1XEUA

Crystal structure of internalin c from listeria monocytogenes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
263
Chain Sequence
ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords internalin C
publication title Structure of internalin C from Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 79
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xeuA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xeuA01
4R6AA 2Z64A 4L3AA 2BEXA 3E6JA 2Y5QA 1NM4A 2WQUA 3FAWA 2RA1A 4R58A 2ASTB 3ULAA 4EZGA 4PEQB 1O6SA 1IX2A 4LI2A 1OT4A 2Z65A 4R5DA 1U0ND 4GLPA 2Z66A 4UFRA 4Q3IA 4BSSA 2XOTA 5HZLB 3RIZA 5GS0A 1XKUA 4M7EC 3RW6A 4RCWA 1DCEA 2OMZA 4R0AA 3UL9A 1LTXA 1JL5A 4R6GA 2BNHA 4ECNA 3SB4A 1M0ZA 4QBZA 1H6TA 2UZXA 4U08A 4M7EA 3O6NA 3ULUA 3RFJA 4RCAB 2Z7XA 3GOZA 4AW4A 4FDWA 5ICUA 4Z64C 3JB9j 5LFNA 4AY9X 5HDHA 3ZYIA 3RGXA 3M19A 4Q3GA 4CP6A 2WQVA 3TSRE 4C2AB 4J0MA 2P1MB 2ELLA 3W3LA 5CMPA 4I6JB 4R07A 1XWDC 1QYYA 1OTNA 4LI1A 2OMTA 1FQVA 3G06A 1WWLA 4LXSA 4C2BB 2C9QA 4U06A 3CIGA 1D0BA 4R6FA 1H6UA 3RW7A 4XGOA 4PKIG 2R9UA 3G3BA 3G04C 5AWCA 4G8AA 4Z61C 2OMVA 3W3MA 5AWDA 1O6TA 2UZYA 1XCDA 5AWBA 4FD0A 4R08A 3M18A 2O6RA 2Z62A 4LXRA 3ZYJA 1OZNA 4CILA 4Z79A 1FT8A 3WPHA 2XWTC 3UN9A 3WPDA 4LSCA 4Z8GA 5CMNA 1P8VA 2O6SA 4FCGA 4P8SA 3VQ2A 4J4LA 4PQ8A 3WN4A 3RFEA 3O53A 4XOSA 4KNGA 5GMFA 1ZIWA 3WPEA 4U09A 5IJDA 1M10B 1P9AG 5B0TA 2P1PB 4U7LA 3FAXA 4NKHA 1O6VA 4GT6A 5GMHA 2Z7XB 4PSJA 2ASSB 1FS2A 1GWBA 3UL7A 4V2CA 4HQ1A 3E4GA 1XEUA 5D3IA 2P1QB 1OTOA 1M9LA 2Z63A 4BSRA 3C6PB 5B0NA 1M42A 4OQTA 5AWAA 4NKGA 3ZYOA 3FXIA 1A4YA 2RR6A 2P1OB 3CIYA 2IFGA 1OTMA 4PERA 1IO0A 4Z94G 3A79B 3W3KA 2JE1A 5FTTB 3G3AA 4WP6A 2JQDA 2Q4GW 4L3FA 2WFHA 2A0ZA 2OMXA 4R5CA 2CA6A 3DZEA 3KJ4A 4FMZA 5A5CA 2OMUA 2WQXA 4KXFB 4B8CD 3E2JA 3BCFA 3BCDA 4TZHA 3CVRA 4BV4R 3C6NB 4QC0A 2OMYA 4WYKA 3E3ZA 1A9NA 1FO1A 2YA1A 3OJAA 4R09A 2OMWA 1OOKG 3UL8A 4CNMA 1OGQA 3OJAB 4FHOA 4ARRA 2C9RA 4CC4C 4V2EA 3REZA 3OGMB 3BZ5A 3PMHG 4MQWX 3P72A 2FT3A 4R6JA 3RJ0A 2WQWA 4P91A 4V2DA 4CC4A 1LYQA 3W3NA 2RA8A 4LSXC 1PGVA 2Z82A 4BSUA 5IJBA 4MN8B 1P8TA 3C6OB 3ZYNA 2JE0A 5IYXC 4QXEA 2V9TB 4KT1A 3WPFA 4IM6A 4Y61B 4RWTC 3RFSA 5IJCA 4LSXA 3VQ1A 4XSQA 3OGLB 3W3GA 5GMGA 3BC9A 3WPBA 5B4PA 2P1NB 4AQ1A 1SQ0B 4H09A 4CNCA 3WPGA 2Z81A 5GS2B 3W3JA 1M9SA 2C9PA 4FS7A 3WPIA 1G9UA 5AZ5A 2V70A 3OGKB 1DS9A 1K5DC 1K5GC 1Z7XW 1XECA 3ULVA 4K17A 3WPCA 2ID5A 3RGZA 4YEBB 1DFJI 1W8AA 3G39A 4ARNA 2O6QA 1KOOA 2V9SA 4ECOA 5GQRK 4LSAA 1YRGA 1KOHA 4Q62A
chains in the Genus database with same CATH superfamily
3BWAA 1QA9B 4X6DA 2CPCA 2Z64A 3KYAA 5L8JB 4ADJA 4QEGA 3MUGA 1U21A 2IV9A 5SX5H 5BOPA 2W80C 4HJSA 4YL4A 5A7BA 3IGKA 2V5TA 1BMZA 1I7TB 1SYVB 3N0AA 2H1XA 4FTVD 3FAWA 5EF0A 4L48A 2XX1A 4ZPTB 5E08L 3BGAA 5IB4A 3RX5A 1BJMA 2FH8A 4F7MB 2K3HA 2WXFA 4YDKH 1XSIA 2KBGA 4OIAA 2BIOA 4D94A 1FF5A 4YLBA 1E5YA 4G6ML 2N59A 3OG6B 2VLRB 3CFUA 1MFCL 3ZMNA 5DDHA 1G1OA 3DIFA 3ZHFA 1YEEL 1KIUB 3DX9A 4FABH 4JFSA 1P4BL 1JGIA 4U1NA 3LEYH 3NIGB 3VXQB 1BXVA 3EHBB 2Q7AA 4YX2L 1G9EA 2ZF8A 2C5DC 5DJXA 1HQ4A 1G0DA 4NLAA 5CLXA 4R0AA 4XN2A 4JDEA 2KZ1B 4S1DC 1H3VA 2HUHA 3NCFB 4LRNH 5T1KB 4JB9H 3HS8A 4N8VB 1RMFH 2DJMA 3B3IA 2W0PA 4WI4A 1WGOA 4QRRA 3WEXA 1TTBA 4V11A 3P54A 1VLXA 3DJRA 3RPIA 1XIWD 4OJCA 2PR9A 4K2UL 1JF5A 1NCWL 5IOPA 1TVBA 2AV1B 4XCYA 2B4CC 3P9LB 4BKTC 3NZHH 3C6LA 3EYSL 2NY7H 2P46B 2IAMD 5B3JE 2LLGA 1FLRL 2G30A 2V9UA 3LHPH 4GO6B 4DP2X 3DPDA 1WVZA 1P6FA 3CZNA 1T3FA 4GAGH 5E8DL 3I50L 2UWEB 4POZD 5BUAA 1NCUA 1E6JL 1KB9J 1Z5LB 3BP6A 3IPBA 4GUPB 4UV4H 5FYKE 3L3DB 1U8HA 4W4OC 3U36A 2QVTA 1NBYA 5SWZD 5JUEH 4B53A 3DROB 5F0PB 3ZHDA 3D39E 2FO8A 1A4JB 4JHBA 3BKJH 5BRZD 3SDCA 1TF4A 3L2LA 4KH2A 5LGHL 1NGQL 4HDIA 4MJ6B 1BQLH 5DJCB 4LL9A 3H0TA 4FFVC 2MOGA 3K6SB 2ENJA 5GGUB 1CYWA 2QT6A 1T04B 2ITFA 5EIQA 3W3LA 1D5RA 5EN2B 2FHFA 2N4IA 4WW1B 3KMDA 4GG8B 5B8CA 1ITCA 3PCYA 5CMAB 4I6JB 5HDOA 4R07A 1UB6B 4LCCC 3DX8A 5I0XA 4DPRA 1OVZA 4LI1A 5JXAL 3WIHH 4JO3H 4PR5B 1J9QA 4FQ1H 1PIGA 1AZNA 4R4BB 2IH3A 4G6AD 5FYKH 1ZWIB 2DQTH 3K91A 1D0BA 2XBTA 2HKHH 3MRRB 4D8OA 3OR7B 5IFHL 4ACPA 2FE0A 5JYMA 1LO2H 1F2XK 1RZ7H 2IGLA 4RAUB 5C3IA 3V8OA 4IGBA 5FCUL 1MZZA 5J6SA 1K72A 1SY6H 3GO1L 1XX9C 2FIKB 1P7BA 2WXMA 4ZTPH 2PWEA 4HUNB 4WI0B 3MJ6A 1MFMA 4X8GA 4AEIH 4PBXA 1JFHA 2CIIA 4JE0A 1WA1X 2IDUA 4B9KC 1AIFB 5I16A 2NUPA 4HJJL 4IRZL 4M7KL 4LF3A 4Y4HD 3N40F 2F61A 5TK2A 3LKSB 4PBVC 3L4UA 1T1WA 1RP8A 5CZKA 1PQZB 3QQ3A 5C09D 4RA3A 3L3KA 1FLTX 4KVPA 4NCDA 5HDQH 5E2WL 3TA3A 3SPHA 3WNIA 3LNFA 3VVWA 4YDMA 2RMNA 3OVUB 5KYXB 4BEIA 4XWOD 3LNGA 2FQDA 4BWTA 4DP9X 3W9EB 2R83A 3NQKA 4TVPH 1M56B 1S9VB 4ISVA 2DEXX 1T89A 4K3EL 2VW6A 4LXRA 2OK0H 1MZYA 2VLKB 4ONGH 3WEMA 4NZDA 4Q9QH 5GS2H 1JWSB 3F04A 1MCPL 2XRAL 5C0DA 4P2OA 2E6JA 2H9GA 3ULSA 2BO0A 1UH2A 1RIUL 1TJHH 1QFWH 2F74A 5ITFB 1VESA 2EECA 3EGXB 2AAVA 2BIPA 2PETA 5CZVH 1FNHA 4LASL 43CAA 4XNQA 4ODHL 5I1DB 4FCGA 4ZUVA 1ZHBB 1QP1A 4OH2A 1VFBA 1CLOH 4AGQA 4Y4FB 5HXMA 3CUPA 4UOW0 5IIEA 2HVJA 1QI3A 5LXGL 3F01A 3LRMA 1ASOA 1WFUA 3LX9A 2ZAGA 2P8PA 1UM6H 5AAPA 5HVWA 2EIJB 2CHZA 3FQUA 4F7PB 1UFGA 4U1GC 2PWGA 1A7PH 4JM4H 2W60B 3RUGB 4LSDA 5J4MA 3CWGA 2V2XB 1JUFB 2GTQA 2BHFA 3T0EE 4LLVA 2FO4B 3FQNB 2PW1A 4IEFA 3QUHA 3SDAA 4JFOB 3T0DA 2Y1AA 1WUZA 2LOEA 4X6FA 2QVFB 5AAMA 3JTTA 4LCWA 4NUPA 4JZNB 2VDML 2ESVD 4U7LA 5JZ7D 5I1HL 3OM3B 5CD3A 4JVUA 4LLDA 1M2VA 3FB7A 5KOVC 2Y0SA 4GKZB 5TDPA 4HOMA 4Q6KA 2Z7XB 5EUOB 3FQ4A 3E9TA 2CUHA 4HUUA 4GT7A 1JV5A 1IT9L 1U8NA 1MAKA 4OLXL 3UYRL 5ANHA 1XEUA 3DVIA 3O9WC 4HIPA 5D2LE 2BH0A 1T22A 1XSOA 5EFIB 4N0FA 4YC2B 3PREA 3NCJL 2G2NA 1LO3L 1NMBH 5A2IH 3NGBC 3V5HB 5I73B 1NKRA 5EORH 4OVVA 4WDIA 2M83A 5C0EB 2WVTA 2Z31B 2X4PA 4NO3A 3FW6A 4PERA 2WB7A 3OB0H 4G6KL 4F58L 2DQMA 4JFPB 2W95A 3BH8A 1AZCA 2PR4H 2PTUA 3M88A 2F18A 1BQKA 4G9FB 4RGOH 3TWCH 5IBLD 2A74A 5ABDE 4QXVA 5IHWA 1C1EL 4A7TA 3GI9H 3N44F 3O8XA 1QWNA 4ZSOE 1KCUL 1AGFB 1CZ8H 1GAFL 5EO0A 2E9GA 3E1ZA 4LDCA 4XCNA 4XBMA 5I75C 2OMXA 5H94A 4JKWA 4GINA 4R5CA 4TXVB 4QRRD 2G5BB 4P4KC 1I1YB 4PLJD 2ISDA 3B9EA 4LRIC 2AEQL 4ODTH 4R26H 2FWUA 4B27A 1HYSD 3W2DH 1J5OH 2IANE 4MSWA 5E6UB 4PJAA 3TPUB 3F7YA 1EGJA 3C6LD 1OM3L 1NL0H 1IM9B 3VD5A 4KXFB 2IDFA 1G7LB 2AEWA 5HHQA 4Y2DA 3PXHA 3IJEA 3OKNB 3WTTA 1G9NL 2AI0L 5I6NA 1EO8L 5F7EH 5JNYA 2JKSA 1A5FH 3IVKA 4KFZC 4PRIA 3MROA 2R27A 2JWYA 3BFWA 5FAAA 3MV7B 4JKMA 3L81A 4FZEL 2FLMA 3MC0A 5LO7A 1U8IA 4LSTH 4N0YL 1CLZL 2HZHA 3MLYL 1BD2A 5FM4A 3VDAA 3Q2LA 4UQ9A 1QA9A 2BWIA 2YOCA 5CCKH 4OIIH 2BVPA 1I7UA 2HTKD 1G9MC 1HNFA 2NSMA 4M7JH 4AKQA 3VD7A 2XXGA 3FFCE 4LPYA 4G72B 2CO6B 4BFGA 1WYJA 5A2BA 2VH5H 1SYVA 1NIBA 2ED7A 4K94C 1HNGA 2WXGA 4PJXA 1IGYB 4ZPTA 5FF6B 5FM5M 4F7MA 2H45A 1E65A 2NNFA 1T7XA 2YPKA 5F7MC 1JP5A 3BRDA 4NQEB 4PB9H 4W9EC 4O2CA 5JHAA 5DCCA 2ZCLL 1TJGH 4M5ZH 2W5PA 2Z7YA 5AW9B 4HZAA 3DX6A 1E3FA 2ZWKA 3FF8A 1BXXA 1IGJB 2YQ3A 4NM8L 4MQWX 2FJSA 1KIUA 4BUGA 3L17A 4FNQA 4L0YA 3DOHA 4L29B 1AR1C 2B0SL 4WQOA 3FQRA 5TTRA 1T5WB 1RUKL 5EEXA 1KBPA 3VXQA 3LQMA 1F58L 4CMMA 3KXFE 4HAGA 3VFMB 1ZE3H 4R6JA 4LCYB 1H8OA 1A7RH 2CGZA 2WQWA 4R96A 3SPCA 4AK2A 5BNXD 3CFJB 3B1UA 1NBQA 5T1KA 2EZ0D 1A3RL 1INDH 5IMKB 2RA8A 2L7EA 2JE8A 4L4VB 2GTWB 4N8VA 1EDHA 2XVBA 4ORGB 5JMOC 1IIKA 3AITA 4IQHA 1OF2B 3BWUC 1J9CT 4XC3L 3ZZSA 5I28A 3ZYNA 2NTFB 3RAJH 5CP3H 2VUKA 2FGWL 1OY3B 5GS1C 3NIDE 1FBIH 5D1ZB 2QPUA 1U8OB 4QHMB 3P9LA 2E7LA 4JGNA 4E9WA 1FCCA 3TA3D 5CEXB 5AG8A 3U7YH 5DC0A 5B1JA 2OCFD 3IXTB 4LT7A 2JCCE 1OARH 4NZRL 4UAOC 1KV7A 2A38A 4GAAA 4KJWD 1SEBB 4GUPA 3BIAX 1KZYA 3L3DA 1BVZA 1H3TA 1YJDH 3T09A 2IDCA 3NVQA 4JFVA 4GG6F 4HWUA 4Z95H 2R8SH 1MCSA 1RL1A 3HZKA 4LSVL 4BINA 1P2CA 4H1LG 1AANA 4ONHB 4P2OD 4I18C 4EVNB 5D7JB 4ALAC 3DI3B 3R18A 4GSDH 4ZT1A 1YY8B 3K6SA 4UUJA 3S8FB 5GGUA 4M7ZB 2L7UA 1T04A 2UYLB 1NPUA 3VXSE 2VSCA 3F00A 5IGXL 1HZKA 1WBZB 3PWJB 5EN2A 1E2VA 2D7OA 4WW1A 1OSYA 5DK2B 2P52A 1BMWA 3PWPA 5I1IL 4CBZA 2V8LA 3KNBB 4HCRH 5EOQL 4Z7UE 3VYPA 5LVEA 1F02I 1UTDA 4XPFL 2WBJC 4XNAA 3EO0B 1VHPA 3T65A 1F00I 1YPZA 2CO7B 2XN9B 1MFBL 3UROR 4BFKA 4PR5A 4R4BA 4ODVH 3BO8B 4K73A 4ZXBB 1MVUB 1WAAF 4QYAA 1WZMA 5EPMA 4FMFA 4FNSA 3RNQA 5TFSL 3MRRA 2EUVA 4M43L 1S9XB 2QMJA 2B5IB 2C3VB 2DS4A 2JCWA 4FQCH 1TZOA 1D2PA 3SDAD 4L8SC 2ZPKH 3F83A 4ZTOL 4JPVH 3TCXA 1IBHA 4RAUA 1OTTD 4KUCF 4B95C 3C5XA 4FX5A 5L2KB 4IRJD 1PYWB 1AE6L 2FIKA 1KGCE 4WI0A 1KN2H 2APBA 2ID5A 3MTXA 1BWMA 1VGEL 2WYIA 1TG8A 1AIFA 1FV1B 1KTRL 5AUMA 2BSEA 3OZLA 3PL6B 4JNXA 5FHAL 4DNLA 4PJ8B 2UY6A 1GGBL 3LKSA 4KDVA 4DN3H 3D25B 4HWZB 4PJ7F 3NPSC 1LGVA 3OBAA 1PQZA 4OBSA 5JPNB 1P69B 3I75B 5J7CC 3ENEA 1N6UA 1A6ZA 5LLIC 4KXZI 1KY6A 4G8FA 4Q62A 2EUWA 5KYXA 2AXGB 2IADA 2FJGA 4FYTA 1A1MA 1SDYA 3VMPA 3HHSA 3O2WH 4FKKA 5D7LB 1IGIH 3IDMA 4MNQE 4NHUA 1CD8A 2VLKA 3AREC 1PY4A 4FFZA 2XKUA 2WW8A 4OLZH 3SE9H 1JWSA 3JV4A 1CFTA 1JZ6A 4H8UA 4GUOA 2AS5M 4AYBA 3P2BA 3LKOB 4K8RH 3DETD 1RUAL 2N0MA 1UA7A 3EGXA 4RBPK 4YE0A 2Z0BA 1T0PB 2JH2A 4HPYL 1CE1L 1ZHBA 4AMXA 3ZT6A 1PG7H 3OMNB 2CBOA 2L04A 2YQGA 3K8MA 1U8JA 3MCLL 3O8XD 4Y4FA 3MUHL 1I8IB 2VE6B 4NKQB 4G8IB 3V0HA 4FG6D 2JKXA 2GUOA 1Q9LB 3L7EA 4UZGA 3Q2WA 4P5TC 5DWUL 1QD0A 2WINA 1A9BB 3G5ZB 4M6OL 4Y5VC 1QSFA 3LOWA 1PZ2A 5CSGA 2YPVA 1THAA 3MLZH 2FB4H 4I2XE 4F7PA 1U8LB 2KQMA 3RUGA 1PD6A 4YL9A 2V2XA 4XVJL 1JUFA 3GRBA 4ECNA 4IYKA 4N22A 1ZCRA 2FO4A 2J73A 3FQNA 3M7FB 4OLVH 4Y2DD 4JFOA 5FUCC 3KZ8A 4GMSH 5E8OB 4F57H 3QP3A 2WIMA 2RGSA 1E30A 4JZNA 2WK2A 3MNMA 3IMWA 1DN0A 1KCVH 4PRID 3B2UC 3CSGA 3TCLB 1FIGH 2A73A 3EKCA 3BPNC 1HH6A 1NFDB 4HC1A 4QT5B 4WNQB 2Z7XA 3GOZA 5EUOA 1BD2D 4XP9H 5IHUH 5ICUA 1FAKT 3THMH 5CXPA 1L6PA 1N64H 2GI7A 3QDME 4XPTL 3JZYA 3GSNL 4Y9CA 1HE8A 1VAHA 2OSXA 4KMTL 2RTTA 3TTYA 3A67H 1XF3A 1N8OE 4IOIA 4PYHA 4ERSL 4ZMQA 1AHMA 3QUZC 3DC0A 2LHAA 1MCFA 2Y06L 3CMOH 3MNDA 1DBBL 5EFIA 4K55A 1GZHA 1FE8L 1KIQB 3V5HA 4PJFB 2XZCL 1MCOH 3RIAF 2BY1A 1IBZA 3ILDA 2Z31A 1K6QH 3FF7A 3ZDYF 3APFA 4H20L 5FX3A 2M1KA 1URZA 1XWDC 2X10A 4JFXB 4JFPA 1GPOH 1WAAE 4G9FA 3K5SA 4YSDA 2AEOA 4RISL 1TYRA 2F7IA 3WUWG 1M6UA 1EBAA 3GIZL 3NA9H 4JRYB 4R6FA 1HK6A 5T1KD 1OP3K 2HLEB 3GKWL 3QAZC 3MNZB 3L45A 2E7MA 3UTOA 2F5BH 4PTUB 4YK4B 4PKIG 5FYJL 4AEHL 2G5BA 1BVLB 1I1YA 2WUCH 1C08B 4N1CA 4AT6B 5F9JB 5ELIA 1ORSB 1YMMD 3UADA 2CUIA 1PJ9A 3MI6A 2YA0A 2FNBA 4LKCB 1QHQA 3WIIL 2EP6A 5BO1H 1SOSA 4LLWB 1P9MA 2ARJB 3VFWB 1IM9A 1G0XA 3GEWB 5E2TH 1G7LA 1JHKL 4MB5A 4U6HA 3OKNA 4PJ7E 2P47B 1ASQA 4IU2A 4XOAA 3CK0H 4M9OA 4OGYH 4KC3B 4ZQKA 4N85A 1CBVH 3CBJB 3MV7A 1CXHA 2HKFL 3QUXB 1GZQA 4X6CA 4R83A 2O30A 1VKXB 1R5VB 2BY2A 3O3DA 2D03L 4MB4A 3UPAA 3B37A 4OLEA 3VGAC 1I3UA 4L9LB 1FGVH 4L8BB 4CKQA 3QO1B 2AJSL 2DJUA 1B2WH 2NY1C 4FXKC 1X9QA 2CM5A 2CO6A 2JV6A 3KPMB 1SXCA 2DWXA 1S7UB 1QHPA 1XBRA 1IGYA 4XXDB 5FF6A 2WXLA 1QLEB 2Z1KA 2NNXA 2Q2LA 1Z7JA 2FDBP 3F58H 3PWPD 3GJFK 3VXTA 3UH8A 4FA8A 2VM3A 4NQEA 1TSHA 5DEFB 1QRND 4BK5A 4E2OA 2EDWA 2HRHA 1H9DA 1WBYB 4QRAA 2J1YA 3AG4B 4OD2B 4JUTA 1K5NA 1IGJA 4YGVA 1ZT7B 3WN4A 4P9HL 3FSVA 3QA3B 3POHA 5A2LH 1T5WA 2QKIB 2DMBA 2XWCA 4U7MA 5G4NA 2GJ6E 3CIAA 3T2OA 3VFMA 2WVUA 1BVOA 2W9LA 1RULL 5BZZA 3TZVB 4LCYA 1MRCH 3SGDI 4MZRA 1TETL 2ZUXA 4LVNC 5JDJA 3ML9A 2R69A 4TNFA 3TVMB 3ATDA 3CFJA 1KTLB 5IMKA 3D52A 4FFWC 4L4VA 7FABL 2GTWA 4ORGA 4X5RA 4XOBA 3QHTC 1OF2A 3K3QA 3HC0B 2BSED 2P1PB 2NTFA 4QRUB 4Y16A 1J5DA 2EIDA 1O6VA 4AXWB 5D1ZA 4HIEB 3SKJL 4BCZA 1U8OA 4QHMA 3VRLE 2X9YA 2VDPL 1JV2B 4Y2NA 4DP8X 5CEXA 2FATL 4FQPA 3MJ9A 1XR8B 3QZWG 3O6LL 4ZPVB 3BN3B 1YEHL 1KCLA 4YHZH 5AAWA 2DQIL 3BDYH 3H4FA 2R29L 4OCYH 1EPFA 4B9ZA 4HQ1A 3TOPA 3VNYA 1AS8A 2ICWJ 3QNYB 1OTOA 3A4EA 4BSRA 2BNRA 4DKDC 4JPSA 3H54A 4ONHA 4YDJB 1HHGB 4MQTB 5F71A 2XX0A 3RLSA 3VACA 4A7SA 4EVNA 5KS9A 3LNEA 3PG2A 5E8NB 5F6HI 3FT2B 1CFQB 1YY8A 1JPSH 1W8OA 3QNXA 4RESB 4W4NA 4AH2B 4E9XA 2UYLA 2WP3T 3NFNA 4NPYA 4OGAD 1S5HA 5GGSB 3ZDYE 4XMKH 1TJMA 3PWJA 1A4YA 1H8LA 1ORQB 3AU1A 3GQFA 2AABH 5CKGA 3KNBA 4Y4FD 5DUMH 1OTMA 2GITB 4F9LC 4LPVA 1ZKAA 4BM7A 4BZ2L 2ZAIA 4Q6YA 3QS3A 5AOIA 1DQQA 1WTGT 3RWFB 2XN9A 4BSJA 2AJYH 3MLUL 6PCYA 4G3YL 1QSFD 3BO8A 3V5DB 1MVUA 4ADGA 4PP1D 4DAGH 4OB5L 2JQDA 1I3GL 4GSRA 3HB3C 1BF2A 3SSGA 5LDSA 2X6VA 1S9XA 4AWJC 3CLFH 4X7SH 3VGGA 4LGPB 4FQXC 1BZDA 2LFGA 2QHLA 4ZFOL 5L2KA 1LLAA 1PYWA 5A5CA 3DGDA 1KFAL 5HI5D 3VFNB 4X5WB 1U33A 3CBRA 1HZLA 3ESVF 3QQDB 3FUMA 2OMVB 1T21B 5JXEA 3KYNB 2YPLE 2HMID 4WW2F 1V05A 1OSPH 3E2JA 1S5IH 1XSKA 2QQKL 1U93A 1HEZB 3PL6A 4QXUL 4UNTA 3QIBB 3MZGB 4PJ8A 1D6EA 4HGWB 1G7PB 3D25A 4O58L 1G7HB 4A2GA 5E7FA 3NABH 2XT1B 1A14H 3I75A 5JIKA 1V7NL 2ZOOA 2OKMA 5DFTA 1A8JH 2D3VA 3KPLB 4XODA 4I3SH 4ZTEA 3E3ZA 3KVDD 2VDRL 2J1XA 3OAZK 4NC0B 2Z92B 4F2ME 3FMGL 1RV6X 2VDQB 2WO4A 3G5YB 3VWJC 2DIEA 1WG3A 4OQ1A 3U4KA 3WCYA 2A6DB 4NCC1 2FWLB 5FGSA 1R17A 1QEWB 2FBJL 2BOBB 3ZDZF 3TXAA 2IQAB 3FYIB 2BS71 2WBKA 4XPBH 2D4FA 5AB0A 3KGSA 2VN5A 2B3RA 2Z31D 5D1QE 5G5DB 4IHOA 1IEHA 4FLRA 3FT0A 1UOLA 1R9FA 2WCPA 3DYMA 1AXIB 1MLBA 2DDQH 2YC1B 4PJDB 2HAZA 5D96B 3VU2A 5JHLA 1DQMH 1FZMB 1LO5B 4G9FD 5D70H 2B39A 3QVAA 1B6UA 4WY7H 4ZMOA 4MNGE 1MF2L 2ITEA 1E4WH 2UXTA 5F8RC 1TCMA 1I8IA 4G8IA 2Q7YB 3Q43A 2DQJH 1Q9LA 3F7RA 1A9BA 5C7XH 1JZDC 4JZJB 2O4EA 2NY4B 2BMKA 3CQFA 4OCWH 3HG1E 3I9GL 5I0WA 1U8LA 4JQIH 1JOIA 4TOYL 2A6IB 1IM9D 3LH2H 4F24A 4YGAB 3GGWB 3C6OB 2IC2A 2Y7MA 3GRWA 4H40A 3LEVL 5E8OA 2AZAA 3ZU8A 4ZS7H 4RRPG 5TE7H 32C2B 3QDGE 3CXDH 1KPUB 3OTTA 3VYNA 5D2LB 1GIGH 3M86A 3MVSA 4QR7A 4UT6H 4Y61B 3HUJF 3TCLA 3PGDB 3I9AA 1NFDA 1GOHA 4QT5A 5J6HB 4HSQA 2AQTA 2MH4A 4RDQG 3GD1C 2YGOA 1MWAA 4HZ1A 1SJXA 4R9HA 3OLDA 3S4SA 2GSGB 4OTXL 4WIQA 1Z3GH 5GMGA 2NXYB 4TQEL 3HAEB 3QORC 3HE7B 5GGSY 5JTWA 1M7IB 1YN6B 4JGUA 2IO5A 2VDKH 4N2DA 1KEGH 4HFUL 1NEZB 2P43B 1LDPH 4LSUH 3VFGL 1KIQA 3ARBB 4WWKC 4PJFA 4ZSOB 1MSPA 5IROA 3GXIA 2K70A 1KGXA 4D9RE 3WPGA 3FTVA 3CMGA 4FKEA 4PV8B 3IN2A 4XXCC 1KT2A 4CN6A 1T7ZA 1U3YA 4DERA 1IAIH 3J8F7 4HUMB 4JFXA 1L0PA 4N6QA 4PWIA 2K0RA 3K7UA 2X1WL 4JG1L 3DK2A 4L4TE 5EOTB 2WKOA 3EO1B 3MX0B 3V9FA 4NKDA 4XB3A 3NG5A 1AZVA 4JRYA 1AQMA 5FLVA 5GGRB 1YECL 1AY1L 3NAAL 4Z78B 4HWEH 3NTCL 5KSAC 5FGBC 3MNZA 1J48A 4PTUA 4PRHB 5HYQA 3G9AB 2AERT 1BVLA 1C08A 2ZZUT 3B2MA 4AT6A 2AV7A 1B0IA 1ORSA 4CC0A 3L9EA 1XT5A 4Y16D 5EF1A 3JXAA 1PLGH 2PCPB 3TEUA 3FFOA 3WLWC 4LKCA 1QOKA 2VR7A 4HAKA 1IE5A 3QG7L 4LLWA 1YNTA 2ARJA 3F6IA 5C0BE 3S9DB 3VFWA 5B3SB 3T4AC 1QR1B 3FFCB 2XQYA 1J5CA 4PY7B 1ZLVK 2JF1A 2NNRA 4KKCD 4JRXE 2WYTA 1I8UA 4FQHB 1KYOK 4KDTA 3S5LG 3ZTNH 2MTPA 3KHOA 2VRKA 1R5VA 4FYSA 4P49A 5E9DE 5CJXC 3IU4H 5BS0A 2BNRD 1JWUB 5JPMA 5JW5B 5IFAH 1MKFA 3QE5A 5B39G 3E6JA 4L9LA 4CVUA 5HYEA 2IG2L 4L8BA 4AVJA 1YQVH 4Y7MA 3IJ8A 3QO1A 5LBSH 1NCGA 5I8OL 3RKPA 3SO3B 4PGBB 1S7UA 2ADFH 2RQ8A 3NRQA 5T1DH 3II3A 4XXDA 5D1XB 3NJVA 2BFVL 2BVQB 4N90E 3LEXB 4WAFA 1OT4A 3FCBA 3EOBB 5T1LB 4LSSL 3DSFL 3F62A 1Y18B 2XN9D 4XWGH 2XLLA 3L5XL 4Z76B 1XKUA 4KXAA 4OD2A 5DJ2B 4S2SB 1RPUA 3DHMA 2A99A 4BE6A 4RWYL 5JYLA 3QA3A 3DBSA 1N6VA 3F64A 4XHJC 2DBLH 2QKIA 2VLME 4KTDH 4LLMA 4X5XB 4CMHB 3NIDB 5L4FA 3AM8C 4XNZC 1OAUH 2FX8H 2BLFA 2JXMB 3O3AB 4TVSa 5L2KD 2H3XC 1L3WA 2X4NB 4R6GA 2FYVA 4J4PC 2PMZA 2WJ7A 4UOQA 3TVMA 1HCFX 4H8WC 5D2NC 5DLMH 1KTLA 4Z7OF 4E41A 5K5YA 2JCCB 3NCEB 5JXED 2MPAH 4TSBL 1UQSA 3LS5L 1TUPA 1EHNA 2K4WA 3L5WB 3OMZA 3K74B 4OLWH 1Q0XH 4NN5B 2NQCA 3HC0A 2M26A 4EZJA 2QGDA 3PL6D 2C7UA 4QRUA 5MENE 2ERJB 4U2YA 4AXWA 2CUMA 3G5VB 3B9KA 3SN6N 1JV2A 4QOKE 4AENA 3V0VB 1GKEA 4JQVA 4O5LH 1UT2A 2PCXA 2V9RA 4GOSA 1DZBA 1OT1A 2GAZA 3CFKA 3EYUL 4HEME 4ZPVA 3VFUA 1INEH 3DPBB 4AY9X 4PCKA 1JRHH 2L0DA 1M3IA 1ZV2A 2V0AA 1KBKA 4YBQC 1E9PB 5DQDH 4Z7UB 1OL0A 1R3LB 1ZPLA 1NFIB 3FHEA 2IPUK 2ZUYA 3HCVA 3QNYA 4W9ZA 4F8LA 2NY3D 3TSRE 4ZX6A 1FFOA 1HHGA 3BPOC 1KV3A 1XGPA 5BJTB 3FT2A 1CFQA 4AH2A 2P1MB 2R4SL 2HJLA 1LILA 5FB8B 5L2JA 1OB0A 5D71H 5GGSA 4PJEE 3QEGL 3ULUF 2L4OA 3CNKA 3LZFH 3HI5L 1ORQA 2DIAA 4ZNCD 4U2ZA 4JPWH 2BOCB 2Y72A 1T83C 5GSVB 2FGZA 4JFHD 2GITA 2WYHA 3TJEL 3SKUD 2WZ6A 3AS1A 4Y89A 5GZOA 2RFXB 3TBWA 1FQVA 5GGRY 43C9B 4KO5A 3RWFA 3N1GC 4JPQA 5FO7A 2UZPA 1M6OB 1BREA 1AQKL 4O9HL 3EAKA 3KM2A 4Y1AD 3P9MB 1ZLWH 1X7SA 5SX5K 5EC2B 4Y4KB 3D4CA 4V33A 3KBFA 3US0A 1KB5A 1MOEA 1X7QB 1J8HD 4LHUG 4M6AA 4W1TA 3OKEB 2E27L 5DC4B 4YHPB 3VU1A 2XXFA 3AB0C 2YIHA 4OGXL 1GS6X 1UH3A 2ATKB 2J12B 3VFNA 3G08B 2ITDB 5E08H 3QQDA 3LQZB 2OMVA 3QXAB 4UQ2B 3KYNA 1IQDA 2JJSA 4N24A 1NZRA 2Y36L 2XETA 1HXMB 2C8NA 2WO2B 3TBTA 4ANVA 2BCKB 4MNQB 2EH8L 1HEZA 4I87A 3VD9A 3QIBA 2MHAB 1R34A 5ESQA 3ZXAC 4G6MH 3MGAA 1G7PA 4HGWA 4UTBL 2ADIB 5IVXE 4F8OA 1G7HA 1MFCH 3DMMB 4BFRA 4XNDA 1ZXKA 4PBDA 3RWJB 2BC4A 1P4BH 1L9SA 2Y7OA 3MN8A 1T1YB 2YD4A 2Z92A 4G9DA 3TWYA 4YZFF 1NANI 4WEUD 4UDUB 4YX2H 3G5YA 3MLPA 3BEWB 5INCB 1DJXA 3CC5B 5IROD 3SGDH 4Y1TA 1FT8A 5DHMC 4KKRA 1HXKA 1OCCB 5IM7A 3HBGA 4XNYL 2D2OA 4ZX5A 4CDGC 4LEEA 4G80B 4NQDE 5G5DA 4UTAA 2F7QA 2K45A 5CMNA 4PJDA 1WT5A 2BZ7A 4I2XB 1NCWH 4KKQA 3WSQH 3DRQB 5J12C 2X4RB 3V0FA 1PFCA 3QPXL 4JRYD 4CKVX 3EYSH 2VW7A 3F84A 1FLRH 2PWDA 5I19L 2Q7YA 1JGDB 3AY4A 3LNIA 3PV7A 5E8DH 3I50H 3VTAA 1E4KC 3MV9E 1E6JH 3FUDA 4C4KT 2XQBL 2WBXA 1BQHA 2B9AA 2AHIA 1A64A 4KY1L 3L4XA 1DCLA 5AVVB 3RL1B 1HKLL 4JZJA 2G5UA 4IMKC 1NH6A 4LLQB 1WZLA 3SBWA 4Y4HC 2A6IA 2OL3L 2W1NA 3QDMB 4WVRA 1NGQH 5F6HJ 4CBPA 3GGWA 3ZTCC 3IFOB 4NKHA 2DN7A 3FT1A 1J0HA 32C2A 4ZDHA 1KPUA 2D3LA 4KMLB 4P2RD 5D2LA 2P1YA 3AWEA 2V5MA 1VA9A 2ASSB 2K7QA 5IQ9A 2DTSA 1JNLL 3ZUNC 4XMWA 5BS0D 3FOLB 5J6HA 2WOYA 3P11L 5JXAH 1N4XL 1CXFA 4NNPL 1CFVL 4U31A 5CBAA 5C0GB 1F90L 4OAWB 3ABMB 4DGYL 4X9GA 1M71A 2EVGA 1CLCA 4NP9A 2HT2D 5FFGA 1F6LL 2E7BA 5E00B 1SFDA 5IFHH 3HAEA 1I75A 1NQBA 2BJML 1QPXA 3K4AA 3DO7B 1M7IA 1CG9B 1FFNB 1YN6A 4ODXB 5T3ZL 2EVHA 5AWAA 5B1BB 5FCUH 3VYOA 4WUKH 3GO1H 1UENA 5I18L 2VXTL 3DO3A 2LAGB 2V37A 4RVBA 2NT0A 1BQ5A 3CIYA 5FA4B 4PV8A 5TH2B 1UH4A 3RWHB 1JGUL 4Q2ZB 3KJ4C 4Y8DC 4C4BA 2BY3A 1UKQA 2J8UE 2JTDA 2ATPA 4HJJH 4IRZH 4RX4A 1IBGL 1GTNA 4R8WL 1MHEB 1U95B 4MAZA 2AXFB 3EO1A 3MX0A 4OI9A 3W0WB 4OF8A 3AU0A 4OZGE 3LH9A 4QLRA 5MERB 5E2WH 3TVMD 1TNNA 5GGRA 1YC8A 2GG1A 1XGTB 1TVDA 3P1VA 4UQIM 3DZEA 4PRHA 2OLDA 1DE4B 1D2OA 3DOSB 5AVSB 4K3EH 3L95B 2XWJB 3NFPB 5I1KL 2A7BA 4J3OF 5AVZB 3B9KD 3TS8A 2R23B 4BKSC 1MCPH 3WNPA 3S36L 3UJJL 4NQUA 5KYYB 4QCIA 3WY1A 1RIUH 5AW3B 1QR1A 3QR1A 3FFCA 4PY7A 3CFCL 5ALCL 3AGVA 4N2FA 1LEGB 4LASH 5I82A 4M29A 5DSCB 1TCRB 1V3JA 2BVYA 4ODHH 1BFOB 3O3EB 3SGJC 3MO1B 4JL2A 5ANME 4FQHA 4YZFE 1A9NA 3GM8A 4OF5A 1JI1A 5JW5A 1JWUA 5E1QA 5FFLA 5IEKA 2HKAA 5LXGH 1MFEL 1F3JB 1YVLA 1RXLA 2F19L 2DLIA 2NMSA 3TGXA 1YRKA 2W38A 3WNNA 4JDVB 4OU3A 5K9OA 2IGFL 4PGBA 1ILSA 3ARUA 1J9TA 5D1XA 2BVQA 3CDGB 3LEXA 5K59F 2CH8A 5GZOD 2CHDA 3TF4A 3EOBA 2GQHA 3VD4A 1ZTXE 3ARGB 2VDMH 3UPCA 4Z3JA 4EOWL 3W1ZA 1KOAA 5I1HH 2E75C 4BHUA 1TDQA 3JWNC 2EDXA 1BJ8A 3OKDB 4RAVB 1QWUA 2FJFA 5KVGE 4A7GA 3AZUA 1ZS8B 4RGMB 4X5XA 4JHUA 1HYSC 5TDOB 1N3NB 1IT9H 3O3AA 3N85H 3CFDB 2X4NA 4OLXH 4ZW5A 3U4EB 3MRHA 4LSXC 3UYRH 1U2CA 4BE5A 4DKEL 4Z77A 3UL4A 2JCCA 3SQOL 4OFYA 4TNGA 5HJ3B 2PO6D 2WWOA 1RZGB 5AKSA 2JE0A 1B2YA 1G5AA 4QXEA 3NCJH 3BVDB 3NZSA 1LO3H 3Q7JA 2FYYB 4L2LA 3RDTD 3MBWA 3OLEA 3OB0K 2Q6WB 3F05A 2A6JB 3G5VA 5IG7B 2J56A 5L7XL 3EJCA 5F7BA 4EF3A 3HN3A 4RWTC 5D72L 2XZZA 3V0VA 2EC8A 4NHCL 5MHSE 1OGTB 5EOCL 1T0NA 3ZO9A 4G6KH 3OGLB 3RBSA 3R8BB 2BSDA 4U1JB 5BMFL 4GBXB 4R4NC 3MJGX 2P9RA 2DEWX 4BUHA 3PGCB 1CF1A 1FNGB 2QL1A 1C1EH 2YMXL 4LPCA 3OX8B 1INQB 1E9PA 2QBWA 2CKNA 1KCUH 4JREC 1NFIA 1GAFH 3QARA 1NA8A 1MFDL 3O6KL 4HKBA 2EIZB 1EXGA 1O7DC 4D8PA 1JDAA 2OYMA 3D4YA 5GJTL 4KHXL 4AQ1A 5BJTA 3T8XA 4C56A 2YXVA 3JWNG 2AEQH 2YD6A 5FB8A 3SDXF 4U3XA 1CGVA 4HWBA 1C7TA 2YAQA 3QYNA 3GBNL 1TQSA 3UBXB 2DYPD 1LWJA 5L88L 4Y5YB 5HP5A 4XPGL 1OM3H 1IBFA 2BOCA 5DWPA 4FS7A 5GSVA 3WHE1 1XGZA 1RH8A 3P4LA 4MMXB 1VFUA 4JFFE 2Z34A 1G9NH 2WP3O 2AI0H 4PG9B 5IVZB 2RFXA 1E43A 1EO8H 5PCYA 2CWRA 1RZJC 1USZA 4F7EB 4ANUA 4J8QA 2YPLB 2MQ0A 2BNUB 4MAYA 4MD0A 5DVKA 4FZEH 2PPEA 5E6YA 1GGYA 3B43A 3P9MA 3T8MA 1TO5A 4N0YH 1CLZH 4UYPA 3CZFA 4Y4KA 1GGCL 3MLYH 3D51A 3R7RA 1PPIA 4L3EE 4MD4B 1X7QA 3GXMA 4I5BB 4JJ5B 4RGNC 3OKEA 4BFNA 4YHPA 3KM1A 3RB5A 2E5EA 1ZDQA 5D7IF 1JNJA 3IS0X 4TTGA 2VWEE 4HT1L 1ZGLB 3G08A 2ITDA 4ABWA 4UQ2A 3QXAA 4F2MB 1OK8A 2H8PB 2RACA 3NJNA 3MRMB 2FQEA 2YD0A 5ICZB 5E6IB 2NTSP 1Q38A 5AKTA 2ZP0T 3B7TA 2ZCLH 2YLHA 3ZE1B 4ECOA 2IBGA 3D30A 4PHZA 3DMMA 5D1QB 3P69A 4NM8H 3RWJA 2ZSVB 4P2OC 2B0SH 1P4IL 3ZRCC 2DQFB 1SM3L 4PWKA 2H2SD 1F58H 2ICEB 1AVAA 5DMGC 4UDUA 1E3ZA 2CRIA 2PTVA 1UXLA 1SZNA 4PIBA 3NCWA 1HHKB 4J3OH 3IDGA 1JPGB 1NCBL 2EDJA 3CC5A 3V0WL 1JAEA 4FRWA 4NBZB 1A3RH 1RZFL 3F12B 1RI8A 2MQCA 1J0YA 5IY5B 4G80A 1N0LB 4Q97A 4ZAKB 1JVLA 3C60B 4XC3H 3RILA 2C9UA 2FGWH 3HG1B 1MN4A 3DRQA 1GL4B 4OIFA 2X4RA 2D0FA 1KJ2B 3LAFA 4GLRI 3DKHA 3ULUC 4N2NA 1JGDA 4NZRH 1ROWA 3QDGB 4IRJC 4PRHD 1LP9F 4XHQA 2XWBB 4LFHG 4LPUA 4MFHA 1K2DB 3V7AG 1A1NB 3UZEA 3RL1A 4ZFGL 4NZFA 3JWDL 1CI3M 3ZHKA 3HR5B 4LSVH 4LLQA 3ARRA 4UQ3B 1H6TA 1IEBB 4P57B 4Y5XB 3HBQA 2WTPA 5IR1B 5EZIL 3T9WA 3BPLC 3QWOB 3AC0A 2DD8L 1CGWA 2WZAA 1P53A 4NC2B 3BAJA 3OXSB 2HT3D 4I1RA 5F7UA 5IGXH 4LIQE 4O00A 3V6OA 5I1IH 4AW4A 4URKA 3U6XA 5EOQH 1EGJL 4PJ9C 5K39B 3GB7B 4XPFH 3KW7A 3FOLA 5KN5A 4HUVB 3RI5K 1CD1A 4DTGL 1MFBH 4XP4L 2CA4A 5C0GA 2EC9U 4OAWA 1MCEA 3DTDA 1AJ7L 1E8ZA 4OI8A 1T66D 2JJVA 5TFSH 4LGSB 3WTXA 4M43H 3MODH 2X88A 1H5BC 3J2PA 4F8PA 3IWUA 4N0UA 4HK3N 3DO7A 2XSKA 1REIA 1CG9A 1FFNA 4L4TB 4ODXA 4ZTOH 3QRBA 3ZQXA 8FABB 1CICB 5FUCE 3BHBA 4DQAA 4WNSA 1BQSA 1AE6H 2Y7SA 2FBOJ 1NIEA 2DM7A 5FOBB 3FN0L 4AV4A 1AIZA 1DBJH 1H15A 4HGMA 1K8DB 1PDKB 5FA4A 5TH2A 4W6XB 1Y6NR 5K9QG 1I8KB 5A6LA 4Q2ZA 3PV6B 2CO4A 1VGEH 2IDSA 2VL4A 3FCSB 3N42F 4DZBB 3ZTJG 4X9BA 3HVNA 5FHAH 1MHEA 1GGBH 4J3VA 3RGVB 1U95A 3BAKA 2AXFA 1SOQA 3W0WA 4KUZL 5DMYA 2VZTA 3ZUCA 3A4FA 1HWGB 5C0BB 3EF7A 1NMCC 5MERA 4IRSC 4G7YL 4IHBA 5ISZB 2AAAA 4J2XA 4MDIB 4OFYD 3BLKA 1T80A 5GRWA 3S35L 1VB9A 1Z66A 1XB6A 1BZ7A 5KBMA 1M05A 5ILTL 5C0AE 3U30C 3DOSA 3EGSA 2XWJA 3NFPA 3STLB 5E9DB 2KKQA 4FMVA 2R23A 1MJ8L 2NX5D 3NJJA 3V9CA 3VI3A 3L3JA 3K2KA 3MU3A 4F5CE 1RUAH 4I8DA 1WS7A 1S7QB 3UG5A 6FABL 1LEGA 1TCRA 3H2QA 4HPYH 1CE1H 4J23A 3SOBL 4RA0C 3O3EA 4HKJB 3MCLH 1QACA 3LN4B 1D5XA 4ZMTA 3IT8D 4FHBD 5HGDB 4AQAA 1XBDA 4GI9A 3WHXA 1F3JA 5BRPA 5DWUH 4M6OH 4C56D 1A22B 2QV4A 2VM9A 2BWDA 4JKPL 1QBBA 2B1HL 1B9KA 4XVJH 4L1DA 3VWKC 4WI3A 4Z8GA 5E8EA 3CDGA 1TITA 2FEDD 5ID1A 4CL7A 3ARGA 5TD4A 4ES9A 1OW0C 2DPKA 4MAYD 4XBPB 2W94A 4NO5A 3K2UL 2ICWA 3OKDA 5M94B 1KLGB 2BDNL 4RAVA 5E4EC 4XOSA 4Y4KD 1BBDL 3HPJB 4S1SL 1ZS8A 5MENB 3X3FL 4XPTH 5TDOA 2BOLA 2E86A 3GSNH 4WGWB 3VXUD 4HX1A 4QOKB 4KMTH 4EUPH 3CFDA 2DV6A 3U4EA 3UMTA 2XJKA 4ERSH 2Z4TA 2A83A 5F70A 3AG1B 4W9FC 3ZDWA 2VR8A 1RPKA 2VC2B 3FOMB 5HJ3A 2Y06H 5HD8C 4JCMA 1DBBH 1RZGA 2TRHA 2G2PA 3QEQE 1FE8H 2NY6D 4DK5A 5F3BB 2Q6WA 2OZ4A 5GMHA 3GSUB 2XZCH 4ONOA 4J12A 4KK5C 4WFGD 3UJTL 1EMTL 1DVFD 3FH8A 2Q20A 3K4DA 5BZWA 2Z9TA 4Z7AA 4H20H 2RALA 4PGJA 4BBWA 5BUGA 5TDNA 4ANWA 1GJWA 4U1JA 4GBXA 4MCNA 4PJEB 3S3BB 5H2BB 4DETA 3D34A 1G94A 1WH0A 3PGCA 4O4YL 1FNGA 4RISH 5HHVL 2NR6C 4AQZA 3E8UL 3GIZH 3OX8A 1INQA 5DUBB 1U3NA 3FBKA 4PGDB 3GKWH 2EIZA 2ZIDA 3UO1L 4OQTA 4YEEA 2C1PB 1PZUB 4AEHH 1KF9B 1NEUA 3H53A 4FLHA 1UATA 3GZQA 4G1EA 2EDTA 2J8HA 2RR6A 3TPKA 4F7KA 3WIIH 1E5ZA 3GMQA 3UBXA 2L8AA 4FFZL 4Y5YA 1N26A 3HNTH 5FA3B 1JHKH 4C58B 4WTQA 1SDDA 4MMXA 1FFTB 1IMHC 1NFAA 1FSKB 1TJIH 4PG9A 5IVZA 3H2PA 2D3JA 2X41A 2Z0UA 1W16A 5KJRL 4F7EA 1U3HC 1WWBX 2BNUA 2HKFH 1UASA 2A0ZA 1ZHKB 3TEYA 2D03H 4KRLB 4DHLA 1UXWB 2VAAB 3BVVA 3KLDA 3BFQG 5IVXB 4I5BA 4JJ5A 4NUJA 2X6CA 2AJSH 1P7HL 1WWWX 4RAHA 3UOAB 1XF5A 3MRCB 1HILB 1X5FA 2YPVL 1WCQA 4EJ1C 4P2YA 1ZGLA 1O7SA 2X4OB 4O51B 1EEYB 1P1VA 5TPWH 2YA2A 4TZHA 3DTXB 3TJHC 2H8PA 4ADIA 1S7RB 1SXNA 1HH9B 2OBGA 3MRMA 2NYKA 5DJ8B 2FL5A 4RMSA 1XAUA 5AVRB 1YYML 3QC5X 1JVKA 3D7PA 3QIWA 2GVYA 4HULB 1F13A 1JMXA 1NCJA 2XTJE 1XH3B 4LPXA 3SDDB 1OOWA 2E7HA 1XCQB 3GNML 4HUXB 4P9HH 2ZSVA 3GS7A 1MEXL 2DQFA 4X8JB 4HC1L 2VN4A 5F93C 1KFGA 1G7MB 2ICEA 4AQ8C 1NDMB 3R06B 4OGAC 3FT4A 4LESA 1RULH 4U6XB 1UOWA 1HHKA 1TETH 1JPGA 1B88A 2E47A 2QTVA 4GY4A 3U1QA 3D0VA 2HJKB 2YAEA 2R2EB 1NDGB 4HMDA 1UD4A 7FABH 3ZDXF 1BP3B 4KZDL 5C9JB 4G1MB 3ML8A 1N19A 1N0LA 2VERN 4ZAKA 1CT8A 2WVVB 4E41B 1W2KT 2FLBT 3BP7B 3IDUA 3RIKA 3B83A 1EEZB 3P73A 2KZWA 5E51A 3QJFA 3SKJH 3W0WD 2OI9B 4QY8B 5T5FA 2VDPH 1KJ2A 2YFNA 2C9VA 5KAQG 4ZMAT 2GSIB 1XH0A 5LDUA 2FATH 3GBDA 3KPPA 4ZUUB 3K1KC 5KBLA 1GYWA 3O6LH 2BZCA 4W93A 3QDGA 1YEHH 1HL5A 4XBEH 5DHXB 4NN6B 3NP3A 3QIUC 4XPAL 2XWBA 4IK7A 2DQIH 5HI5C 4PLKD 2R29H 1K2DA 3OB8A 4NPKA 3PDOB 5J11C 1ZK5A 3FO0L 4ANKA 3AQZA 1OGAE 2Q3XA 1OTUC 2V9TA 3HR5A 4UQ3A 2O61A 4KNTA 5HI3D 3HS9A 4YSEA 3T5WA 5IR1A 3QWOA 2X1OA 4NZTL 1GSKA 2XZQH 1MCQA 2AJVL 4HWNA 4QHPA 4YFLF 4XXWC 2CDEB 4IDJL 3OXSA 4U1GB 5L8LB 5EB9A 2O5YL 3VQ1A 3QYCA 3L2MA 2NY5L 4KGJA 5EO1B 1NDTA 4BZ2H 5K39A 1VEMA 3GB7A 3MUUA 3NH7L 3LZLA 5T3XE 4HUVA 3K4ZA 1F56A 3MLUH 4Q74A 4G3YH 4TSAL 1UFUA 5IHLB 1S4IA 4FP8L 3MV8A 3WGVB 5TE4H 2J8UB 2J1ZA 3NEXA 4OB5H 3TO4A 1I3GH 1E8YA 4KXBA 4HU8A 1JF6A 4H8QA 5IUSA 2D8KA 4M1CC 5G4OA 8FABA 5EIIB 4OZGB 5A7EA 4J3SA 1KFAH 2C26A 5FOBA 3C6SB 1S78C 3CFNA 4R2GC 1ZHLB 2BIMA 2KL6A 1K8DA 1PDKA 3CBKB 3IEAA 2ZP9A 3RX9A 1KSRA 1F4HA 3PV6A 1MJ7L 3MV01 3FCSA 2G3NA 2QQKH 4MZIA 4ZBJA 4DZBA 4QXUH 1NCTA 2V70A 3NGBB 3ETBF 1FHNA 3RGVA 5I1CL 1HFUA 4O58H 4YHYC 2YKLL 5DUJA 3CZJA 3AQXA 3CQPA 1V7NH 3IKCA 3VG0L 5ISZA 1T7WA 3HRPA 4JFZL 2VDRH 4CVWA 2P5WA 3CSBA 3FMGH 4M61B 1QFWM 3TP4A 3SDYL 1TZGL 2AFNA 2FBJH 3STLA 1DFJI 5E9DA 3O81A 3G39A 4K5NA 2R69L 4FHKA 1KPRB 5I75B 3GMNB 3OXRA 4P4KB 1A4BA 3EW3B 2XKNA 1VCAA 1S7QA 4GBXD 4XGZB 3SE3C 4XNBA 4HG4K 5D6DC 1UEMA 2ZAHA 3P2TA 1MF2H 1FQ9C 1T4KB 1ZANL 4HKJA 3ZHLA 2RBLA 4PD4J 3LN4A 3S3JA 3OSVA 2XICA 5EMYA 1WAPA 1BVNP 3NJHA 2G5RA 1NM4A 3MJ9L 5HGDA 1F4XL 5DRNA 2AVFA 1ODAA 4XT1C 1P5VB 2ASTB 3ARVA 4R7XA 3INUL 3IBEA 3I9GH 1IJNA 1IX2A 1U2YA 3QZLA 4HISA 1VSCA 4TOYH 1A9VA 1CS6A 1ZRUA 3Q8CA 5EUKB 4DOHB 5KWYC 4HHWA 4Z3EA 3LEVH 3PWUB 3LZOA 1Q9OA 1E7VA 1U8CB 3PQYB 4BELD 3D2UB 4RIRB 4RQQA 4L5FL 2HWZL 4XBPA 2QVMA 4RCWA 3CXFA 5HY9B 3TBVB 2X0UA 1KLGA 2DJ4A 3T0WA 5KUKA 3HPJA 3FS9A 1ZV9A 2V17L 3VD1A 4AM0Q 4UQAA 2O93L 2P5EE 3ILPB 1CBJA 2OMZB 4ZD3L 4KQ0A 5BXFA 3KBEA 4QOKA 4KTYA 3PAYA 3SB4A 1EIBA 3FSOA 1AR1B 3PNRB 4TQEH 3FOMA 5E24E 1DQJB 1M7XA 2P44B 4MS6A 2DI9A 3GTVA 4LBAA 1FG2A 1KCRL 1ZT4B 3VFGH 3QIWD 3BSZA 3MLXL 4MRBA 5F3BA 5F7NC 3GSUA 4GKOA 3FNKA 1SHMA 5BRQA 4WU7A 3CDYA 4HUCA 3FCTB 3L5IA 2IPTH 3I02A 3L4VA 2DQEL 4CSTA 4I9XA 1SUHA 5ADPL 1U8QB 2QSCL 2XNAB 1HTYA 4Z7VF 2JKLA 2WIIB 1P5UC 4PJEA 1ZVSB 5GS1B 4JG1H 4LOEA 5C0FB 2YD1A 2F1EA 3RWEB 1A7QL 1SXAA 3SD5A 4LPWA 4Q3GA 1KZQA 5DUPL 4HLZH 3WI9A 2Z8WC 1FZJB 1AY1H 1YECH 3NAAH 4JFFB 3NTCH 4PGDA 5D2NE 4F15C 4C2AB 4J0MA 3P77B 5DURD 1W0YT 2KHAA 4UAOB 4ZAKD 1XO8A 2W92A 2V9QA 4MMYB 5C6TL 5D4QA 4X7FC 1HJBC 3FFDA 2NYYC 3BGFB 3MCKB 3TBSB 3AMKA 3QG7H 2VRQA 4L3EB 4XI5D 2NCMA 1YNKL 4QHNA 4I18B 1NCOA 1JE6A 3RYMA 4LXSA 1B0RB 3BP5A 3EUUA 3UXFA 5E1AB 2PWFA 3L2NA 5JHLL 1VPOL 3PGFL 4PS4L 3V0IA 5D5MF 1M53A 1PX4A 2R1WB 2ARWA 1XB3A 1II4E 1D5ZA 2ADJB 2VSMB 4FTVE 4HD9A 4X4ZA 1JXDA 3QSKB 1AXTL 4A2HA 4LCCA 3U1PA 5DHVH 2WBJB 1X5YA 1UXWA 2MQGA 2VAAA 4NENB 5IVXA 4FJZA 1XDTT 2IG2H 3Q9PA 3LQAL 3QZNA 2ZKXA 1CC3A 5I8OH 4Z61C 3MRCA 3IFPB 4CJ1A 2ZYSA 1HILA 2JVUA 1OAYL 4PLOB 4EKJA 3STBA 2E3VA 4EXPX 5C2BL 2BFVH 3DTXA 4YDZA 4OZIE 4L8SB 5F44A 4LSQL 3CXHJ 1TQBB 2B08A 4MMZB 4JL1A 4JPKH 1ZIBA 4LSSH 3GRWL 4WEMB 5EZLB 3DSFH 4AEEA 1URLA 3S6CA 4CDHA 1LEKB 1XCQA 5A3ID 3MV8D 1NFKA 2NY3C 4HUXA 2PTTA 4RWYH 1IC5H 1X7TA 3TO4D 1GY1A 1OZNA 1G7MA 3MRPB 1NDMA 1NUNB 5BZXA 4P59L 4Z7NF 4U6XA 3NPSB 5KSVA 5CEZD 1MWAL 1TTGA 3RB7A 1AQHA 3SPVB 3CPUA 2IBZX 2HP4A 4ZUWA 1JTPA 1NDGA 3ZPDA 4TSBH 1LMIA 3LS5H 4G1MA 3SCMB 1CQYA 3H56A 4RMRA 3G6JE 2IWFA 2VRAA 2WVVA 3B5TA 5TGBB 4NDMB 4AG4L 4AI7A 3BP7A 3ZKQD 4UOW1 4G8GD 4X6DF 4AL8L 1EEZA 1MELA 3AREB 4JK0D 3MNVB 2AJZB 5SWZE 2QHRL 1NCIA 4QY8A 4OUOA 4BCXA 1ET8A 5BQDA 3VI4B 3MMEB 5BRZE 2K9UA 1AGCB 1CLVA 3EYUH 2P5WD 2I25N 3EOAB 3M07A 4RDBA 3MR9B 2VISB 3WDHA 3ES6B 3MRNB 3PDOA 1MH5B 1DQDL 3DVGB 3S3PA 2VKXA 3IDXL 1LD9B 1I1FB 2CG9X 1JPST 4YLQT 4JY6B 2FUQA 1ANUA 1Z0MA 3ROLB 1E4XL 1HOCA 2HT4C 5K1JA 2BSTA 3BD5A 4Y5VB 2R4SH 4OCXL 4JN2B 2CDEA 1F3DH 1YEGL 3QEGH 4AYGA 3EJZD 3HI5H 5ESAA 2C9AA 3UL7A 4OT1L 1HAWA 4Z7VE 3TJEH 5EO1A 3L54A 2P8LB 3TONA 2M8XA 1ZLWK 5C86A 3L3OC 4LP8A 2P24A 3DARA 5I8KL 4D9QD 5D3IA 3ARPA 4L8DB 4O9HH 4NPJA 4M00A 4LHJB 1A6AB 1OOAA 3BPNB 2J8UA 1D7DA 1T7YA 3OWEA 3PRZA 3GMMA 3OAUL 3OAWA 2GEQA 4F7TB 2B14A 3NRPA 3GI8L 3CZSA 4FCHA 2JLPA 4OZGA 4P2QD 1CGSL 1BAGA 3MQIA 4UM9B 5C09E 2J25A 4YUEL 4OGXH 3OLGA 1JNHA 3O9WA 4D0BB 2Q8AL 1BGXL 3PWNB 2NW2B 3KBHE 4APQC 4X9YA 5IW6A 2XCMC 2D0GA 3JZ7A 4G8EB 1QLEL 4OZFH 4DQOL 3VW3L 2EH8H 1B9ZA 4BH7B 4PVBA 4UTBH 4W9KC 1ZSDB 4Z0BL 3CCHB 1KEML 1SHSA 3DV4B 2CJSA 3MJ8B 2H32H 4XNXL 4DP4X 3RY5A 3Q8BA 1HS6A 4XX1G 1T5XB 3R1GL 3HMWL 4NZUL 4EMZA 3EGDB 3PP3H 4M61A 4J2QA 2WYZA 3PJLA 4DKFL 2R0WL 4C59B 4J3BA 3ARFC 2ZD0A 4S1DD 5IB3B 2VR5A 3FQYA 3BCFA 3NZ8B 2QQQA 1MW3A 1KPRA 3QAZB 4XNYH 4N2IA 5DZAA 3GSNB 3GMNA 3GLZA 2J3SA 4LHQB 4ELKA 4P4KA 2XG4B 4HOXA 4FQ1L 4LRIA 1BFSA 3NDZE 4XGZA 4QC0A 2DQTL 1CO1A 3BVXA 5IJKC 2HKHL 4PJHA 3QPXH 3SE8L 1T4KA 4QHLB 2WQRA 4MKMA 2VO5A 3CJJA 4UINL 4K71C 1I8MB 5I19H 4Z7NE 3QC6X 2YRPA 5DGRA 5ACLA 1A6UL 3UBHA 3B2VL 1E0OB 2A77L 2XQBH 2ESVE 4N3UA 5SWSD 1YO4A 3WS6C 1QSEA 1MFUA 1HKLH 3RJOA 1JHLH 4BFOA 4HETA 1BYNA 3O6FC 3FU9A 1BFTA 4HV8A 5FV2A 3REZA 3LNHA 2OL3H 3VGAB 5B3NA 3DJ9A 3OKMA 3PWLB 4X6DE 3LJ3A 2Y69B 1CN4A 4FFVD 2NY1B 3D2TA 4FXKB 4OKVA 2MNJB 4YHLL 1PEWA 3PQYA 1PL3A 4F7CB 4MA7L 2ZONA 3O3BB 3D2UA 1MWOA 3TLRA 1KXTB 15C8L 2OZNA 5HY9A 1KWGA 4JAMB 3TBVA 3ZQ9A 3R8QA 3BISA 3WJMA 3VFSB 1JNLH 5IT2L 3U48A 2X89A 4TF4A 3U9UB 4KRPD 3P11H 4H1LA 4HIJB 3HFML 1N4XH 3ILPA 3CSTA 4NNPH 1CFVH 4U3SB 3RVVD 2NOYA 1F90H 4Q9QL 3B9KC 4HS8L 1MJUL 4GAJL 4WU5A 4DGYH 4A7UA 4QAWA 2WLHA 4Z7WB 2ZX9A 4G71B 1YC7A 1RJCA 5GGQL 3SKMA 1CD0A 3WKQA 1DQJA 2JJUA 5IYXC 2BJMH 3N1QC 3CGTA 1YCSA 3ISRA 5E5LA 5T3ZH 5CZVL 9PCYA 5HJGA 5B22A 4HXAL 1ZT4A 1NKOA 1TTUA 1HHHA 3KLQA 4LVNB 2IBBA 3C2AL 4AC4A 2VXTH 3HZYB 3JYBA 4YSCA 5I18H 3K2MC 1RHHA 2X7LB 3ESOA 3DVFA 3GLDA 5D4JA 4DK6A 5IV2A 4CSZA 1V55B 1JDDA 1W8NA 3FCTA 1JGUH 3MTRA 1OP9A 3JWNE 4P46D 4YSRA 5DYOA 1L4IA 1U8QA 4U05A 2J71A 2XNAA 1M9WA 3GBEA 3PNWB 4QRRE 4WK2B 1IBGH 2EE0A 4R8WH 2WIIA 1B0WA 1ZMYA 4BWWA 1YEDB 1ZVSA 5GS1A 5C0FA 3RWEA 2Z93B 3QEUA 1TLKA 2GI0A 3BVNB 2MKWA 1LVEA 5J56B 2DWTA 1FZJA 2D7MA 5CN1A 4Q9BA 4TM9A 4FNUA 1EFXA 2IH9A 4EEEA 1DZ0A 2OTPA 3CFEB 2CIKA 4E41D 1CDBA 4MMYA 5BW7C 2JK5B 2VDQL 5I1KH 3I6SA 3NSXA 1M9SA 2PP7A 4OJYA 2XUWA 5KANG 1PZAA 3BZEB 2EDLA 3TBSA 4UI2A 5E0QA 3S36H 3UJJH 4LP5A 4I18A 3EFOB 1B0RA 2AJUL 4UTAL 2XWEA 5E1AA 2Y1ZA 3CFCH 5ALCH 3SOTA 4AGOA 3PU7A 3D3VA 2J57A 2WN3A 1WHOA 4UIMB 4IBUA 1N2RB 1PSKL 4A6YB 2ADJA 4X4KA 1K5GC 4MBOA 5D8JL 4JM2F 2PO6C 4XMUA 4X7DC 4AGNA 2UV3A 5FYJU 2WBJA 3RDTC 4XMXA 4NENA 4W6YB 4JZOB 2V7NB 1FPTH 3FQXB 5EORL 2XZAL 3HW7A 1HSAB 2B7DT 1O9ZA 3GXTA 4LARL 5E8PB 3SD2A 1A7OL 4BFJA 2IGFH 1YG9A 2N56A 3HB3B 5E5RB 3CN2A 1J10A 4MA3B 4QRSB 4K5LA 4L8SA 1N8ZA 3T8VA 3L3GB 4FQXB 5GQRK 4KKZA 2Z7UA 1KIRA 3IDJB 4QXTB 1FO0A 1CIUA 3RVUD 5EZLA 5F7LB 4X4YB 1ETB1 3CTTA 2FR4A 4KJYA 1LEKA 1E9QB 3JYCA 3ZBMA 1FFPA 3NESA 4XN8A 2N0KA 4AYMC 2WQUA 3P9WB 3ULVF 5E6RB 1XF2B 4NKIL 4DUWA 2OXHB 4ZOCA 1CD9B 3HNSL 1EWHA 5DEGB 2F1AA 2H6PA 3SPVA 2BS9A 3O9WD 4DKEH 5CHNB 3SQOH 1DFXA 4NRYA 1UYWL 1RSFA 3TBYB 1PKQB 2G2RB 1IEAB 2Z66A 3BJLA 4GEJA 1UWEL 5TGBA 4NDMA 3AREA 2D7PA 1MIML 5L7XH 3RTLA 4WZ9A 3QFGA 5D72H 3OZKA 1DJWA 4IOSD 4NHCH 2K9FB 2CNZA 3VI4A 3MMEA 4X5QA 3G6AB 5EOCH 5K1VA 1W6WA 4WKZB 1AGCA 3SE4C 4HKXB 5FOJA 1EXUA 3EOAA 5BMFH 1HVXA 2BNHA 5ESVB 1G5GA 3MR9A 2VISA 3HRZB 3MRNA 4YAQB 1MH5A 2GJRA 2YMXH 4QMEA 3DVGA 4MJ4A 1LD9A 4U08A 1I1FA 1WIPA 5FKPB 4JY6A 1MFDH 3O6KH 3QCVL 2OYKA 4I0KA 3ROLA 3ZT5A 5GJTH 4KHXH 1HXYB 4P5TA 3V4PB 4Y5VA 4RCAB 5DK3A 2DB8A 3CH1B 3NIGF 4JN2A 3KD4A 2GBTA 4GAFB 3GBNH 5EU3B 5F88A 3WUWA 5L88H 2WXOA 4XPGH 3FZUC 3M8OL 1KBVA 1LWRA 2P8LA 4LVOB 1R5IB 3OJDB 1I3RB 4GW4B 2EEBA 1DJIA 3DUHA 4W9GC 3B7SA 1WWCA 4J39A 1E5AA 3MRIB 1IO4C 2AZUA 4XNMA 4L8DA 1QSED 4PJGE 5F96L 1A6AA 3BESR 3LVEA 2BVOB 5G55A 2VCOA 1GGCH 5EG6C 3EYFB 4F7TA 1QNZL 4MNHA 5F0JB 2VOTA 1N70A 3BVTA 5KSUB 1EHXA 4UM9A 2QGBA 1JF1B 1QFOA 3PQYD 3Q5OA 1WBXB 2UWEF 4HT1H 1JERA 3D2UD 3QUZA 1UADC 3UGXA 3PWNA 3VMNA 4D0BA 1SMAA 2NW2A 3QORB 1FNAA 1W0VB 4E42B 4QNPE 3S5LB 4G8EA 5FYKD 2MMXA 5JW4N 4G8AC 2NY0C 4YHIA 3VE0B 4IU3B 3CHRA 2OJEA 2Y5EA 2CU9A 4TRPL 3AS2A 3FN3A 4WWKB 3Q6GL 5B39B 3IJ9A 4U0QB 1FGNL 1ZSDA 1KTDB 3OQRA 2QPEB 3DV4A 3MJ8A 2WHVA 4KTEL 5J3HD 3UTZB 1N0XL 1P4IH 3FK3A 2APWA 2BCMA 3IU3B 4L1HA 4XN7A 1DJZA 1SM3H 1OV8A 1J87A 1XXFC 3VFPB 1ML0A 1LDSA 2G4EA 3EGDA 4XCEA 2HT3C 2J55A 5HYSB 1NPJA 2VT0A 3GKZA 4PRPD 3TEZA 1NCBH 3O4OB 4DW2L 4MWFB 3V0WH 4H8VA 5AW5B 4HCRL 5F9WC 1PNCA 1RZFH 2YHGA 2GBUA 2L7QA 1NMAL 4FNRA 3OPZL 3TFKD 3V2AR 5IQNA 3ZMEA 4N9OB 1DDHB 3DX7B 2XG4A 5DR5L 2J88L 2G0LA 4MCYB 1ZGLM 1SQMA 2O1AA 1CFNA 5I0ZA 3I84A 4TVPD 5F8QC 2FK9A 4HXBL 4PJAE 1GYAA 2QEJA 4FNTA 3T4AB 4K0OA 1I8MA 3GTNA 1OPGL 1N59B 4ETYA 3SGKC 3C09B 3WN5C 3ULAB 5GS2D 1EFXD 1E7UA 5B38G 2IJ0C 5J8OA 3QBTB 2X2IA 5TJWK 2HFEA 3P3RA 1KN2L 4PRIE 4ZFGH 4KU1A 2WD0A 1SF3A 2J4WL 2TAAA 4OD3L 5B7EA 5C0RL 4XO5A 3LSOB 1BD2E 5DD0L 5EZIH 2B2XL 3PWLA 1UWXH 4PJ5A 1QNIA 4B7LA 2YAPA 2ZYHA 4FXKA 3QZWA 4LLAA 1G4MA 2R0KL 4F7CA 3VX1A 3D3VD 5H37G 5HHOA 3GF8A 4HWBL 4PJXE 5GMFA 5FO8B 1JYXA 2WAQA 5HDLA 1EGJH 1X4YA 4FLOA 3VFSA 3VSVA 2XKSA 2WBJD 1N18A 2D31A 3VAEA 3VB8A 2R1XB 3U9UA 3WTSA 4DTGH 1RFDL 5I15L 4HIJA 1DJHA 2NLJB 3OAYH 4U3SA 4XP4H 3UG4A 4NSKA 5TF1H 1ULVA 3GMOB 4HIHA 1RU9L 4HOZA 4W9LC 1AJ7H 4Z7WA 4H7VA 1N12A 5B0TA 2YO3A 1ACYL 2XVLA 2ZOUA 3LD8B 2O6FA 4XX5A 3WNKA 1FNEB 2AEPL 1OAKL 2PLTA 1T6BX 3D6GA 1RUQL 3NIGE 2DRUA 4GSXA 5F6IC 4XNZB 2ZYRA 1IAIM 2FH6A 1HE7A 1PG7X 1YEIL 3H9SB 1FC1A 3HZYA 1MNNA 3V52L 1MI5B 5DHVB 3FN0H 3MBXH 3MLVL 5D2NB 1J11A 5CN2A 4M8UA 4C57C 3HS0B 1H3UA 3RUGF 5E2UL 3PNWA 3FO2B 1X5XA 5HVHC 1THCA 1G1KA 5EZPA 2KZKA 1YEDA 4HBCL 4FAAB 4LHUB 1F3RB 2Z93A 4KUZH 4JEGB 4XCCL 3MRGA 4DN4L 4MQ7A 1MRDH 4G7YH 4XOEA 1EXHA 2FEDC 1GJUA 3S35H 3ZYOA 2YWYA 3IRCA 2VB5A 1WICA 1JGVL 3CFEA 5DFVC 1F11B 4FTVB 5ILTH 3C87A 5EUOF 4BKLA 4G6JL 1J8KA 3DUSA 3HMXA 4L1SA 1X5JA 5DQ9B 2EIKB 4E9RA 5MEOB 3BZEA 3H4HA 1MJ8H 2ZG3A 3E80A 5DRZB 3BPOB 5DF0A 2G9HB 2WC7A 2B1AH 3INOA 4B41A 4DEPC 1XVSA 1ZXQA 2X4SA 3VD3A 3NA4A 6FABH 5CUSL 4JGMA 1HHJB 4F3FB 2DWSA 5EZJA 1N2RA 2PYFA 3SOBH 1BW8A 3PHAA 2LV4A 4IS6B 4A6YA 4OF7A 4OZIB 5D6CB 5D9SA 3EBGA 3PWPE 4F9LA 3TBBA 4GAYB 1ID5I 2VMDA 1QRNE 2OMUA 4P5TD 1P0SE 1CDHA 1YPZE 2E46A 2QQLL 2V7NA 4FQQB 5AYQA 3FQXA 3LRLA 1HSAA 4WV1C 1DVFC 1OE3A 4ZO6A 3BCDA 4JKPH 5LGJA 4IBLT 3WN6A 2B1HH 3IDNB 2X3CA 3QZBA 1EVTC 2FIRT 4PWFA 5C07A 4MA3A 4QRSA 1XIWB 3RFZC 2YAFA 4JS7A 4GRLC 5I5MA 1OAXL 3L3GA 4FQXA 5EF2A 3VNZA 3DJSA 1NLBL 2WTRB 4H8PA 4QXTA 3AB0B 3T2NL 3P0GB 3GFUA 1A25A 1XAKA 3B2UD 3NPZB 3K2UH 1E9QA 2BDNH 1DQVA 3G6JB 4ENEC 1BBDH 4WHTB 4S1SH 3T0VA 4G43A 3X3FH 2GBAA 4NGHL 5CJOL 4CNMA 4EN3C 1FCGA 4UM9D 4FHOA 1S7SB 1KYFA 5DEGA 3QQNA 4RRPA 5BRZB 2C9RA 4LDLB 3QUZD 2HUEA 1OZTG 4LNRB 1MW0A 1WCBB 4H0GA 4AC2A 4X6CF 1PKQA 2X4UB 3TBYA 3V4UL 3VFVB 3VWJA 3D07A 2HVKB 4JVWA 2YRLA 1FYHB 2O6EA 1BM7A 4BA8A 2JELL 4PVLA 3AADB 3OGCA 4URTB 3WV0A 4CU8A 4L4JA 4M6MH 5CZRA 3N91A 1I7RA 3UJTH 1D9KC 2VXUH 1EMTH 2GUYA 3EYOB 5EV7A 3MLSL 4WKZA 3BKMH 4HKXA 4FZ8L 1BDYA 4I0CC 3W3NA 4NRXB 1YYLL 3JTSB 5ESVA 3SPJA 4O4YH 4JRLA 5HHVH 2YSSA 5K33A 4YAQA 1MPAL 3E8UH 3GSRB 4WSGA 2GT9B 3QXTA 4OGQC 1RVFL 5FKPA 2MNWA 3HZMA 4N1EA 3ARZA 2F6AA 4YE4L 2COQA 3UO1H 1CPUA 5EH1A 4JM2C 4Q14A 1RZIB 2AQPA 2WJ5A 4EKXA 2Q76B 3V4PA 2DTML 5HYFA 3A5VA 1BXAA 1VF5C 4ATWA 1UJ3C 3Q0HA 1QSFE 3UBGA 4NI3A 5EU3A 1L5GA 2IV8A 4XSQA 3W3GA 4OV5B 5D55A 4FFZH 1WFNA 3RUGE 1B4RA 1AG6A 4Y4HB 5CWSA 5DRXB 3JWDC 1AXSA 1BIHA 5C09B 1R5IA 1XL6A 3UIYA 4GW1A 1UJTA 4GW4A 2W0KA 1YEKL 4XMZA 1HWHB 3IMSA 2DKUA 3MRIA 4W81A 4AGPA 2P1NB 5DTFA 2BVOA 4L18A 1IKFL 1A6TA 1UGKA 5AOJA 1P4LA 5JW4R 2FT7A 3IGAA 2VQUA 3KAAA 4PJ5D 2X9XA 2DLEA 5KSUA 3ULVC 2NT1A 4LVHC 1JF1A 5DGQA 3VUAA 1WBXA 3EBAA 2YPVH 5AOMA 5HHOD 4H2AA 3N1FC 1J1PL 2F7PA 5DJDB 2I07B 3QORA 4G42B 4E42A 3S5LA 2UUDH 1TU2A 4YJZL 4FI8A 3SKOA 1A66A 4PLKC 3VE0A 4IU3A 2JI1A 1GGTA 3NQIA 4WWKA 1J8RA 1UUNA 5LNEA 5B39A 3GSWB 3X12B 3GTTA 3V4LA 3LRGA 3GNMH 1F8TL 2ZXGA 1E27B 1KTDA 4XXCA 5L0QC 3Q44A 1X5LA 3KJ4B 4KI5C 5HI3C 3UTZA 1MEXH 2DQHL 3KL5A 4BFBD 5FECA 2EICA 3BP4A 4HC1H 2I60L 1M7DB 2BRRL 4P0DA 3FQWB 1DP0A 4G9FE 5SV4A 3FUKA 5GGVY 4Z7NB 5KSAA 2Z1PA 2XTLA 3OL2A 3RVXD 2XBZA 3NSCA 4FFWD 5E5UB 5FGBA 4KZDH 2EKSB 2EILB 1K4CA 3BUBA 3WTUA 4NP4L 3DX7A 4LOVA 2XTSA 4CW1A 3N40P 1S7XB 2VITB 2V6HA 4MCYA 1KBBA 3W38A 1HKFA 1I9EA 2BIIA 3DIDA 3ECVA 4J3WA 1AS7A 3F5WA 3NJLA 3DBXB 2K4AA 2OR9H 3BWAB 4KJPD 4OF0A 3T4AA 1AO7B 2JKTM 2GIYA 5GS0C 4O2FB 1N59A 4OI7A 2AXJA 3APMA 1YUHB 5BPPA 3ULAA 5KVDL 1HIML 1S2EA 4XPAH 5B4MD 3I2CL 1BHGA 4AGLA 1X5IA 3R4DA 3FO0H 3F6JA 4A04A 4X6CE 2VXVL 3D33A 3H55A 3EH1A 1SVCP 1KXVC 3SGEI 3KPSA 1U0ND 5CJXA 1GHFL 2PP8A 3LSOA 4FLQA 3MRLB 4UFRA 2XOTA 1J0IA 4OQTL 1E6OL 4M4PA 4NZTH 3UAAA 2KZBA 2AJVH 4KQ3L 1L0YA 3CSYA 4IDJH 2I5YL 3DX9B 5JIMA 2YMOA 1EZVX 2OJZL 4O02A 5F1SA 4U1NB 3AAZB 1RLBA 2O5YH 1PW3A 3FH5A 1EFQA 2NY5H 5A16A 5AYTA 3V0EA 3A23A 4DUVA 3NH7H 5DJXB 1HL9A 2NLJA 3B4NA 4TSAH 3TH2T 3ARYA 1M0ZA 4M8VA 3GIVA 3GMOA 4FP8H 2YEVB 2FWOB 2C3WA 3GMRA 4NLHA 3AUVA 1N5YL 4H0LC 5BO0D 5C07D 2LE9A 1V10A 1DN2A 2AW2A 2WMPB 4P3DA 3RPIB 4ZMLA 3AT8A 3QDJB 5DZ9A 3AM8A 4FQXD 2WNXA 4CGTA 3H9SA 3KYKH 3I6GB 3KJ6L 4J4PA 2EDBA 3QR0A 1IE4A 1MI5A 3QZPA 5D2NA 1KLUB 4WK0B 1ESOA 1IC4L 5FHBL 4R3SA 1NCAL 2WKLA 3D1MC 1BVKB 1MJ7H 1NGXB 2FT6A 2AQRA 2WUBL 3BP6B 4J27A 5C7XL 3FO2A 5IMOA 3U36B 2WLZA 1H8NA 4IBYA 3D06A 4GH7B 5I1CH 1R0AL 4LHUA 4Y9GA 2YKLH 3VG0H 5H35A 4JY5L 4Q9RH 2H6OA 3SE6A 2K8MA 1BG9A 4JFZH 2AEIT 3G6DL 2AF2A 3UTPD 4DGWC 1NFDF 4YIQB 3VWJD 5CMPA 4IW4C 1F11A 1JHTA 1GIGL 2KLSA 3SY6A 1C7SA 3SDYH 4X4ME 3I74A 3JT0A 1QYYA 5MEOA 3L9YA 4JREB 2O5XL 2R69H 1A47A 1IC1A 3DX8B 1UWGL 5MP6H 5TK4A 4YHKL 5DRZA 4KRMB 2BNRE 3JWOL 5CEYB 1BOGB 2V7HB 3IE9A 5KS9E 1HSBB 1CK0L 2BSSA 2PCFB 4WI6A 2ZXDA 4F3FA 1HHJA 3FU8A 1IB5A 2X4QA 4LPTA 2XFXB 1BXUA 4L5FE 3UPRB 1L9NA 4IS6A 4OZIA 1ZANH 2EDEA 4PAZA 4PJFF 1T83A 2FQFA 1KJ2L 5T5FL 1JZ4A 3V0AC 3NN8B 4GAYA 3WMSA 4F33B 4MYWB 3MJ9H 1F4XH 1LDPL 4GNKB 1GMIA 5GHWL 5K9KB 2XN9E 4NNYB 3BSGA 1QUPA 1BOYA 2EIEA 3INUH 4FQQA 1TEGA 5FW7A 4N3TA 3T4YB 1IRAY 4TYUA 1IFGA 3EOTL 3GXFA 3MPCA 1HQRA 2NUPB 1V8HA 1WEJL 4LQFL 3T71A 5I16B 2L3BA 3MOAL 1T2QL 3AFLA 3LRSA 4JPIB 2AQ1A 1FC2D 1T1WB 4JCWA 4K7PY 1F6AB 2WTRA 5DJAA 5L2KE 4N2AA 3TA3B 1J1XL 1XF4A 2AQSA 4KUCD 3RP1A 3WKNA 1A6WL 5GRUL 4TN9A 4L5FH 2HWZH 4KKPA 3WD5L 4CN1A 4R08A 5F1IB 2ALAA 2PPFA 3EJQA 3G6JA 1KIPA 5IHBA 1TR7A 3QQ9C 1Q4NX 4LCIL 3UX9B 4EN2A 4DVBB 3HJEA 4W6WB 2XWTC 4ZD3H 4ZK8A 1DLHA 2YLKA 4JHZA 1S7SA 1WPCA 5BRZA 4XI5C 2JKWA 1U3JA 4P2OB 3MRQB 3ECUA 3HC2A 2Y2WA 1CGXA 4LNRA 3R19A 1WCBA 1E42A 3CVDA 2X4UA 4J8RB 3KPRB 3VFVA 5AW7B 4AYFA 3RHWF 1KCRH 2H0FA 2HVKA 2R2CA 4XNQB 4ZUVB 3FN9A 2C4FT 4WWKD 4EIBA 3MLXH 4CSPA 3UP6A 3ZTNL 3BZ4B 3T0AA 1USQA 3CUPB 3QQ4B 4DJMA 2ADYA 1VENA 3UCRA 2DQEH 1QFHA 4TUKL 5ADPH 2OFQA 2QSCH 4N26A 1GGIL 4BA0A 2ETWA 3W39B 1E67A 3U7WL 4NRXA 3SIKA 2CO2A 1A7QH 2OW7A 3LXAA 4UB0L 4WSKA 5DUPH 4QAMB 4LLVB 3GSRA 2GT9A 5KSAD 4U6TA 1KG0A 4JFHE 4PN6A 4X6FB 5CD5C 4BH8A 4IRJB 1RZIA 1E4KA 4GW5B 3FONB 4K9JA 2Q76A 2QV2A 1S7VA 4PIRF 4B9GA 2EUXA 1NAKL 4PJGB 5C6TH 2AJ3A 1OQOA 4LLDB 4PSJA 4N8UA 5A3IC 1MFAL 1M2VB 5HDBE 4KNQA 3RVTD 3WLWD 2FLRT 4IMKA 4Y1AE 3UDWC 2SODB 4Y4HA 3KS0J 1YNKH 3QYMA 3BPLB 4HS3B 4M1DL 5E56A 4Q7DA 1J8HE 3IPFA 1RZKC 3CVCA 5JQ6H 1KGWA 1Q1JH 4UT7L 1U8NB 1VPOH 5JHLH 3PGFH 4PS4H 4YQXL 1TENA 2BIQA 2FJHB 4F1SA 1OP4A 3HI1B 4K3DL 3ATBA 5EA0L 1VIWA 4PTTB 4HJEA 3VG9C 4PJ9B 1CFBA 3KPSD 1ZV5A 1NEPA 2CDFA 5E5MA 7PCYA 3L16A 4QGYA 1BQUA 1TMQA 1FI8C 3LQAH 1SHWA 1UD5A 4M1GL 3TU6A 4AYDC 4KK9C 3ABZA 1ZK9A 4X7CC 2HRPL 4XVTL 4K7FA 3A79B 3UC0L 4BSWB 3SO5A 1OAYH 3RPKA 3QS2A 4B3VA 1H5BB 1QKZL 5DJDA 5C2BH 5HPMB 4G42A 5DHEA 3BH8B 3I3DA 4LSQH 2GEEA 2XYCA 3T0BA 1ZLDA 1AI1H 1SVZA 3K81A 3GRWH 2WANA 3GSWA 3Q06A 3BUQA 3X12A 4OLUL 4PJFE 4HA1A 4BHUI 1E27A 3ZE2E 2J8OA 4ZNEA 1XSJA 2OMXB 3A21A 3KJ4A 4JFEB 1CI5A 2CO1A 3RPBA 1M7DA 3B3BA 3EO9H 2RQEA 4P59H 2VDNB 4JO2L 2FECI 1QSZA 1WSST 4TTDC 3H9SD 3LZFL 1MWAH 3D05A 4PJAB 5JA8B 3Q8AA 4JO5A 1NMCB 4AKOA 1MI5D 4IRSB 4JRYE 5HHQB 4QHKJ 4Y2DB 3L9BA 1BWWA 2F9BT 5F7FA 2QSVA 1R46A 3FTSA 2VC2L 5A2JH 3O11B 4B60A 3GPSA 4PRIB 3MROB 3U30B