHH 1KGXA 4O00A 3KJ4A 1AHWB 1EFXB 3LZRA 2JTYA 2EYTA 2YEQA 4N25A 3LZFL 4AYFA 3OGCA 4KRLB 4GUCA 5IV2A 3I6KB 1BECA 2Q8BH 2CJUH 1LEIB 3QZBA 1O0VA 4QKXB 4CSTA 5A1AA 3AY2A 1AO7D 4JPVL 1EQWA 3RWJA 2PXYB 4M6NH 2ENSA 4LSSH 4OLWH 5ALCH 1CYGA 1VACB 2HJLA 3EOYG 4F8PA 4K2UL 3S98A 1EEZB 4NNPL 1QQDB 5CEXA 5I8OH 4BZYA 5FYJU 4PV8A 1A7PH 1XF4B 4DP8X 3O9WA 3VWJB 4G80B 1I9EA 4AL8H 3CFCL 4OCSH 2ZCHL 5L4MA 1URIA 1KEGL 1UZ6E 2WXRA 1W0VA 3S97C 5KYUB 3M88A 1QFWM 1B90A 4NQVB 1D5RA 4X9YA 4OR1A 1JGEB 4KKRA 4YLBA 5FKAA 3F5WB 2IAAC 1HTYA 4PLNC 5I23A 2CRZA 1ZLVH 3QYNA 5HTSA 5EEUA 4P5KB 2CGRL 4MD0B 2YD9A 2EO9A 3Q6FB 5TPWL 3X12B 3AQZA 1NOFA 1XGPB 2GBAA 1N8OE 3WXVL 4G7YH 3ILEA 5HVFB 1WAAE 2ZG1A 3BXNA 1A6UH 4Z77A 3CLEH 3MAWA 3L3IA 1PLCA 4UOZA 5J6HA 3MCYA 6FABL 5DS1A 1U58B 3KPRA 2ATPA 1G84A 5KANG 4GLRH 1NCJA 4JUSA 5AFAA 1NOLA 3ZKND 3ET9F 2APWA 4AENB 4PJDF 2C3VB 3D8MA 5E4EC 2E7BA 1T1YA 4AEIH 4YFLF 2QPDB 5CBAB 2VDPL 4Q4EA 5I1DA 4P5RA 4WTXA 3RI5K 2YC1A 5E2TL 4GSQA 5EEVA 4E68A 4K5OA 2EUXA 2VR9A 3DBXB 4GSDL 3O2DA 1QABA 4HUUB 3V9CA 1GZPB 4PI0A 4X6DF 1U8KA 5D7KD 5FW6A 5BZWB 1U6AH 4HIJA 3SY0B 3BPNB 3AADB 4JM4H 1PDKA 2WXQA 4MJIA 4OF0A 2Y69B 4HBQA 2D2OA 5CAYB 3T0AA 3OXSA 4FL4B 3LPGA 1CK0L 1J0KA 1DEEA 1W16A 4Y9EA 5GRVK 2R59A 4R0AA 3TBVA 1QZNA 1TZGL 2JIXA 2AAAA 4MQWX 5E4OA 2ADIB 4YSPA 5B3NA 5JUEH 3B2MA 4IBYA 1MFDH 2ZXAA 4R4BB 4A67A 1UXSB 3DSFL 2VW6A 3P9LA 2XIIA 2BNRE 4H26A 5DMJB 4TXVB 5KVMC 3GXUB 4ZW3A 1D2PA 1BJ1J 1CD9B 1RZGB 2EIMB 3QXVA 4F57H 5M7QA 2VR3A 1IAKA 2XACC 1ZHBB 3RFZA 1TZIA 1A66A 4AEHL 3N1GC 2GBTA 2YWYA 2F53D 3HZKA 1BYNA 4HWBA 4MD4A 3G08B 1DLFL 1OALA 3K72A 5LUMA 3GSWA 1DCLA 4A6YB 2LAAA 3GMNB 4BFRA 3E6HA 1ASPA 1M2VB 3H3BC 2Y0SA 4H1LA 5BJTA 5JW4N 4OAWA 1HXMA 2B5IB 1IFRA 5EOQL 1BX2A 3KWXA 5A16A 1ETB1 2F7QA 1EHLL 2WMPB 3FFCD 1YAZA 3KE0A 3FQUB 2IALB 2OYKA 3QORC 1LDPL 3ZHFA 4HXBL 1HZHL 4B3EA 2OK0L 4IRJD 3RGHA 4BSVB 4YQXL 4ZO9A 1BFOB 5FYJL 1FL6A 4R26H 4K5PA 3T09A 3S4SB 3V9FA 4LGPB 2NSXA 3PDOA 4DKTA 2BHZA 5GRYA 1LEKB 5ABDE 2AQQA 1DANU 2AITA 2GTWB 5ADOL 4MB3A 5C0IA 5HYJB 2OAAA 3O6LH 4LXSA 3DXAE 5HGDA 4XNZB 2ED8A 2WSPA 3B8YA 4JLRA 2WIIB 1ZJAA 3DI2B 3TT3L 5DJ8B 3NJXA 3U25A 1YNTB 4HCFA 4PV9A 3RHWF 3ARTA 1ZS2A 5BUAA 5LNDA 4F9LC 1KTCA 1XIWC 4HEME 3HLAB 4GFXA 2HX9A 5L4JA 2WGXA 5FFGA 4WI8A 9PCYA 3KGUA 4UQ2A 5KWYC 2NXYB 2A9CA 3WO4B 4KJPC 3VSQA 2AEQL 1WDAA 1FVCA 1A8JH 4EDXA 3SDAB 4YZFF 4NI3A 1T7WA 3RGVD 1NFAA 4EI5A 2J57A 1ZDQA 3VQ1A 4PD4J 1MWAA 3E9UA 4JRYA 4OY9A 5JOPD 3P0YL 4KNUA 2FH6A 3RTQC 3WDHA 2QEJA 1IBDA 2FX9H 3L5XL 2J55A 1JERA 1U2HA 4WTWA 3HJ0A 1RP8A 1NOAA 4RSVA 5B38B 4BGDA 2R8SL 2X4NB 1D5BB 1QBAA 2DQTL 2O6PA 3P72A 4YFDB 5CLXA 4FMFA 3QIBB 3LKQA 5F6HJ 4HJSA 4AEEA 2IH9A 2YKLH 3V7AG 1KELL 1NGWB 1JZGA 2WZ6A 2M2DA 4ONOA 1GSKA 1L0YA 1NSNH 4L4VA 4W6YB 5IQNA 5JDSA 2YS4A 2X2IA 4QHUB 3VA6A 2ZUWA 3EDEA 3GS7A 4U6YA 1TO5A 3VA2C 3O2WL 1AI1H 5DQDL 2BY0A 4NO3B 3LKPA 3UBXA 3V0AC 4UZGA 1O7DC 4NM8H 1BZOA 5JHLL 2BFVH 4N3TA 2BNQA 2YSSA 3KLDA 4LDCA 4NPJA 4KROC 4OF5A 1TVDA 2X7LB 2Q86A 4OLXH 1XGYH 4M5YL 4YWGL 4BZ1H 4Y2OA 1J48A 1FYTE 2CHNA 3VI4B 3TF4A 4AQZA 1CLCA 1QSZA 3ECBB 3WY2A 2F7IA 4E42A 2GI0A 4EZMA 1TPXC 3KPSB 1MLBA 2NY1D 4BKSC 3E1ZA 4G8GE 4JJ5B 2GQHA 4FLSA 1IBBA 5DVOA 4E2OA 4OCRL 1M9SA 1C5BL 3BE1L 5IUSA 1F2XK 1G7HA 3D0LA 5D5ME 1YPZA 3CBRA 1JYNA 1WRFA 1RZJH 4JG1L 3BUYA 3GSOB 4UT7H 1E2VA 4BSJA 1XV8A 1I8MB 3HPLA 5FM4A 1ORQA 1WE5A