1XEUA

Crystal structure of internalin c from listeria monocytogenes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
263
Chain Sequence
b'ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords internalin C
publication title Structure of internalin C from Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion
total genus 79
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xeuA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xeuA01
3VQ1A 3O6NA 2V9TB 2ASTB 4Z79A 5CMNA 4QBZA 4J4LA 1OZNA 2FT3A 4KT1A 3W3NA 1KOHA 4Z61C 4LSXA 1M10B 4R6JA 4KXFB 1OTMA 2P1PB 4L3AA 2V9SA 1OOKG 1IO0A 3ULAA 1XCDA 4XOSA 2IFGA 4BSSA 3RFEA 3C6PB 4XSQA 1LYQA 3E6JA 1M42A 1K5GC 2C9PA 3FAXA 4Q3IA 4WP6A 4R58A 3WPHA 2WFHA 3RJ0A 3FAWA 2JQDA 5FTTB 3C6OB 3G04C 4NKHA 5IJBA 4Z8GA 3M19A 4Y61B 3JB9j 4OQTA 1OTOA 4CNCA 4R07A 1M9LA 4CC4C 4HQ1A 2ASSB 5CMPA 2OMVA 3RFJA 1P9AG 4FCGA 2BNHA 2Z7XA 3CIGA 3DZEA 3W3GA 3G06A 2ELLA 5ICUA 4I6JB 1O6VA 4IM6A 3ZYIA 1A9NA 4R08A 1SQ0B 4XGOA 2OMYA 4PQ8A 1G9UA 2Z66A 4RCAB 1YRGA 1XKUA 2OMTA 3OGMB 4NKGA 2Z81A 3CIYA 4LI2A 4QXEA 5GS0A 4R0AA 4U7LA 2WQUA 3E4GA 5IYXC 4Q3GA 1NM4A 5IJCA 3OJAA 3E2JA 3W3KA 1FQVA 4CNMA 1QYYA 4FHOA 2RA1A 4C2AB 4R6AA 1XECA 1XWDC 4B8CD 2OMWA 1FS2A 1XEUA 2WQVA 1LTXA 5B0NA 4PEQB 5AWBA 3BCDA 4R6GA 3RW6A 3WPBA 2Z62A 2YA1A 4WYKA 3BZ5A 3P72A 4Z94G 4P91A 5D3IA 3KJ4A 4QC0A 3WPEA 2C9QA 4EZGA 4K17A 2C9RA 4CP6A 3W3LA 3FXIA 4PKIG 5B4PA 3WPIA 1Z7XW 1O6SA 3A79B 2Q4GW 3OJAB 1U0ND 3TSRE 3WPCA 3E3ZA 1DS9A 4YEBB 1A4YA 3REZA 2UZYA 4BSRA 2O6QA 2JE1A 4BV4R 3M18A 3SB4A 3UL9A 4C2BB 5B0TA 4U06A 5HDHA 4TZHA 5IJDA 3BCFA 3UL8A 1ZIWA 4R5DA 4FS7A 5GS2B 2V70A 4CC4A 1OGQA 2OMZA 4G8AA 2Z65A 2WQWA 5AZ5A 1JL5A 4LSCA 1M0ZA 3ZYNA 2UZXA 3RGXA 4FDWA 1FO1A 3WPFA 2RA8A 2WQXA 3OGKB 4LSXC 3ZYJA 1PGVA 2Y5QA 3GOZA 5LFNA 4FMZA 2O6RA 2CA6A 3BC9A 3UN9A 2OMUA 3W3JA 4LXRA 2JE0A 1GWBA 5AWAA 2BEXA 4P8SA 1OTNA 1O6TA 3ZYOA 3PMHG 4BSUA 3RIZA 2Z7XB 4M7EC 1DFJI 4AW4A 3WPGA 4R5CA 1WWLA 2OMXA 3G39A 4U09A 1DCEA 2P1OB 3OGLB 4RWTC 5A5CA 4KNGA 3RGZA 4PSJA 2Z82A 2R9UA 5AWDA 4LSAA 1IX2A 2A0ZA 4ARNA 4M7EA 1FT8A 1H6TA 5GMHA 3UL7A 3ULVA 1D0BA 4LXSA 3ULUA 4R6FA 4GLPA 5GQRK 4Q62A 3O53A 3W3MA 2ID5A 1P8TA 4MN8B 4R09A 2XOTA 5GMFA 4L3FA 4V2EA 3G3AA 4RCWA 4UFRA 5AWCA 5GMGA 3CVRA 1W8AA 4AY9X 3VQ2A 4H09A 4FD0A 4ECOA 4J0MA 3WN4A 1P8VA 1K5DC 2Z64A 2RR6A 5HZLB 1KOOA 1M9SA 3RW7A 2Z63A 4V2DA 4GT6A 2P1QB 4CILA 2P1NB 4U08A 3WPDA 4ECNA 2O6SA 3C6NB 4MQWX 4LI1A 1H6UA 4PERA 4AQ1A 1OT4A 4V2CA 2XWTC 3RFSA 2P1MB 4Z64C 3G3BA 4ARRA
chains in the Genus database with same CATH superfamily
3NFNA 5I6XB 1EZVY 1JZJA 3RVXC 3VXSA 4GW5B 2ZF9A 3PCYA 4LVHC 1S7SA 2BP8A 3EDDA 3WKPA 5SWQB 3NCMA 4JDTH 4WI3A 2P7TB 1BAGA 4BFIB 4N85A 4A04A 4XMTA 3DHMA 3GXNA 5DURB 1A3QA 5JNYB 2J8OA 4J3TA 1A4BA 2W8CA 4PRBB 4YGVB 1CK0L 1SF5A 3OHXA 1AR1B 4YO0B 1E50A 4PJIF 4KROB 1FV1B 2J6WA 4ENEC 2FLBT 4FLQA 4I0CC 4B0MM 2HRLA 2EYTB 4IRZH 3W11C 5IEKA 4OSUH 3U1SH 4DQAA 1YUHA 2CUMA 1T7VA 2LFEA 4JREC 3KXFD 2R51A 4KXFB 2NR6C 3CCHB 1IUZA 2VR8A 2PYEB 1X3DA 3VXMB 1NDGA 1HAUA 3BUIA 2JCWA 4KK6D 1OF0A 2VXQH 1KFAL 1NJ9B 4TNVK 3EH2A 5T3XL 5GRVL 5IG7B 3RNQB 3WS6A 43C9B 2EJ1A 1SQ2N 4XNUL 3WXWH 2LU3A 5D93B 3U7WL 1GAFH 5EA0H 3TN0B 2VLJE 3FSAA 5DFAA 5K9OA 4I3GA 2EDMA 3FTGA 4R3SB 5E2JA 3N85H 4B5EA 4ERSH 3HLAB 2V7NA 1WBYA 5IBTH 4UAHA 1BLIA 1J1PL 4MB5A 2X4NA 1ZT4B 5HHOB 4N0UA 4PWEA 2VZUA 2B15A 2ZKHH 3ARFC 4E0RB 3FPXA 4X6EB 1RIVH 4NBYB 3FOLA 2K6ZA 4F9LC 4GAJL 3H3BC 1N6QL 1U4FA 5GS2D 1NFDB 1E27B 3ISRA 2FIKB 4OZHA 1UXSA 1ZLUK 5J5EA 1CLZL 3EOYG 3HVDA 4NKHA 3JWNG 1Q9OB 2PPDA 3QPKA 4RLDA 4W9LC 4XPAL 3GQFA 3GUFA 4M6OH 2OI9C 4NERA 2JLPA 2Y2TA 4KO9A 4DVBA 3ZBMA 4M9PA 4X5XB 1QW8A 1URLA 2DV6A 3V0HA 5C08B 4WENB 4ZMVA 3VFPB 4XP5H 3BQUA 2GSIB 4EI0A 3RL2B 3PV6B 4QAMB 3RQ3A 3VXSE 8FABB 3S2AA 5I30L 1X7TA 2NY5H 4QKTA 5DVNA 4HHGA 1C8QA 4FXGB 1PNCA 4ZDHA 5TQ0H 5CMPA 5HDWA 3JWNH 2A6IB 1VF5C 1KIRB 4GY4A 4N2EA 2W88A 2GT9A 1W15A 2A6JB 1JCVA 4PMEA 1SY6H 2BSTB 1KTDB 4FCGA 1GKEA 1BIHA 1E6JL 4HH9B 3U9PL 3ARFA 3KLQA 5I73B 4XOEA 2EC9T 3U1QA 4JY6B 2WO3B 4YDKH 2VXTH 4XHQA 2YMXH 3CD4A 2O93L 2EDRA 2RQ8A 4OH2A 5JDSA 1WZ1H 1T3FB 2B14A 3NACH 1VERA 4XN9A 4EZJA 3ILQC 3R19A 1A3ZA 1KT2A 3B7SA 5GGSB 3UH8A 3IXTB 4ZFGL 1R4XA 4MDRA 3Q44A 3OB0K 5C0NC 4JN2B 4P2QE 4BQ9A 3T2LA 5LUMA 4HEPG 4GMTL 3EOBB 4M61B 1XGPB 3QI9C 3P3RA 4KKAC 2JKXA 5KVFH 5F0LB 5IW6A 3SCMA 5MEOA 3D30A 4DEPC 4IKIA 1MPAL 3QUZD 1NEZA 1OSEA 2JXMA 3F12A 3PS6A 5BVPL 5ITBL 4IGBB 5JXAH 1G6RL 4U33A 1ZHNB 4QXEA 1ZHBA 1VFBA 4JDVA 4AC4A 4EDXA 5KYYB 5MENB 3FB6A 4XNXH 5ITFB 3CVIH 1M05A 1UWEH 4P4KD 4AV4A 4JZOB 3FN0H 5DHDA 1UGKA 1YA5A 3MNVB 3QDMA 3AG4B 3CQPA 3HKZA 2A77L 1LWRA 2F7PA 4GG6E 1RCYA 5E2UL 1MFMA 2V9QA 4HWZA 5DGRA 3GXDA 1HSBA 1IAOB 4K5PA 3R1GL 1MG2C 2AI0H 3HUJF 4UCFA 1YPZF 3S37H 1ORSB 1OTSC 3HR5A 2BSED 3CIQA 4ATTA 1RVFH 3O4LD 4LLQA 3Q1SL 2OCJA 2DQTL 3QEQA 3EW3B 4NJ9L 5F8QC 3B1TA 1JNHA 4FQIH 1R3KB 3HZVA 4PCSA 2AEPH 2E4FA 5LXVA 3U36A 1CPUA 3ZRFC 4N0FA 2XYBA 4FG6D 2BIOA 3GO1H 2IFFL 4XN7A 1DVXA 3I2CL 1AQDA 4KY1L 1T83C 4BV1A 1AXTL 1SEQL 5EBWA 1DCLA 4EO5A 3MO1B 5I26A 4CMMA 4E9YA 2VC2H 1DSWA 5FA3A 3BZ5A 1FVCA 4CBZA 4XZUA 4I0KA 3EIFA 3FTWA 2G9HB 2LTQB 4TSCL 3IJSA 4RFOL 4WHTB 2CG9X 2XN9D 3S2CA 1ZK5A 3T3ME 1OD9A 4WY7L 2OYLA 1A9VA 2XVGA 4DP0X 4DP8X 1JGUH 4RFNC 3SOBH 3VU2A 4C4KO 3SE3A 2C9QA 2BJMH 1WAEA 1S2EA 1SJEB 2VR7A 5I1DB 1TQBC 4HS8L 1MG3C 3H9SA 2E8ZA 2HX8A 5JORB 1DFBL 1ZS2A 1BD2A 3P4MB 3Q8AA 5A2LH 5FUZL 4LRIC 3VXPA 1HFUA 5DZ9A 3THMH 5FGBA 5IW3A 4N26A 4RWYL 3IDGA 2DWYA 4A7GA 3IFNL 4RDBA 5F7EL 2YAFA 1HU8A 5KVGE 4KWUA 3EDEA 4LFHG 5B4PA 2OXHA 1PZAA 1QYGL 5F9DC 2CUAA 1T83A 4DN4L 1O6SA 3QQ9C 3ZY7A 5BPPA 4NJAL 4XN8A 3QJFB 4I2XA 1M1XA 3H7LA 3KXFB 4X5WA 3L3GB 1CD0A 3QW9A 4IOSD 2Z65C 1UT9A 4K2UH 2DIJA 1IGJA 3NTCH 3QDME 1DS9A 4PR5B 3K91A 1T6VN 5D7EA 1ZLVH 4IOIA 3NPZB 3NIGE 3REZA 1SM3L 3T0WA 3LV3B 1DJWA 4FLOA 1O7VA 2A9NH 4H8UA 1Y6KR 1VADA 2JB5H 3PWUA 4HIJB 4QGTA 5AVQB 5F88A 1B2WL 1R3LB 2E47A 3T4AB 1YNTB 3CLFL 4B9ZA 3AGVA 3B2VL 3P0VH 4K71C 4HVBA 4U7MA 1TZGL 2D4FA 2OCCB 3QEQE 4LRIA 4FP8H 4M02A 4U06A 1UJ3B 3I74A 3RZCB 1MW3A 1N5YL 4TZHA 1C9SA 3TFKD 3S36H 5F7UA 2BOCA 1ZWIB 3ULAB 1RJCA 5B21A 2L7QA 1I3VA 1GZHC 5L6YL 1S7RA 3ZTEA 5GS2B 4QF1A 1AJ7L 3D2TA 3AWEA 2OMZA 3IDNA 2YPLA 1OGQA 5HJBA 4XCNA 4XXDA 4PJ5A 2Z65A 1J12A 3GXFA 3HNSL 2DMGA 3FSVA 5E8OA 5IEHB 3T0EC 3TYGH 4J8RA 4GKNA 4GEJA 4M6MH 3K6OA 2J8UB 4Q9CA 2BVTA 4R96A 2JB6A 2F68X 3QRGL 3TJEL 2KS0A 5LAXB 3AQZA 3MGTB 3QZLA 4NT6B 2YPKB 4IIQC 4UT9H 3D48R 3NZHL 3UTPE 4DKFL 1HXYB 3MRNB 3H0TA 3ZYJA 1H3VA 3H9SE 3FKUS 1Q0XH 4FYRA 4XNAA 5C0DA 2FYVA 3E80A 1A6TB 1U8LB 4HXBH 3T77A 1I9JH 3NQIA 3D07A 3MJWA 3EFOA 3RWHA 3PAZA 3QRLA 3OR7A 5LNEA 4YZFE 4P4RB 4U1GC 3PIQA 1AZVA 5DHVA 2DOCA 4H8QA 3RHWF 1UB5B 3GTNA 4G7QB 1J05A 4GKSB 4L1HA 2AQ2A 3OQ3B 3UL4A 2R59A 5E5MB 4U1IB 4JW3A 3VXRD 1NBYA 3DX9B 3VFTB 4TRPH 3EG9A 4DT2A 4KU1A 4N3UA 3KLHC 3T0EA 2BWQA 4B7IA 1QPKA 5IIEA 2EEFA 3NEOA 1WLHA 1AANA 5IB2B 3SOTA 2FUTA 4GNKB 3VD9A 1QLRA 3JQOB 2XZAH 4G82A 4OBRA 4JZJC 2YEZA 3O11A 4EPSA 4U09A 3NFPA 2CKNA 3BWAB 4L8SC 3MR9A 3V4VL 2QQNH 3QUZB 2WM0A 5CBAA 5JHDE 4QDGA 2V5MA 1ZLVK 3ZKXB 4EI6B 3CSYB 4RNRA 3RILA 2PTUA 3ZGHA 1T21A 1F1GA 2X9WA 3CHOA 3IN0A 3BRDA 4Z76B 3R06A 3WUWG 2AMUA 2F7IA 4P4KB 4MA1C 1UGNA 3PU7A 5KWYC 2EIKB 1Y1UA 4KUZL 2E9GA 4QRSB 2NW3B 3PWPD 4YHPB 3CVHH 4UOJA 2VQUA 2EE0A 4CSZA 5F89A 5CZVL 1DN0A 3HAEG 3IFOB 5F7DA 2I24N 2W92A 4UM8B 1KCSL 1Z1WA 5K93A 4PJ5E 1A7PH 4Z7UF 3GXUB 3R7QA 2L4OA 3ULSA 3ZUNC 1FO0B 5D70H 1USZA 3O4LB 2BC4A 1DP0A 1SUHA 4DUXA 4NZRM 2BNUB 5AW7B 3DI2B 1AACA 4NX0A 4PRDB 4GW1A 1N6VA 4JZJA 5F93C 3IAQA 4O2FA 2FWOA 3QSKB 1TMCB 2WLNA 4GLPA 5DZNA 5TQ2H 3BKMH 4PREA 4WI0A 4W9DC 3VRLE 2DQFA 3FT9A 2ZD0A 3GSNL 3IS1X 3GB7A 4FXKC 4ANWA 1DQMH 3C5ZD 1MJJB 1SDDB 3L9RB 4F7TA 4F7EB 1IGIL 5DC0A 3T0XA 3TO4A 1TKWA 1DL7L 1QZ1A 4HHWA 4HC1H 4V1DD 1TVBA 1XF2A 1GGTA 3A22A 2XN9B 4LSQH 4PU2A 4JG1L 4ZJ9A 1WV7T 4OD3H 4IDJL 2UY7B 1N18A 2E7BA 1BQ5A 1AI1L 2XBZA 4NUGL 1QW9A 4ZW7A 4Z8FH 1TJGH 4JHUA 3CZJA 4M8UA 3T0EE 3MRCB 4YHMH 2VAAA 2R69L 2YC1B 4HUNB 1IGCL 3C6LC 1S9YA 1XSIA 2VQ1B 2VKWA 5D7IE 4ZO7A 2GBUA 3PABB 2A2QT 5IVXA 1E5CA 3LPFA 4AUUA 1ZTXE 1SXBA 2F2HA 3EOTH 5ESVB 3OKOA 4OCWH 1DBAH 3HBGA 3AAZB 4QLRA 4Y5VB 3VE0B 2HRGA 2BRRL 2DMBA 3TBSA 5KG9A 1HHKB 1KJ2B 3V9EA 2AANA 3NRPA 4X7TB 4BQBA 3UBXB 5E4EB 1S9XB 5T3XE 2QVKA 4KRMB 2E27L 5SX5H 5B3JE 1SGKA 4B9KC 1KCLA 1O5DT 4POZD 3BYYA 4Z7VA 1D5BB 3BPNC 3F7QA 3Q8CA 2GB2A 3DX4A 3H3PL 3LEVL 3AMKA 2MTAA 1UOVA 2NSQA 4OV5A 1PSKH 1G6RA 3IXAB 2VLRD 3IKCA 5L8JB 5B1KA 5LDSA 2EDTA 1JPEA 3C6LA 4WI6A 5IMMB 5LLIC 2ASTB 1HILA 4HJUA 1SN2A 2DWEA 2LFGA 3OKDA 1F4XH 5L4MA 1WFMA 4ODSL 3MRQB 3H7BA 4DVRH 1JGIA 1F41A 3OAUH 1OGSA 2MKLC 3GSQA 4YX2H 2FT3A 4FRWA 4FLSA 1OTTC 1TG8A 1UB6B 4N25A 1CFQA 2D9QB 2BOLA 4BGLA 3OGOE 5JLZA 1KB9J 2X42A 4PW4A 1TJIL 2CIIB 1NAMH 1CDCA 3F7YB 3IMBA 3V4PH 5LVEA 1A7OH 1ZVHA 3TESA 1J7VR 1XEDA 4TOYL 3CPUA 1E43A 2RIKA 1JG9A 1YYML 2C34A 2R39A 3NVQA 4X8JA 2VL4A 3CVDA 4F58L 1DLHA 2IPKB 1MFCL 5JHBA 3UCQA 2WGXA 4JFOB 1OW0C 3O9WC 4YUEL 1PD6A 2HFTA 4HPYH 3ZSSA 3NGBB 4P04A 4QHNA 2YGVA 4NQVB 1M2VB 2YMTA 4WKZA 5J6HA 1QWUA 2CQVA 4M03A 2BHZA 1LDPL 1LYQA 3ULUF 2PUQT 4RMSA 1IIIA 4WI7A 1M42A 2NY2C 4WU7B 1D6VH 3V0IA 4Q6KA 1BIIB 3I9GL 1RMFL 1AGEA 1TZAA 3D2UD 2HG5B 2VQTA 3FAXA 4GFTB 5SX4I 4WP6A 3CFDB 1VJSA 2YUVA 3G6JA 2I27N 3IU3B 5F1KC 4S2SA 2VW6A 3MUZ1 1IMHC 2PWEA 3NIDE 4XXWC 1SDYA 2FD6H 3KE0A 5C0BD 3VXRB 2Y7MA 4D0DB 3WHXB 3Q5YA 3RJ0A 2WN3A 5AOMA 4JFPB 1J5DA 1EK3A 1V3MA 4HU8A 3G04C 2AGJH 2PYFB 3LQZB 3RX9A 4P57A 2HMIC 3LB6D 3US9A 4HXAH 2OSWA 1D3CA 5L4IA 3O9WA 5SX5K 2WLMA 5J1AA 1G0XA 5E9DD 5FYLE 2X87A 1WVZA 4LAJH 2R29L 1OTUC 3DBXA 2AQRA 4JFDE 5E6IC 2IMNA 1KB9K 4R2GD 3HNTL 4XOAA 2HKAA 1DHKA 3DUUA 4YSOA 3S9DB 3PWPB 1LEKA 2Y72A 4JFFD 1CFSB 4K7PH 4JR9H 4LBEB 5F7MC 5I5IA 2X4OA 2DJMA 2E9IA 1RZKH 1H9VA 3MRDA 3NIFB 2R2HB 1XBRA 3QQ3B 5DK2B 5ILTH 4HAFA 4XBPA 3DURB 4XXWA 2JJTC 5D7LA 3JWOH 3Q01A 5D1ZC 4EIZC 2WBJD 3MCLH 3F7VA 4UU9B 3ORJA 1QI4A 1A9BA 3IE9A 4J12A 5EO0B 5AAPA 4ZQTA 1R19A 5HD8D 5I18H 2RACA 1U95A 1BREA 1QBAA 5BQ7A 1QOKA 1AAJA 5ESQA 1PYWA 3UTQA 1BGXH 1QNZH 1RUKL 1T20B 4Z77A 1SQ0B 4XGOA 1L7TL 2LABA 3DTXB 4J6IA 3JVGC 4L23A 1KGCE 2CLZB 3S88L 2BNQD 5DRNB 4D9RE 1F58L 4LEBA 4Y16C 5CR8A 1EFQA 2C3VB 3C5ZB 5GRXG 1JTPA 3II3A 4YDLB 3NJKA 2X2IA 4FLHA 1AGDA 4N8CL 2XRAL 1P2CB 4IHOA 4ETQA 5CGTA 4U1MA 3DUSB 4JM4H 4ONHA 4Q3GA 3I6GB 1N0XH 2YGPA 3VWJC 5IJCA 5DMGD 4UILH 4YFLF 1PGRB 4MJIA 4N86A 1S9VA 3M17B 1U3JA 4HUKB 3WKQA 4P59H 1E3FA 2JJTA 1P69B 5D1ZA 2EECA 4WFGD 4AXWB 3T8XB 4LB8A 3PGFL 1T22A 1N2RB 2RA1A 4LOUD 5LQBL 5FXCH 1SJMA 4KZDH 2IAMC 4KMTH 3DJ9A 1DQJB 2C9VA 4LSUH 1HYSD 2VJXA 4XMKH 1Y7VA 3QFGA 2DQEL 3JVGA 4YWGL 1NC4D 2HT2C 3DDGA 4LKCB 4OQTH 2G0LA 4TQIA 2WXQA 4O5LH 4P5KB 2X6VA 1TNMA 3JV6A 3LNGA 4PS4L 1QFUH 3CUPB 3T1FA 1RFDL 4HEMA 4MX7B 2XBTA 3FSWA 3S36X 5I1AA 4G6MH 5K33A 2OTUA 4GKZA 3QORC 4HIPA 1F6AB 3T0DA 5DZJA 3VGAC 1ZTMA 3NK4A 3EO1B 1CYXA 2ZCLH 1BM7A 5IW1B 3VWJA 3L2MA 3N6YA 3DHJA 3VB8A 3WJMA 1T7YA 3V4VA 3WIAA 4KKCD 4YHIA 1QSED 5DSCB 2CR6A 1KN4H 2X88A 4LDCA 4XNYL 2VLRB 5EOCJ 4CC1A 2B59B 3BKCL 3NSDA 2NMSA 4AYID 1OLLA 4L4TD 4D7PA 1I8MA 1I7UA 2ADJB 1E9OA 2BVQB 3B34A 1WTLA 1OAKL 1NOLA 4RMBA 2IAMA 4MCYA 5HVFB 4FQHB 4NQUA 2BSSB 2YD6A 4BRJA 2TSAA 3PUCA 2EXWC 3WMSA 4YL9A 3OAZH 3VM5A 3NABL 3ZVVA 4DN3L 1CFVH 1XGTA 2E56A 1QBMH 3TASA 1YNKL 4ADGA 4FFVC 3U9WA 4AVKA 4Z3TA 3UAFA 1NEPA 3CFJB 3WFHA 5E00B 4F7PA 3PJLA 3T71A 2ZJSL 1MFVA 3QORA 2VIRA 2W0FA 2JJUA 4KX9A 5E1IA 2VSDA 2TSBA 5FA4A 2Q87A 4KMQA 3UG5A 1SYSB 2BIHA 4FTVA 4QHLA 4WHDA 2YKLH 4YSAA 1HXMA 3N9GH 4P9ML 1JL8A 4N6RB 5J7CC 3IDMB 1INEL 4AYFB 5GS1B 4QNPF 1RULH 3GSNA 4ANKA 3SDYH 5EBMB 2ZUQC 4C59B 1A6VH 3PYCA 3NT0A 2UUDH 2FJGA 4ALAH 1BQUA 2HTLC 3NCBB 1FIGL 3SB4A 2IIJA 3UL9A 4MQ7B 4HK3N 5HGHB 3QQ4A 5ID1B 1RPQA 3TNMB 1QEWB 2BP0B 1CZ8H 1DVZA 3D2UB 3FRPG 3FONA 4HWBH 1PIFA 3P4LA 4FQ1H 2R69A 4N0YL 2Z35B 2VXSL 3DPDA 1UVQA 5C0BB 4MNGA 2OR8A 3WEAA 1F4WL 3QIUA 4KUCD 2CO7A 1CVRA 3MLTA 5GS3A 4F57H 4HETA 2ZYHA 1K6QL 3CFKA 2XQ0A 2ZCKH 1JL5A 4MMXA 2FT7A 3QNZA 4FXLA 4TSAH 4FQCL 1RZKC 3TBWB 3DIDA 5F21B 3U6XA 2V8LA 3C08H 2KUTA 1BF5A 1OIOA 3RGXA 5HHVL 2FB4L 5GS0L 1AVAA 5E9DB 5D1XD 3KPNA 5FK9B 4ADIA 4QY8A 1FFNB 1XH3B 3LEXA 2BXZA 4R2GB 1A02N 1BWMA 3TA4D 5I1LB 1G7JA 2A6DA 2DLFL 2Y5TA 2HJLB 4X0KA 2FECI 1R5VB 2YEVB 4LP8A 2ESVD 4EBQL 1IT9L 4U1NA 4JFFB 3E1ZA 2IQ9H 3SY0A 1WBXA 4Y5XA 3FTUA 4JDEA 2D31A 1N59A 3BC9A 2V5RA 3EH4B 5ES4B 2AK4D 1ED3A 4MKTA 2BDNL 4YSDA 2FBJL 2GBVA 3OAZK 4HJGB 2WBJB 1MHEA 1OAYL 3L5WA 1GWBA 3KWVA 4BKTC 4FJ6A 4H0HB 4YK4B 4FTVE 2PP7A 1UM6L 3ZE2F 2FO8A 2VC2B 4GLRH 2YA0A 4ZZKA 4PJGF 4ICXA 3WE1A 5IUCA 1GL4B 4OGYH 5LWYH 2BNQB 3ZTNH 3T65B 5EU5B 5BCAA 5J4MA 1ZA6A 2JKRM 5LO7A 3VD5A 4HBCH 1KMGA 2VLKB 2PO6C 5TFSH 1PPIA 2YWYA 4FFWC 2ADFL 3GUTA 1NFIA 3RWFB 4DKEL 4U7SA 4DZ8B 2FYYA 4P23C 1XT5A 3ZGIA 2FX9H 1RUAL 1QTPA 3GNMH 3HCVA 2E86A 4GIOA 4P49A 4XRCA 1J0KA 3TOPA 2UUDK 1KC5H 3RFRA 3GJEB 3GSVA 5E8NB 4GH7B 5HVGB 3CBRA 1XGRA 2IADB 4XP1H 3N1GC 2DTML 4MAYC 4IMLB 3ZL4L 2P48B 1N68A 1TR7A 4LVNC 5T1KD 2OCFD 1MUJA 3FTXA 4L8BA 1EBPA 3HB3D 2CDGA 1SHMA 2DQIL 3MYJA 3GSRA 1F6LL 2F58L 4TTDC 2VNCA 1AQKL 3VX1A 5HHPB 1D5MB 3P11L 4NQED 1WT5A 2BOBA 1D7DA 3QEHA 4NKIH 3BUYA 4YNYB 1VKXB 1I9EA 3LRMA 1WFNA 3QFJA 1NA8A 5IMKB 1NC4B 2EQDA 1AMXA 1ZGLB 5C0JB 5DQDH 1KGYE 5IB5B 1G7MB 2CBTA 1A5FL 3N50A 1EFXD 4RISH 3VI3B 1YEGL 4ZFOB 4BFIA 1ZV9A 5IQNA 4OF7A 1XCWA 5JNYA 2PO6A 4B41A 3MRJB 3RU8L 4HSQA 4KHXH 3LMJL 4Q62A 4L3ED 1QZNA 3LS4L 3X3FL 4YGVA 1LO2H 1IM9D 4K3HA 4P23A 2V5TA 2W60B 2XACC 1ZIAA 4YO0A 1QBLL 4IS6B 4Z3FA 1FV1A 5EH1A 1QSEB 1RZJH 2R29A 5BV7C 4OJDH 4Z7WF 2YN5A 2EDOA 3LKQB 5L7XL 4L4TB 3V0AC 4UFRA 2NYZA 4XNBA 4HUXA 2ZKYA 2WNXA 3VXMA 4KX8A 4AY9X 4EUPH 3BOVA 1L5GB 43C9A 1FF5A 5AOLA 3TN0A 2J88L 1Q72L 4JGJA 2ZKXA 3KYKL 2AJZB 4IEFA 1SHWA 2Z64A 1TOXA 1CE6B 5HZLB 4YFEA 3PWNA 2WCPA 1BVNP 4P46C 1YAZA 1SLWA 2J1YA 5F1NB 4LQ1A 4WJKB 2CBPA 1MWAH 1ZT4A 1IGYB 3NJXA 5HHOA 1FO0L 3ZMRA 1J8RA 1IM3D 4X6EA 4U08A 3HG2A 3UAJD 4Q74A 5EG6C 3WPDA 1YEKH 4FQPA 3OMZA 4MXVE 3UJJH 2WVVB 3WG7B 1NFDA 4AYEC 3MOBL 4YDIL 3ZK0A 4FG0A 1KGWA 6CGTA 4TVPE 1XZWA 2VSKB 1Q9OA 3TNNA 4F7CB 5E7FA 2P1MB 1E4WH 3PWJB 3D06A 3FQ4A 3L6FB 3V6ZB 5JIDA 4CRPA 4X5XA 4HK3J 4JUSA 5C08A 2QV2A 3OJDA 3VFPA 5C7XL 2EC9U 2OJZL 2ZG2A 3IDXH 2GSIA 4KI5C 2WXLA 5B22A 2XKUA 1F13A 4YOKA 4G6JL 3PV6A 2COVD 3QPQD 3VG0L 1FYTD 5E0QA 4CU8A 1W8NA 4TNWK 1YDPA 1KJ3H 3L13A 1P4IL 2BSBA 3MSPA 3FTYA 4C4KT 3BRFA 1INDL 2A6IA 5EIIG 2H32A 4AIEA 1ZSHA 3J27A 3AJ7A 4K15A 2BSTA 1KTDA 3PDOB 4HH9A 2K6WA 2C3WA 1R3JB 3MLVH 4K7PX 3FU8A 2OJ1A 4LSRL 2XT1B 5E8PA 4G9DB 3RRQA 3RE0A 1PZUB 3ETBF 4AY0A 2BH0A 4R6JA 3R8QA 2NTSP 1T3FA 3CVHB 5HYQB 2EH7L 1IJNA 2NCMA 3HBPA 2DDQL 5D1XB 4PRID 5GGSA 3IXTA 3TC9A 3SODB 4BIKA 2IFGA 1HZHH 1N10A 4X7FC 1DJXA 3P30H 3P02A 1YECL 3EOBA 2XQYA 1WDAA 2ESVB 1XGPA 2NY4D 1WF5A 2OZ4H 1I4FB 4MA8H 2OR9H 3N1MC 2XWBB 2XN1A 3OAWA 2FX7H 4U0RC 2AK4B 2OL3H 5EZJA 1ZHNA 2C9PA 5BMFL 3SBWA 4YJZL 3QPXH 5KYYA 3UERA 2V2TB 3AACA 1FZKA 2X70B 1M71B 2FUQA 4XCYB 4Z7NB 4QRPD 1MREL 4X7SL 3SIKA 3V6FA 2RH0A 4OLWH 5SWSD 3CC1A 2O5YL 4P2OC 5TGBB 4Z0BH 1IAOA 3MRLA 1AD9B 3PGDB 3RGVC 3KPLB 1E30A 1RZPA 2PW2A 5L0QC 4R07A 3L3OB 5J56B 4GOSA 1ORSA 3NBNA 2WANA 3GPSA 3BGMB 4K4KA 1SXZA 3N43F 4LU5H 2ASSB 3G5ZB 1R3KA 2AXJA 1X5MA 4JL2A 5AZEL 4GT7A 1ILUA 2PR9A 1P9AG 4WW2F 2NYYC 1U3NA 5GS0C 1J10A 3CLEL 1X4ZA 5I6OA 3WL9B 3K7UA 2DD8H 2OPCA 2B1AH 3HMXL 2C9UA 2JCCA 1LO4L 2E9BA 5T1KB 3MO1A 4HOMA 1QWHA 5LCVH 2O6DA 1B0GB 3ELQA 3HB3B 3IRZA 1FSKB 2Q0ZX 3RWGA 4E9RA 1O6VA 4NNYB 2J8HA 5EZIH 1RURH 4KTDL 4HHAA 4NQEB 4XH2B 1L0XA 4PJDA 2XTLA 4IK7A 5DRXB 4E41D 3NSYA 3HZKB 3FCTB 4FL4C 4NYLB 2OMYA 5I1DA 2EICA 1VIWA 2H0FA 5AAWA 3LVTA 4HOWA 5CCKL 1EFXB 1HE8A 2CM6A 2Y0SA 2VO5A 1A7RL 2F5BH 3ECBB 4PLNC 4KI5E 5I8EA 2JSFA 2WSPA 1HL4A 2XWCA 5DZOA 3RVVC 4L3EB 3OKMB 1A1NB 4YHOL 5E2TL 3UYRL 1IM9B 3KPSA 3CIYA 4EDWH 5GS0A 1A3RH 4Q9RH 3APMA 4U7LA 3GGWB 3VGAB 2W65B 5IYXC 1Z66A 2B4CL 3ZE0B 3Q05A 3L2NA 3T04D 5TE6H 3MROB 1NEUA 3KXFA 3L3GA 5DMIH 4WFFE 2ROXA 4WUUD 3II2A 4ELMF 3W3KA 3NDZE 3VXOA 3WKMH 4GS7C 3ZQWA 1URIA 1XF3B 4H26A 5GISH 1NAMB 2X4TA 4Y1AE 1GZQA 3V4PB 1X5HA 4AT6B 4HDIB 3FUJA 2XA8L 5L88H 3QDJE 5E08L 4HALA 5I0VA 3VW3H 4P2YA 1BAFL 4JQXA 3DX0A 4AYMC 2B0SL 4BFBD 2BM3A 3WSQH 3NCJH 1R3LA 1G9MH 3K6IA 2VM3A 1ZVYA 3FYIB 2J25A 3GTVA 4X99A 5H94A 4S1SH 2HN7B 2ODIA 2Z4TA 1UJ3A 2E59A 4JFUA 2AJVH 3BVXA 5KS9A 3INUH 5HGDB 1IM3B 4L05A 4ISVA 4A55A 3BISA 2M1KA 2MCMA 3U46B 3ZR5A 3CK0H 1P5UC 3GI9H 4NKMA 2JCCE 2ZX9A 1YJDH 4WYKA 4N2DA 3RX5A 4WEBH 2XTJC 1Z3RA 2XICA 3G5XA 4Z94G 5IEHA 2VLLB 5CSGA 2CO4A 2J8UA 1NUGA 1QTYT 2HH0H 4PJDE 5F6HJ 2MHAA 5ICZB 2CBMA 4NO0D 3NEEA 3GMQB 3WPEA 2OQJB 5LAXA 2JI3A 5DUML 3MGTA 1MCLA 4NT6A 2YPKA 4FNPA 3ZDYF 3DX6B 1HXYA 3WLBA 1FYTB 2N0KA 4N90D 3RY4A 2D3NA 3BWUF 4AL8L 3LOWA 3DXAE 4DGIH 1NL0L 5C09A 1L6ZA 4NDMB 1ZSDB 2K4AA 2XX1A 4IRZL 4PG2C 3QAZB 5DJ6B 3GI8H 3KPSE 4L48A 1BQHG 3MBXH 3ZLQC 1WUNT 5LNGA 5C2BH 2HVKB 1R0AH 3IGLA 1DFXA 4P4RA 4PP2B 1SOXA 2A74B 2PWDA 1J8HD 4QXTB 4JKPH 4XNZB 4GKSA 3IRPX 4B6ZA 2A6KA 4JJOA 3BFOA 4U1IA 6TAAA 4LHUA 4PRIB 3VFTA 4WIQA 3UTSD 5LKNA 2KMWA 1I53A 1FC1A 4JCWA 4P0DA 5IB2A 1AQ8A 1MFUA 5IBTL 2NY4B 5E4IA 4LSPL 5BUGA 5KSVA 5I1JH 3M1OA 3D4YA 3BWAA 4ZW5A 1MFDH 5FECB 2FDBP 1OGAD 2ZKHL 5BOJA 3QUZA 1BQSA 1RIVL 4NS0A 1DJZA 2VQ4A 4EI6A 3CSYA 1OV8A 3F5WB 1OCZB 3P4NA 1NLDH 1FG2B 3TCLB 1MQKL 4LASL 2R1XB 4OCYH 4YH6A 1AQHA 3EYOA 5KS9E 5E56A 4P4KA 1ECZA 3OWRA 4QRPB 4QRSA 3V0EA 1T1WA 2NW3A 4P5SA 4M6OL 1XF5B 3L9YA 4EI5C 2XDHA 3EO9H 4ZTPH 3VCLB 5LXGH 5SWSB 4LGSB 3IFOA 1TYRA 5DYOB 1KXQE 1ITBB 4UM8A 4XP5L 4CVZA 1RZFH 4HYTB 5FKPB 2N7AA 3KJ4B 2XVBA 2BSEA 2H2PC 2NY5L 4ODVH 1FO0A 3C9NB 3DV4B 3QA3A 4FDWA 5TH2B 5TQ0L 4AX3A 2BNUA 3P9MA 1LEGB 4KFZC 1FNGA 1ND0B 2O6CA 5IBUG 1NBCA 3DVFA 4JG5A 4AE0A 4Z0XB 2DYPA 4MXWH 4PJIE 1SY6L 2L7JA 3LNHA 5J3HD 4OZGB 4XI5D 2WWMC 5CMAB 4NZRL 3SZ6A 5FOBA 5ISZA 2IC2A 2XN0A 2ERJC 1KLFB 4NZTH 4YDKL 1Y1DA 3TL5A 2YMXL 5C09E 1BFVH 3E3QC 1MJJA 4UOQA 4F7EA 1WZ1L 1FG9C 1QPXA 4MRBA 3HE7D 2G60L 4QRRE 2BEXA 1SMAA 3UYPB 4EI5A 1Z0MA 4YHYB 3VVVA 1ML0A 3HE6D 4PJBB 2UZYB 2XTJE 4E41B 7CGTA 2H7WA 2G5UA 5KVEH 5KVFL 2CU9A 2J4WH 3MRCA 1MCHA 2A4EA 1TTUA 1EEQA 2P47B 3G39A 3DJSA 1M6OB 5I82A 1ZLWH 3D4CA 3VO0A 1E2WA 2Y36H 5JIKA 3MODH 3CVIL 3N42F 1W0WB 1UWEL 3AAZA 4Y5VA 2EC8A 3FN0L 3VE0A 1M56B 3DSFH 4MB3A 5EULV 4HCGA 3BWSA 4LSTH 4O4YH 1JWUB 4FQLL 4PSJA 1HHKA 1KJ2A 1SLVA 3KR3H 1OGTB 4X7TA 3A0OA 4IOSA 4WUUB 1S9XA 3UBXA 5AWDA 5EUOF 5FO7A 5DA4A 1CJYA 1FP5A 2AI0L 2E76C 4Y5YC 3COOA 3ZW3A 3SSGA 3S37L 3WTXA 5EDXA 3ZU8A 3OBAA 4A6YH 4PJ7F 4DFHA 1U8MA 3IXAA 4FQIL 4QHPA 2AEPL 2UV3A 4ZPTB 2Z31C 2WO4A 3FQUB 2OW7A 2CPCA 2W9LA 1AC6A 3GO1L 5A2BA 5IMMA 4G71B 3PQYD 1D0BA 2G75A 3WN5B 5CP7B 4UDTB 3BLKA 3MRQA 3STLB 3BVWA 1T89C 4JRXD 2APFA 3FFCD 1CFBA 3BX7C 2X6CA 4XAKE 2VC2L 4XWOC 3RDTC 1ZANH 3RHWK 5ISZE 3AB0C 4LCCC 4KK5D 5C86A 4N2OA 1IC4H 2QVMA 4UQEA 4ES9A 1I31A 4ZMWA 3KLAB 3RAJL 2EKJA 5KYXB 4J1UB 3PWVA 5CUSL 5GMFA 2ENQA 3I50H 3QWOA 1CIDA 2BJML 4RMTA 1EJ6A 4CUCA 5IBLD 1ACXA 4E9TA 5HGBA 3F58H 4NO0B 4Q9BA 1MRCH 1TENA 4JO2H 2QQQA 1HCFX 4WO4C 4B9IA 4RA3A 2B4CC 4R5VA 2ZUTA 3SDXF 2IPKA 3B2XA 1IEBA 3HMXA 3ZKMD 4JFOA 1GR7A 3FRPB 3V0DA 1NUDA 1YEIH 1JFQL 5D71H 4XP4H 1P8VA 4NQVA 4CSTA 3BEVA 3EJYD 1ZHLB 2R8SH 3QQDB 3IPBA 5CO1A 4KV5F 1M9SA 5D1QD 1T89A 2VCOA 4ZMZA 2XIBA 4M5ZH 1A4CA 5FX3A 1G4RA 1BIIA 3SPHA 2VERA 2HG5A 4LCCA 1HNFA 3CN1A 1J8HB 3V4LA 3HUJE 3O2DH 3IU3A 3E3QE 5CCGE 3AY4C 3IU4L 4KNUA 1OO2A 3LKRB 3MBEB 1ZLWK 4D0DA 1AD0B 3G6AB 3VXRA 4MQWX 4LLDB 4JN1L 5AW5B 3WHXA 5K9KB 1I8IB 4C57C 2QGBA 5KSBB 5E6SB 1AZBA 1NBVH 3UTSB 4ZFOL 3C2SA 5DZVA 5HHXH 2PYFA 3LQZA 3GHBL 3Q06A 3ETTA 4PVMA 4XNDA 3G3BA 1E7UA 1JYNA 1YMHB 4BK5A 5D1ZI 4OCRH 4FP8L 1J5HA 3L4VA 4M7LH 1OGAB 3UBGA 4XNQB 1LO5B 2J5LB 2EKSB 3CQFA 5DZAA 4Y88A 5IMOA 5FB8B 5I71C 3L48A 3ZHNA 3U0WH 5FCUL 5ANMA 2PW1B 4L1TA 1G5AA 2GSGB 2H6PB 3SDAD 3W3NA 4GQPH 4EIGB 2B7DT 4KRPD 5DJ2B 1W0YT 1L0YA 3PWPA 5BRZD 1N8OE 4MJJA 1CFSA 1SMDA 4LBEA 3TYGL 2ZXQA 2Y7QB 4M6ML 4JFWA 4AQOA 2IPUK 2VAJA 3KCPA 4AL8C 5DK2A 4KXZI 2P28B 2AITA 2KQMA 1LILA 3D87B 4UU9A 3ZO9A 1KF9B 5EO0A 3D52A 2DMHA 2V9SA 3F05A 5CN3A 1Q0XL 5KBKA 1QHQA 4RGNC 5FO2A 4XOSA 1BYOA 1OCRB 3I6SA 3MA7A 2DQMA 4N0CC 4Z23A 3QE5A 3EBGA 3ME0B 3DTXA 4HXBL 4PHZA 2A1WL 4XGZB 1EXUB 2YSSB 2V6HA 1JGVH 1K85A 2FL5A 3KHQA 1ZJAA 2Y6SC 3KEDA 1AP2A 3BQVA 3FPYA 3ECQA 5EORH 2C3VA 3C5ZA 4AZ8B 1NCHA 1X9QA 2E74C 5A2KH 5L2JB 3N04A 3A6CL 1P2CA 2FO1A 4G8EA 3DUSA 4HMDA 1CTNA 3I6GA 5KYUA 1F02I 1ADQH 4V1DA 3O2VH 4YGAB 4DO4A 4ZW8A 3WDHA 4YHLH 5AW6B 3HE6B 3D0LB 1T5KA 4HJ0D 3D1MC 3M17A 5EWIH 5EFIB 1WAAF 3GDCA 3RIAF 2UZPA 1WCBB 2ATPB 4AEHH 4IRZA 4TQPA 4KDTC 3IF1B 1MIEL 1N2RA 3RWEB 3NJMA 4KKRA 4ODUB 1NWOA 2XXGA 2CHNA 4DO5A 3BZEB 3HNVH 1U3YA 4F7MB 3MBWA 3SQBA 1D5ZB 4PBDA 1P4BL 3EADA 3NZ8B 4M29A 3V7AE 4O00A 4RSYA 4LKCA 3R4DA 5DDHB 3RFJA 1NGPH 2D03H 2QPDB 1H8LA 3CVHL 5DU7A 5ANME 5T1LB 5BXFB 3UIZA 4C47A 1HINH 1KV7A 4RGMB 5HI5D 1DQLH 1I7TB 4ZMLA 2BNHA 2D4DA 5KJ4A 1DSYA 4GP4B 2QGCA 2B9BA 2IH1B 1EGJH 2P8MB 3EO1A 1A9EB 1MWAB 4DK6A 1JPTH 5JHLH 4UNVA 5D70L 1R5WB 1ZPUA 3BLPX 4AEFA 3U6RB 5B4MD 1NC2D 5DSCA 3OKNA 1KZYA 4Y4FC 2VLRA 2B59A 4WEUD 4JO8A 1KTLB 1S7WB 2QKIC 3K3QA 2ADJA 3DX1A 3PJSB 3SYAA 4BYHA 4Z78B 2BVQA 5CEZL 3PQYB 5BS0D 4J2XA 1OY3B 5H37G 5TQ2L 1N64L 3PLYA 4WGVB 3I9PA 2MEJB 4JRXB 1DQML 2BNRD 3FFCB 4PJEB 3IN2A 1KWGA 2WXRA 4W9EC 3AW5A 2NY0C 4B9GA 3FB8A 3Q5TA 2BP5M 3SHSA 4BXSV 1LDSA 4EZLA 4X9YA 1PD0A 4ONGL 2CO6B 3QG7H 3RWIA 4LI2A 2AXGB 4TNEA 3TV8A 5E00A 2F7QA 4M4RA 3WNNA 1NM4A 5CJ5A 2E7CA 1YEEH 4CJ0A 3X1GA 1PQZB 5H37H 4MXQC 4AVIA 1SY6A 4A39A 4V1DE 5F7AA 4YHML 5IT2L 4XCFH 1D5IL 5DMYA 2O72A 2XIDA 2YAMA 1M7DB 1KGJA 1JV2A 4N6RA 3VNZA 3IDMA 4OCMC 5HI3C 4J7RA 5GS1A 1VGKA 1YAIA 3BIAX 4OZIE 2B5IC 3ARUA 5EBMA 5IFJA 4Y8DC 3EOTL 1SUJA 4Q9QH 3NJNA 4DZBB 4OCWL 1I7RB 4X8CA 5DD5L 4RGNE 3U2SB 1NKRA 4AJVA 5E2WL 2PCPB 4KVPA 2ALWA 3P73B 2UVEA 4X6CF 2FQGA 2YXVA 1F42A 4M93C 4MQ7A 5D1QB 3BSHA 5HGHA 3TNMA 4I0PC 1QEWA 1TF4A 2BP0A 3K2IA 1FE8H 2FAUA 3K71A 1LTXA 6FABH 3CDFA 2Q8BL 5BW7C 1QRND 2GPZA 4Z7UE 2GTWB 4OF6A 4CL7A 1DQTA 1XL4A 1ACCA 2O30A 5CF3A 1ECYA 4E68A 5EEUA 2CK0L 4AGOA 5C0BA 1M1SA 2OL3B 4ZYKB 2GJZB 1B4JL 3CHSA 3GBNH 3NK3A 4JPIB 4WTQA 1AGCB 3ULUC 4AENB 5I6PA 2WLZA 3K2KA 3BH4A 3B1UA 4NZUL 4PY8I 3P9LB 1BAWA 4O02H 3EYVA 4HEPA 1MF2L 1UD3A 3CFCH 1HKFA 4PMFA 5DEFA 1JWSB 5KBPA 2J44A 1WFUA 4FQXC 4ZT1A 4WWKD 3OAUL 3V52L 5E9DA 5F9WB 3Q13A 4YX2L 3X1FA 4UTBL 2Q7NA 4U3SB 5C8JB 3IAPA 5FK9A 5J0BA 1FFNA 1XH3A 2V33A 4A66A 2DM4A 3DROB 1NMCC 3SDAB 5FOJA 2OK0L 4KRPB 3QBTB 2EXYD 5CINL 1GGIH 4K7FA 2D0FA 5BRZB 4JFFA 1NAML 2Z4QA 2ZPKL 3V4PL 4G3YL 2QADC 3BW9B 1S4IA 1WWAX 5K9JH 1B9ZA 2YGQA 4QHUB 3PY9A 4P8QA 3A79B 1D6EB 2X1PA 4N3TA 2J21A 3M8OL 1P4UA 4CMHC 5A43C 4U6YB 3A5VA 4GBXD 1JF1A 3MFFB 3QCTH 2WBJA 4HJGA 5BUPA 1RK0B 4XP6H 4FGMA 1CDUA 2Z93B 3VXUD 1AXSB 4HPYL 2DQJL 5J13C 2R0ZH 5ABAA 1EJOH 1XH0A 3GSWA 4J3OG 4BSRA 4MD5B 3SGEI 2XJLA 3MV9D 4XPFH 1TQCB 1H15B 3NZUA 3FQTB 2MCG1 4FQXA 1XQ4A 2BNQA 5IQ7L 3T65A 4Z3JA 1YEJH 5DQJB 1QVOA 4ETYA 5EU5A 2JWYA 5DVPA 5HYSG 4NKDB 4AYGA 2I5YH 1VENA 1CQKA 3A4EA 1AIZA 3RWJA 2A38A 4J3OH 1CU4H 3DSNB 1MH5B 1QSFD 1YPZB 4YR6A 3WKNA 2X0VA 4PTTA 1GGCL 1IE5A 2F54D 2JH2A 2AGJL 4MJ6B 5E8NA 5C1MB 2FJSA 2IADA 4G8AA 1ACZA 3EGDB 4IMLA 4BD4A 2WQWA 1FORH 3VI4F 1UUNA 4NN7C 3TA3C 1OALA 3ZHLA 5IWLA 1M0ZA 4MNQD 1VRSA 5EO1B 4ZOAA 3ZPDA 3U7AA 3WMQA 1F00I 5HHPA 4ZS6D 1D5MA 4LARL 1AE6L 4YNYA 4H0LC 1VKXA 2I7OA 2QVIA 4HKBB 1COBA 4ZTEA 3SQRA 5DUBB 5IMKA 1NC4A 3KYOA 4ZMYA 5GZOC 1R46A 5C0JA 3CVBA 4KKLC 4KK9D 5IB5A 4NXKA 3DJTA 5C07A 2BS8A 1BCIA 3ABGA 3VI3A 4OJFH 4ZFOA 2BPBA 1FAKT 4N8UA 5LFNA 3GTTA 1MW1A 5J6GA 1UA3A 1AHKA 4Y2DD 2HT4D 3PFQA 5EUKB 1HESA 5HDBE 3MRKB 3VTAA 5DC2A 3MCLL 4IU2B 4TS6A 4F5CA 4DW2H 5I18L 2W60A 4LEEA 3R0NA 2AFNA 2C26A 2DWXA 2D73A 3W3BA 2GW5A 1NC2B 1QSEA 2P8PB 4Q8BA 2OX5B 5GQBA 2ICWI 1XTMA 1BGXL 4PJAA 1OXYA 1VEOA 3UTOA 3AREC 5E2VH 4XMPH 3ULUE 5AVRB 4BSUA 5BS0B 1S78D 4PI0A 1MJ7H 2AF2A 2PABA 2XWZA 2HWZL 5T1DH 5I1IH 2BNRB 3UYOD 1E42A 4YLCA 1UA6H 5B1JA 1JMXA 1QFWM 4GQQA 2P1OB 3WNPA 1L9PA 2BLFA 1VACB 3OGLB 3QUYC 4MMZB 4XPBH 5JPNB 4JM4L 2AJZA 2X4SB 4YL4A 1N0XL 1KN2H 3T3PB 2XXFA 3SO3C 3FCBA 4UILL 3TIEB 3RGZA 5JIHA 3FSOA 4H20H 3QJZA 2OYMA 4P59L 4ATWA 1RUQH 1IGYA 3K0WA 4JAMB 2GJ6E 5E8DH 5IK3B 1QLEH 2WQSA 3TU6A 2NZ9D 1T66C 2OTWB 4RDQF 5C9JB 4LSAA 2X44D 2WJ5A 1BHGA 3DX7A 3OG6B 4IJ3C 5FGCB 3RWCA 2J20A 2IV9A 4G1EA 5LBSH 4BE5A 2MOVA 4XMKL 2XZCH 4WAFA 1S3RA 2KZKA 4F7CA 3PWJA 2EDLA 1HSAB 4LEOA 3GM8A 3L6FA 3V6ZA 2GC7C 3QZBA 4O5LL 4TF4A 1ZRUA 4XB3A 2BO0A 4PJ8C 2PTTA 1SJXA 3DRQA 3SKMA 2J55A 4G6ML 3SDCD 4J4PC 3DC0A 1MJUH 2ZCHH 4N2NA 1QRNB 3QUYA 1EJ8A 5A16B 2ZCLL 5C07E 3PXHA 2EO9A 3ZHFA 4AM0B 1W8OA 2OMUB 4O9HL 4WNQB 3PREA 3PDOA 3BN9D 1FN4B 4XE5B 3MU3A 1R3JA 4R7VA 2JKTM 2WB7A 4F5CE 1Q90A 3VXQB 2X41A 1V10A 4CADA 1TPXB 3EO0B 4XXCA 4J6RL 4JGUA 3SPIA 1NCBL 3VXNB 4PLOB 3CVHA 3LEYL 4PJAE 5HYQA 4HBQA 2D3JA 4QOKE 4WWKB 3GBDA 2FEJA 3BH8A 1CFVL 4PYGA 2VDRL 3QUXD 5D1XA 5DD3L 1OK0A 2Z91B 4X9HA 2CIKB 4ZD3L 2H3NA 4FD0A 4FA7B 3WN4A 1T5WB 2ED7A 4LVOB 3BAJA 1IKNC 4X7EC 4KKQA 5CIPH 5FUCC 3L8QA 4NQDD 3GWJA 3FO0L 3ARDC 5D5MF 3WUWA 5CLWA 2ADYA 1UH4A 2RR6A 4YPJA 1Q0YH 3V5DB 5BZXA 3IMTA 1OE1A 4UTAH 2VMFA 5DTFB 1HZKA 4M62L 2B2XL 1NIEA 2GITB 2PP8A 3HAEA 1AHWB 2YKLL 4GBXB 4Y0GA 4AH2B 2V2TA 3VXUB 4R7DB 3U79A 3ZIYA 4WQOA 2X70A 5K39B 1WIOA 4XCYA 2XPGB 1A6VL 2I26N 4FHKA 5IBUB 4ALAL 3AG3B 5DO2C 3NG5A 3KGTA 3PXLA 2YS4A 5TGBA 3S8GB 1AD9A 5FM4A 2ZSVB 3PGDA 3FZUD 3ARWA 3L3OA 5GRJH 3S35H 2MPAL 4HWBL 1TNNA 1KJMB 1V3KA 3EDJA 2AQQA 3BGMA 3O6ML 4S1DC 4QBZA 1JHTB 4N2LA 1JOIA 1Z5HA 2Q7AA 2DQCH 3ARDA 3G5ZA 1M6UA 4OFYD 4NKOA 1BZ8A 4UQ3B 1QSFB 1OP5H 3EH1A 3UZQB 4W68A 3RUGF 4IK6A 2ZICA 4JVUA 2F54B 2WLIA 3WFBH 2ZCKL 3WL9A 1U8OB 5DWUL 4TSAL 4AV5A 1AO7D 3LN5A 4TULH 1FNEB 3C08L 1ODAA 4M1DH 4MNQB 4NM4H 2HCZX 4MHHI 4NNYA 3W5NA 3ETBJ 2P43B 2UVFA 4NQEA 1B90A 1BMGA 4PJFB 4ANXA 3I02A 5LGKA 3T6VA 4GRWH 5FDYA 1UCBL 5A1AA 3G5VB 2NW2B 5AB0A 3HZKA 4A6YB 1WS7A 4NYLA 4JRYD 5GHWL 1U42A 1RLWA 5JHAA 1EFXA 3EDFA 4Z7OB 1BXUA 3B9KD 5DEGA 3ECBA 4H1LH 3SQOH 1GGUA 1RK7A 4Y2DB 3WUZA 3DOHA 4F15C 2CZNA 4Z7QB 4B9CA 4L3EA 3OKMA 1A1NA 2EVHA 1AGBB 3TH4T 3LNDA 4G6AC 2E5EA 4QNPE 3KG5A 1K5GC 4NO5B 3B9DA 2HYMA 5AOIA 5CEZE 3GGWA 2W65A 4UTBA 2QHRH 2ZXEB 2TRHA 3MROA 3BVNB 3MJ6A 4M7JH 4N5EC 4AQ1B 5CGBA 3RKPA 1YY9C 4OM0H 4XX1E 1I8KB 3POCA 1BF8A 5CKAA 5HYEA 5MI0C 2WYZA 2DW5A 1NAMA 3V4PA 1PFOA 3GJFA 4HDIA 2GUOB 2QSTA 1UQSB 5GGSY 3PAYA 2EH8H 5DVLA 4FI8A 2K45A 1C5CH 4GO9A 1U8NB 1ZMYA 1PY0A 4K94H 2H47C 3UADA 2X38A 1H0DB 2DQGL 1KC5L 2H2SC 2N01B 3DUHA 3GMPB 2HN7A 1Z9NA 3KLDA 5FUCE 3RPIB 5IQ9B 4H25B 4YHZL 1A22B 1SEBB 4OLEA 4I87A 3BPLC 1PKQB 5HGDA 1RK1B 1LQSR 3PP4L 5FF6B 3NCWA 4TUUA 4OT1L 3Q9PA 2KQNA 3U46A 4QXWA 3W3GA 3G06A 1TTFA 2BRQA 1T4WA 1RAMA 4GO8A 4HFUH 5LBGA 2GJPA 1EANA 3K4DA 4KKPA 3S3DB 1SVBA 3CGTA 3INOA 1P7KA 2WVTA 3FB7B 3VD4A 2QLVB 2DM2A 4R08A 1EA9C 1BVKB 3GMQA 5F3HB 3ZDXB 1KPRB 2HFFB 5D8JH 3NA4A 2ARJB 3SDCB 3JV4B 3DX6A 5CJOH 1A6WH 2BIPA 4KHXL 4I18B 3TX4A 5IROC 1FYTA 1LP9B 1LO2L 2JKJA 3BZDA 4MJ5A 2NY1D 2DMKA 3Q0HA 4P5TC 2MJWA 2Z81A 2GCYB 5IR1B 3LKNB 3GRWH 4NDMA 5DJAB 2HVJB 5DJ6A 1L7IH 3OKKA 4HK0B 2EDJA 4PJGE 4L5FH 1WYJA 2VMEA 5FYJE 5MP6L 4L18A 4WK2B 5GGVL 4X4YB 4Y7OC 1KGIA 1NIFA 2LU5A 3GSOA 4PP2A 2A74A 2LOEA 4KZ0A 3SEPA 4A68A 1IU1A 2IOOA 4JFED 2VW4A 3D0VB 3ML8A 4GRLC 3S5LG 5I1HL 1ZV2A 3QUXB 1YQ2A 2DI8A 5LG1A 3L4XA 1MY5A 4KBPA 1CLOL 5EHFA 2WUBH 5HJDA 5IJVB 1IGMH 4N68A 1MHCB 4NQDB 4HD9A 3HG1A 4NP9A 4XPHH 5FKAB 1CICC 4AOFA 1K8IB 3II1A 5ECJE 3QIWD 2XG5A 4PJHB 5EIQA 1J0JA 2C9AA 4YDJB 5IF0A 5IROA 5FECA 3W1ZA 3ARBC 4Y19E 1GS6X 5B0NA 4QTHA 2EIEA 4DP6X 1D9KC 1CE1L 2QR0B 2XV0A 3F5WA 2H45A 3BH9B 3TJHC 3MLZH 2ZOOA 2ITEA 5ADPH 3GM0A 2P5ED 3LZQA 3X12A 3KBHE 2LHAA 2WXMA 1FL6B 3OVUB 3RW6A 3NRQA 1DBKL 1DEEB 4HUWA 4QRPA 5IGXH 2NX5D 1XF5A 3IJEB 1FHNA 3MCKA 4OZHF 2X7LB 1YNLH 4J3OD 4DP1X 5IOKA 3GINA 3TF4A 1T6WA 5SWSA 4HUUB 5DT1L 3X1EA 5DYOA 3UBXI 4GRLA 1UZ8A 1BBDH 1Z7JA 5AKRA 1GMIA 4R97C 5F3FA 3T0AA 4PFEA 1A7QH 4PYHA 3FH7A 4LOFA 3TYFB 4KGJA 3KJ4A 4PRPA 3C9NA 5TH2A 3UG4A 3AS2A 3RBSA 2CGYA 2R23A 3KMDA 2ROYA 1ND0A 4GMSH 2DLEA 4K3JL 2A9CA 1X5JA 2GBAA 4K17A 1C1EH 1EEUA 2RCSH 2HX7A 4KO6A 5TDPB 1A7BA 1CN4A 1LK2B 1BVZA 2FLRT 4G7YL 4I9XA 4OZGA 4Z7WE 3ARBA 5CMAA 3H4HA 3SJVD 8CGTA 3T1WA 1I1YB 3US0A 3W3LA 3LXUX 1D9KA 1AO7B 4M3JA 1PLGH 2AV7B 1QFOA 3MRRB 1U3HC 2MPVA 5SWZD 3GK8H 3AC0A 4BWUA 1N67A 4LLUB 3DGCR 3V8OA 3NAAH 2V17L 4EIUA 1V7MH 1HZHL 1QI5A 3L4ZA 1JTTA 4F37F 3P30L 3U0TA 4PJBA 2UZYA 4WU5B 3DVGB 3FU0A 4X7CC 5KUKA 5JR1H 1WA1X 4L9LB 3V10A 4E41A 4KC3B 4JRYB 1TETH 3OF6D 1T5XB 2Y1ZA 3C6SB 3M18A 1EJFA 3B9KB 3KVDD 5G5DB 3SY6A 5B3SB 3JWDH 5F9JA 4OGAC 3HG1E 2V2WB 3ALXA 1H6EA 1ZT7A 3QPXL 4IKJA 4P06A 3UGXA 2XWTB 1OWRM 1F4HA 3L9EA 3OSVA 5ICXB 1W0WA 2H1XA 3OM3B 4QRUB 1YVLA 5B7MA 3LYRA 4QRAA 2ENYA 2X1WL 5DLMH 2ZKMX 3Q2VA 1N6UA 2NY6C 1JWUA 3QIBC 4PGBB 1NBQA 5ACMA 1E5BA 1OGTA 2GKIA 4OLWL 5KBMA 3IRCA 2BINA 1HHGA 2ZTBA 3A4FA 4Z0BL 1RUMH 1Q1JH 2Z8WC 5AVSB 3K72A 2Q6WB 4OKDA 3O3DA 4W9CC 1TIUA 3ECVA 3DYMA 2RR3A 2ZOKB 3CHQA 3FFDB 5DMKB 4ZFQA 4KRLB 4UINL 3RVTD 2V3FA 1MQ8A 3G7TA 4ZPTA 4XMLL 5DJCB 3RKDC 3ARSA 3ZQ9A 1FZMB 4O51B 2BVOB 4G5AA 4PRPE 2HLFD 3V95A 3SPGA 3L3DA 5DHYB 1S9WA 4UDTA 2BSRB 4JFZL 4RMVA 3RY6A 3TIDB 4KPHL 3ECWA 3I6LD 4GXVH 3STLA 4NUJB 4HF5H 4F2MB 5KVDH 2E6PA 4FMZA 5M95B 3D09A 1P5VB 4MS8C 1B88A 1P1VA 4RMQA 4XR8C 3ZZLA 5TTRA 1RURL 1JK9B 2H41A 3H1ZA 1EAPB 1JPST 4KRNA 5DJ8B 4LGRB 1A1MB 4HWBA 5C97A 3B6SA 4WUKL 5CD5C 3T2OA 1BG1A 2C4XA 4XO4A 4LCUA 5I8OL 1QUPA 5K5YA 3DVNB 4NO0A 4JM2D 3CV5A 3V0WH 2CHZA 1K9TA 4Z95H 3RTQC 2FBRA 3KJ6L 4M7EC 2D0GA 1BQLH 4O02B 2K7PA 3WIIL 3FRPA 4G5ZH 2DJSA 3PXJA 1DCEA 4WCYH 3VG9C 5C6TH 3G3LA 2NY1B 3ILDA 1X7QB 3E2HB 3DHUA 2OP4H 4E5XB 2EUZA 1OM3H 3QQDA 1HI6A 2E3VA 2QGEA 2H0EA 3MQIA 2DPKA 2WYIA 2GJJA 3DECA 5DMIL 2QV4A 2P26A 1LWJA 4XPTH 1T1ZA 2BY3A 4JFEB 5GISL 1E67A 3LKRA 2XWXA 3BWUC 4NIYE 1AD0A 4JFSA 4HUVB 5K9KA 2VRKA 5JQIB 4LO9A 5KSBA 1CDYA 3VA2C 3P9WB 3IGUA 3UTSA 4XT1C 3QNXB 1EO8L 2I9LB 1G9ML 2MCPH 2X3CA 1E5UI 4PEEA 4V33A 3LRHA 1EX0A 4XAWH 1TJHH 3U48A 4M7EA 1P6WA 2W9EH 3QIWB 1TUPA 4S0HA 3FCSB 3QUHA 4OCXH 2BVYA 1OGAA 5HDOA 2EKSA 2VZ3A 1FGVL 2WBXA 1CDGA 1HAWA 3VU1A 5A2FA 4NXSA 4XVTL 2PW1A 5F71A 2E7MA 3KLLA 2P5EB 2GSGA 3RFZC 2H6PA 2VZVA 1UWXH 3HE7C 5DJ2A 1S3KH 4IM8A 4URKA 1PLAA 3W3MA 2WUCL 2ALAA 1MFEH 2NX5B 4R09A 2OMWB 2DLIA 2Y7QA 4YEFA 5KYNA 2HH0L 1FL3B 1EZUA 1OB1B 2R56H 4OGXH 3G3AA 4RCWA 1DR9A 3M1BA 1JF6A 2EDXA 4EOWH 1PZSA 1E5YA 4UZUA 3CVRA 5HYSB 4K8RH 2A0LD 1OPGL 4H09A 4GO6B 3QJQB 4DGIL 4RFEB 4MJHA 2D3VA 1ZY9A 3ME0A 1HEZB 3QJXA 5DI8B 3SJVB 1EXUA 2EAEA 1D5XB 3ZE2B 3VRLF 4DETA 1EZVX 4C8XA 4LCYB 5IQLA 4ELME 1VPOH 3UROR 3UZVB 3LZFL 4PV9A 5SWZB 1IZKA 5I1GH 2Z63A 4X50A 4JKPL 5EDSA 1OAQH 3RFZA 2JELL 3GIVB 5L2JA 1ZIBA 3HE7A 1PX3A 1HDMB 2HTKD 4HIEB 5EZLB 2P1QB 4I9WD 3CFMA 4KFMA 4M5SA 2VGLM 1DVFD 5H2BA 4UIKL 3TT1L 5C70A 3HE6A 4GAGL 1XZ0A 4JHZA 5AAMA 5K69A 3S96B 1OAJA 1TMQA 1OT4A 2L0DA 5EFIA 3WLWD 5ICYB 2EZ0C 1OL0A 1WCBA 1LJMA 2ATPA 3ZT5A 4FJZA 3TEYA 1KY6A 4H8PA 3X11A 5DEJA 2UZIH 4ODUA 1AY1H 3O6NA 3BZEA 5JIPA 5CMNA 2EDWA 3L4CA 3JTSA 1NLDL 3REVB 2P45B 4OCYL 4J4LA 1B0IA 1LXMA 3BT0A 3BHBB 1S46A 1T0MA 3HZMB 3NZ8A 4WJ5B 1HL5A 3FT2A 3GHEL 5DDHA 1YY8A 4DP2X 5CZXC 3B7TA 2V0AA 5FGSA 3ATDA 2NSXA 4ODTH 4R0LB 1BYPA 12E8H 4AGPA 4GJTB 4ZTPL 1I1AC 2XZQH 1I7TA 4PGCB 4OIAA 3O3BB 3VFRB 4APXB 1IC5H 4KXCA 3U2JA 2IH1A 5EN2B 5KANG 5B8CB 1A9EA 1E28B 2YZ8A 4U1JB 3ZDYE 5DJXA 1CTMA 2OZNA 3BD5A 3BUPA 4HMEA 1R5IB 3O3AB 3BVUA 4PWIA 3TPUA 5ENWB 2FT6A 1R5WA 1QLEB 2VR4A 5GJSH 5GIRB 1ZS8B 4MXWL 1KLGB 3GMRB 1GSMA 2APVA 2AP2A 2Z9TA 1GIGL 1S7TA 3CHRA 3CXFA 3Q2WA 4F92B 5HJ3B 4H0GA 4NZTL 4JEGB 4CKVX 1HWWA 2FH8A 3U30C 4PRNA 1BFVL 1T4KB 4NZDA 3FFCA 4PJEA 5G2NA 2BX5A 5I5MA 1HYRC 1B3IA 1IQDA 5FHAH 3Q6FB 5I23A 3TO2B 3L3IB 1Y0LA 2CO6A 2VR9A 4S10A 3L2LA 5D72H 4Q3IA 3EHBD 3UJIH 3KHOA 4DP4X 3O4OC 4OF8A 4HSCX 4GXUM 3WE6B 4L8DA 5F7WC 3HI6H 1TEYA 1PQZA 3ABKB 5KVEL 3NFSL 2NUTA 4JM2B 4M1GL 5C0GB 4LK4A 4GRMA 3VRJB 2QLYA 3BAIA 1M7DA 3QS2A 4Y61B 1QFHA 1KELL 2EEXA 4JB9L 4CSSA 2Y36L 2KH2B 4ZG1A 2WJ7A 4JRFA 3DI3B 1C7TA 4DZBA 4D9QE 2X4RB 2WNWA 1C5DA 4UT6H 5IVXF 2FRGP 4PUBH 3QDAA 2LLGA 3MZTA 3U83A 5EIIA 2PCPA 3EBHA 4J23A 4LSTL 1E0OB 2XV6B 4O4YL 2WKLA 3E9UA 1S7UA 4LMQI 4BH7B 1YYCA 1SVCP 5CIPB 2WZPD 1ILSA 5IFHL 5M7QA 2IXQA 2Y23A 4WZ9A 1WE5A 5T33H 1N8ZA 2OZ4A 4OLVL 3D39D 3P0GB 1BX2B 4XO3A 4BQ8A 3O8XD 4N4YB 4RAVB 3SDDC 1IFGA 3CXDH 2BVEA 3CAFA 2NNRA 4WI9A 1NCDH 4Z7VF 3TVMC 2ZOLB 4ZYKA 4JPIA 1YMMD 3WXVL 4U3HA 4AENA 3FQYA 3L54A 2F15A 2OFQA 3P9LA 4AQEA 1IAKA 2APBA 2BMKB 4ZOCA 3R8BB 5DZLA 4BWWA 2G5BB 3IJYB 5CP3H 3Q3GB 5DVMA 4Z9KB 5IESH 5L2KD 2RALA 3C75A 1JWSA 2NY7H 4XVUC 3CFIC 3MNWA 4HS6B 1Z0NA 1JPGB 4X98B 1Z3GH 4Q2ZB 1ZANL 2DN7A 4U3SA 3SKNB 4ZMQA 4RCAB 2K7QA 3N1QC 2KPNA 2IPTH 3O6KH 3V8CA 2WWKT 2OMTA 2KL6A 3DROA 3O0RL 4JPQA 3OJMB 2DQHH 4YEEA 3SDAA 3B2UC 3DETC 1PCXA 1JN6B 5BRZA 1XBDA 3NRFA 4PLJC 3I50L 1F97A 1UM5H 4Q89A 5CGYC 5C0AE 3BW9A 4RAUA 1JXDA 4FQQB 4QHUA 1RHHB 1D6EA 2FGWH 3EF7A 3F58L 5I9QC 4KJPD 2GEEA 4U6YA 1MCCA 1FBIH 1U8CB 3MFFA 4X6FB 3TVMA 1WEJL 5B38B 2AXFB 2XV3A 1CB4A 1RK0A 3MCYA 2Z93A 4QMEA 3HC4L 2G3ZA 3RJDA 3A47A 3DTDA 2ZSWA 1YEIL 4UNIA 3O6LH 4QKXB 3F85A 4NQXA 4Z5RB 5AD0B 5D96C 5IOPB 2R8SL 3VDBA 3BKYH 2SODB 1OF2B 3G6DL 1XWDC 3FUIA 3FQTA 5E7BA 4ZUWB 2QGDA 3EXLA 3DKHA 4GRWB 2IVFC 4M5ZL 4PVBA 2QQLL 5DQJA 5E5RB 1N70A 5EUOE 5I28A 1AC0A 2AJYL 3JXAA 3EH3B 4PVNA 1ETB1 2WQVA 3KVQA 3O2DL 3O41B 3NOIA 4PD4J 3LSOA 5EZPA 5JO5B 3UO1L 1T7ZA 5AENA 5KAQG 1OSYA 4H1LB 3DSNA 3AT0A 5DR5H 1QO3B 2W9DH 4M7KL 2BK8A 1DVFB 3GBLA 4OIFA 4ZTOH 3G6JF 1ACYH 2WKOA 3BUTA 4MJ6A 5LG6A 4HUMB 2K3HA 1AMYA 2ZOWA 3UXFA 1DBMH 1S5HB 3NSJA 3HKFA 3P72A 1GW6A 4H8WL 3BSZL 4WW2B 3OTTA 4RGOL 3MLXH 5EO1A 1OZUA 3UGUA 4G80B 1D5RA 2EEBA 4A7UA 3QEUB 4DOHE 4B3VA 4I48B 2CMRL 3F04A 4RX4D 1VHPA 1XF4A 4FLRA 1KB5L 3EBAA 3AADB 3P69A 1P4LB 1X4YA 1F8TH 2ADGB 4OTXH 2C9RA 3SO5A 1M3JA 3VYNA 4OQ1A 2UWEF 1TCRB 1BXAA 2ZF8A 3QEGL 1DLFH 4XHJC 1YEHL 2BSCA 5EUKA 2JE8A 4IU2A 4PS7A 2I07A 3D8MA 4Y4KC 3OAYH 5TPWH 5J11B 3WD5L 2XWDA 1IGFL 5CEYB 1NC2A 1KCUH 1WQVT 2P8PA 2OX5A 3MRGA 4Y4HC 5A6MA 2FE0A 2OSLB 3E3ZA 1J1OH 2G2RB 4XBGB 4R90H 1CMOA 1MFAH 4OU3A 5IHLB 1EHLH 3BE1H 5BS0A 3NJGA 4PD4K 3VMPA 1GC1H 2HLAB 1L9QA 4R5TA 1OE3A 4L0PB 1OSZB 2RJMA 1M57B 5AW1B 2YBRA 4QHKJ 4NN5B 2ZAHA 3EJRA 1BW8A 1I8UA 4U2YA 4Z3IA 2D9CA 1FNSH 2KYIA 3NJHA 1GJIA 5HDHA 1FL5B 5MERA 1XWVA 2WO2B 3EHBB 2F61A 3ZE1E 3TIEA 1IAIM 1N9PA 3S0PA 1CXHA 1K5WA 1QFWL 1MNNA 2ZUVA 4JAMA 1AKPA 5DFVC 4Y4KA 3WIFB 3X3GH 1G9NC 3KDMA 4W9HC 5AVXB 4AE1A 1FAIH 1O0VA 3MV7E 5AYQA 2B3IA 1W72L 4Y4HA 4BSVA 2EP6A 3E8UH 3HNVL 4HZ1A 4D9LH 2J12B 4FFZH 4K3DL 4R26H 1HSAA 5DS8A 4YSCA 4LPTA 4ODHH 5FUOH 3G5YA 1NGPL 5F8RC 4W70A 2WOYA 1HINL 1ZV5A 4YHNA 3T08A 3RVWC 4IRSC 5AZ2H 3HRPA 4Z3EA 5I19H 1HIML 3DYOA 1BQHA 1QRNA 1XD1A 3I85A 4DK5A 3L1GA 4J2QA 1EGJL 1GZPB 3LXBA 1KCRH 5A16A 2FQDA 1T0NA 1JPTL 3MRMA 3D39B 3FOMB 3RP1A 3O8XB 3UTTA 2OMUA 4MMYB 4WNQA 5SX4H 4GIPD 4MJ4A 4LQFH 5GGTH 1NFKA 1XHHA 4OF5A 4YHKL 1E6OH 1YMMB 2O61B 1FN4A 3TZVC 3FQNB 3VXQA 4JANB 3UFIA 2K9FB 3QR1A 3EJZD 5MHSE 4AJ0A 1CF8L 2BCMA 4NPKA 4PTUA 1OT1A 2DIEA 3Q6GL 3VXNA 5L2KB 2X3BA 1L0PA 3ISWA 2AJSH 4PRHD 4M8RA 4WWKA 3QDGE 2PCXA 4DTGH 2Z7XB 1S7XB 2Z91A 2WCSA 5T5NG 2LU7A 3RNKB 3U2IA 1KBWA 2CIKA 2AEIT 1WWLA 4YSSA 5ABZA 4FNSA 5E0FA 1JZ4A 1T5WA 5T3ZH 1P84J 2J3SA 5CHNB 3RA7L 3WO4C 3HI5H 4IRSA 1CS6A 4K8RD 4U1SB 1EMTH 4EE2A 1A3LH 3F7LA 5DTFA 2VN4A 1CGSH 4XCFL 3FL7A 3CZFB 2GITA 3HJ0A 1AHWA 4GBXA 1FH5H 2VZSA 1JFHA 4K55A 3AXLA 5C9KA 2WLYA 1TTGA 5D2LB 4R4FH 3VXUA 2X09A 3TZVA 2ZYIA 2WZAA 4Q9QL 5K39A 2XPGA 3BXNA 1XGYL 1S9KC 4TNGA 1TLMA 5I1KH 3MV9A 3RI5K 4OFDA 1DQQB 4WV1C 1SXAA 4R6UA 2DKUA 3FRUB 5INCB 5D7SL 4X5RA 4GQ9H 4EN3C 2ZSVA 2DICA 4ZK8A 1H6TA 5INDB 1JZHA 1I3RA 2X2JA 5D2NC 5KSAC 1JHTA 4KQ4H 2I60H 3DIFB 1GYAA 4UQ3A 5GGRY 3ESUF 1A6PA 4JX0A 1QSFA 5I6MA 1QUNA 2WPGA 4LRNH 3SB3A 2MNWA 1OAXH 3MTXA 2F54A 3I6KA 1HHJB 1KG0A 3QWRD 5E95B 5JTWA 3NESA 2VDML 1U8OA 3OJVC 3UTTE 4I4WB 2RAMA 4I8DA 4DGUA 2VDKH 1FNEA 1E90A 3AVEA 5AOKA 4Q14A 4KITB 1RZIB 3LQAH 3B5GA 5JW5B 5HHMD 1DQDH 2AQTA 3SE4C 1LE9A 2VDNH 4NZ8A 3FUFA 3H2PA 4UM9D 1P84K 3FU5A 3PGCB 3OQRA 4PJFA 3A6BH 4WV1A 3KVPA 3N40F 2NW2A 1EUUA 1G7HB 5AWNH 4A6YA 4EN3A 1GGIL 2HSIA 4N8VG 5DJYB 3FCUB 2YJLA 1TQUA 2Y07L 3L7FB 5EU6E 1R1CA 4OI8A 3G9AB 5CZRA 4JM0A 1KOOA 3EXJA 3QO1B 4Y2DA 1ZDSA 3B3BA 3W0WE 1FPTH 2VLMD 1AGBA 3QCTL 4M1CC 4BZ2L 1CBJA 4NO5A 1MDTA 4TLUA 3UC0H 5EPMB 3TTSA 7TAAA 2K3TA 5JA8B 4HJEA 3VD3A 3BVNA 3N42B 4AQ1A 4X6CE 1LHZA 3QZWB 4P5RA 2BY2A 4HA1A 1I8KA 1JNNH 4A1RA 2VR6A 2WC7A 4K73A 4FMFA 4UQ2B 2XETA 3FQXB 3MV9E 5JPMB 2GUOA 4TUKH 5DHEA 4PGZA 2W38A 4E42B 2I5YL 3MRIB 1RU9L 3PWLB 4YMPA 4WWID 3UTZB 1VCAA 4QLWA 3PPSA 2AJUH 4AUYA 3K2MC 2EVIA 2EYRA 3BPCA 2LQRA 1H3XA 1R17A 1ZLEA 1H0DA 1PNDA 4KTEL 1XIWC 4PJ7B 3GMPA 1BXVA 4K23H 5IQ9A 4H25A 1OARH 4AI7A 2ZX6A 4ZX5A 4DHLA 1UYWH 1OSPH 1PKQA 1FORL 1RK1A 4CKQA 2DI7A 2XXCB 2X53A 1FDLL 2EIMB 1ZEAL 3U4BH 3F7KA 3MI6A 1XMWA 4DWHA 1P6FA 5BRQA 2VABB 1NWPA 3HRZC 4XMXA 3V4UH 3LS5H 3O2DA 5KBNC 1H5BB 5CU9A 5E94B 2NUPB 1LNUB 4NHCH 1BZOA 3CH8A 5HYJD 1XCDA 4L29B 4K3EH 4F8OA 4IMKC 4HLZH 4LPUA 1BWWA 4AUJA 2HFEB 4ZX6A 1KPRA 4XE0A 2ARJA 4JQVA 3SDCA 1NANH 1LGVA 4X5QA 2NQDA 4I18A 3NQKA 1JRHL 1LP9A 3BSZA 2D7MA 2UZXB 5D2NE 4DW2L 5IVNA 1WZAA 3HHRB 2XPZA 1DANT 4C56D 2GCYA 3SDXB 2JQAA 2J6EH 3LKNA 1ROWA 4AM0Q 1RZ8B 1CC3A 2HVJA 2WYHA 4P2RD 3QUKB 3SYPA 5E2VL 5HPMB 3Q7JA 1KB5A 5JW3L 4CAGA 1R75A 4X4YA 3IDYB 4M5TA 1ZVSA 3FAWA 4UIMA 2WY3B 1MJ7L 4PRHB 4V2CB 3AT8A 5FV1L 3NPSB 3QCVL 5T1DL 5I1IL 3QUXA 4C55A 2FWLB 4FNRA 3VD2A 4MASA 1S8DB 3C5JA 4XPBL 4I7ZC 5IJVA 5FYKL 4IMKA 1XH2A 5GGQH 2IGFH 5E5LA 3QO0B 2DJUA 4WFHE 4BHUA 1VFUA 3GSUB 3STZB 3L3HB 5FKAA 1K8IA 1KCBA 1RY7B 2DH2A 3Q5OA 4H20L 3IDJB 1RUQL 2OMVA 4QT5A 3GRGA 4NWUH 2YPVL 3ZKQD 4F3FA 5E8DL 3VI4E 5C0IB 3P3TA 1J0IA 2QR0A 1NPUA 4X6BB 3BH9A 3P2DA 2WYTA 3ECUA 2FEEL 3CIGA 3HZYB 3IS0X 5LBSL 5DD1L 2XZCL 3SGKA 1FL6A 3IETB 1EHAA 1JYVA 1K8DA 4JO1H 2CO1A 1NFDF 4PV1C 3IJEA 2X7LA 2WXKA 1K4DB 2D7TH 3ET9F 1ADQA 1F5WA 3QB7C 4H2CA 1WK0A 1ITCA 3T4YB 1XGUB 2YQ3A 3PDGA 4OGZA 5JQ6H 3LDBC 5I0DA 1MFNA 2FEDD 3VFWB 1UCTA 5CLXA 2P5WE 1AR1D 1MHPH 4JFYB 2F18A 3PJNA 1LEIB 4OFYA 1CFNB 1NINA 1XKUA 4W4OC 1U8QB 1OEZW 2C4FT 3D85D 3OMNB 4KZCA 1LK2A 5TDPA 1KJVB 4FQ2H 5ERWA 5JHMA 2PPCA 2XKNB 4JFHE 1TU2B 3QDHA 1I3GH 3AS1A 1JGLH 2FTAA 4MD0A 2WQUA 2AV7A 3MRRA 4ZAKD 1RZ7L 3KYMB 3REWA 3FO2B 4K9JA 3N3EA 2ZWZA 4XVSH 3NJVA 3MNDA 4XBEH 4ZBJA 3VFSA 3MKKA 5HHMB 4A2HA 5TJWK 1IGTB 2CSPA 3BD3A 5EU4A 1OHQA 3E2JA 2ZWNA 4UM9B 3KPRD 2KDYA 2F19H 1HEJC 1YQVL 4QRTB 5BZDB 3MYZA 1EGJA 2CR0A 3HC3H 4WU5A 5KZCD 1P6AB 3S3CB 4L9LA 3WYRA 4KK8D 2WIIA 1SBSL 1XECA 1MELA 4JRYA 1J9TA 1Q0YL 4B9YA 5A2JH 3B9KA 5G5DA 4UTAL 2VN6A 2OYPA 4DJMA 3PV7A 4NQCD 3MOAH 1E4KC 4NLAA 5HVHC 5JMRA 1L0QA 1LO0H 1NCOA 1A6ZB 3L4YA 2XWTA 5TE4L 2IOMA 5ICXA 5FO9B 1JERA 4QRUA 2P24B 5DJ0B 3AT9A 5TF0A 1QP1A 1LD9B 1J0HA 1OCWH 1NCIA 2CJTA 3D6GA 3D3VD 3N2JA 5FYJU 5CSZB 1CR9L 3P3YA 1V3JA 4MTMA 4UBDD 2ICEC 5SV3A 1UWFA 3T2NL 1IC7H 2Z62A 1F3JB 2YK1L 4I89A 4JHBA 4UT7H 3T6QC 1J5OH 3H55A 1KXTB 2YD4A 2IANA 1XR9B 1HHHB 4FQJH 2OMBA 2P8LB 3QHZH 5GRJL 1PLBA 5H37A 4LCWE 5HGGS 2JJSA 3S35L 4M43H 4G9FA 3IAGC 5C7ZA 2NLJB 4MQXD 5DD0H 5DHXB 2O5XH 2DQCL 2IBZY 4MLIA 2V5YA 3EOAB 1FZMA 4O51A 4MA7H 5C0RH 1G84A 3GEWB 1FWXA 4QRQB 1UWYA 3MOQA 5F96L 2A9ML 2QEJA 1BZ9B 4X6DB 2BSRA 1E4KA 3QXVA 4CP6A 4U2ZA 3U7YH 1RERA 1B4TA 4NUJA 4YIQB 4F2MA 4BFOA 2I7SA 1J87A 1N19A 5GZNC 4NM4L 2DYRB 1HQRB 1WICA 3VQ2C 3FNKA 1W9XA 1EAPA 2JCCF 1IV8A 4RIRB 1IBZA 5DJ8A 1A1MA 2PXYB 3SD2A 1MI5E 5DK0B 4BA8A 4R7LA 3WFCL 3FU7B 3ALPA 1A4YA 1K4CB 5D5ME 3GIZL 4OZ4A 4F9PA 32C2B 4HGWB 5HYJB 3TWCH 2AERT 3FH8A 4JPWH 1MIML 4TQHA 4M6AA 2O6QA 1A4AA 3PG2A 4YE4H 3SQOL 1HC1A 4WI5A 1BVLA 2IG2L 2FO4A 2O5ZH 2O6PA 2W1NA 3R18A 5GRUH 7PCYA 2J1WA 3KW7A 4YBLB 5JIMA 1JIBA 4A7SA 5MEPB 2CJUL 1IL1B 4BBWA 2ENPA 4C56B 5B39B 1C12A 3ARGD 2QHRL 4R4NC 2CA3A 2GTZA 1LVEA 4P2RB 3UL8A 4M8QB 5GZNA 3A23A 2FNWA 3HN5A 5T3ZD 1KBKA 4JE4B 2BY0A 3TBVB 4CC4A 2F53E 4HV8B 4KDWA 3U4KA 2R1WB 1Q9KA 2IO5A 5E1AB 2KZBA 5IB1A 2EDHA 1WP6A 2CGRH 1UACL 3C2AH 2O5NA 4HUVA 1WAPA 2ZXAA 2ZXGA 4ZFFB 3D9AL 4N2CA 4GEIA 2IANE 4OFIA 2QKSA 4K94L 3TBCA 4ZXBD 2I9LA 4BZ2A 1JUFA 1KBPA 4G9FE 3O2WH 3RUGE 4L4VD 2H8PA 1QTSA 2KHAA 3QUMH