1XEUA

Crystal structure of internalin c from listeria monocytogenes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
263
Chain Sequence
ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of internalin C from Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion
molecule keywords internalin C
total genus 79
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xeuA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xeuA01
3TSRE 4M7EA 4RCWA 5GQRK 5B0NA 4LSXC 3WPDA 2C9PA 3RJ0A 4U06A 4R5DA 2O6SA 2XOTA 2UZXA 3VQ2A 2P1PB 4C2BB 4Z64C 5GMHA 3WPIA 2V9TB 3W3KA 4ARRA 4HQ1A 4PSJA 4ECNA 3UL9A 3RW7A 4ARNA 4NKHA 4C2AB 4Q3IA 4V2DA 3SB4A 3C6OB 1KOHA 4XOSA 3ULAA 3ZYOA 4R6JA 3M18A 4Y61B 3WPFA 4P8SA 2RA1A 2IFGA 5IYXC 1GWBA 1OTOA 1M9SA 1QYYA 3WPHA 1ZIWA 4G8AA 5CMPA 3DZEA 3UN9A 4M7EC 4Q3GA 3UL8A 4PKIG 3CIYA 4LXRA 3BCFA 2WQUA 4KT1A 4U7LA 2Y5QA 4Q62A 5GS2B 2WFHA 2V70A 3REZA 4RCAB 3RFSA 5IJBA 3VQ1A 3C6NB 3A79B 2P1QB 1P8TA 1XEUA 2Z7XA 4L3AA 4R5CA 4H09A 4KNGA 2YA1A 2JQDA 4J4LA 2O6RA 4Z61C 3JB9j 2RR6A 4ECOA 1G9UA 2Z64A 5AWCA 3BCDA 4MQWX 2WQXA 4CC4C 1M42A 1K5DC 3E4GA 4Z94G 1SQ0B 1JL5A 1XKUA 1FO1A 1OZNA 3G3AA 3GOZA 4LSCA 5CMNA 2OMUA 1O6VA 4L3FA 5GMFA 2C9QA 4FDWA 4IM6A 4LI2A 1P9AG 3ZYNA 3BZ5A 4R58A 5HDHA 2OMXA 1FS2A 5GMGA 3G04C 2WQWA 2JE1A 3O53A 4GT6A 1K5GC 4YEBB 5FTTB 3RFEA 1DS9A 1W8AA 3W3NA 2OMVA 1M0ZA 4V2EA 4UFRA 3W3MA 2OMTA 1PGVA 2ASSB 3W3GA 4GLPA 3W3LA 4V2CA 1U0ND 3ZYJA 1O6TA 4P91A 4FCGA 4QXEA 2Z82A 4BSUA 2R9UA 4TZHA 4CP6A 1O6SA 1OOKG 5A5CA 3RFJA 5AWDA 2OMYA 3RW6A 2A0ZA 1H6UA 2XWTC 3G3BA 1OTMA 3PMHG 4R6FA 4CC4A 4R08A 5IJDA 3WPCA 4AW4A 2ASTB 4AY9X 1YRGA 2CA6A 3OJAA 4R07A 4BSSA 3WPBA 4B8CD 1OT4A 2Z66A 1KOOA 3FXIA 2ELLA 3OGMB 2Q4GW 1XECA 3OJAB 1FQVA 1OTNA 2P1NB 3E2JA 4FS7A 1NM4A 3E6JA 4CNCA 3WPGA 2Z63A 2Z81A 4KXFB 1DCEA 4U09A 4Z8GA 1DFJI 3RIZA 2UZYA 4Z79A 4PQ8A 4QC0A 3WPEA 4R09A 4BSRA 3CVRA 5B0TA 4MN8B 4FMZA 3OGLB 4LI1A 1A9NA 3OGKB 4AQ1A 4R6GA 3E3ZA 4FD0A 3KJ4A 3ZYIA 4CNMA 4XGOA 4CILA 3BC9A 1XCDA 5HZLB 2OMZA 2Z65A 3FAWA 2Z7XB 3ULUA 2OMWA 2Z62A 1LTXA 5GS0A 3O6NA 4LSXA 1M10B 4PERA 2BEXA 1A4YA 1IX2A 2O6QA 4LSAA 5AWBA 5AZ5A 3FAXA 1FT8A 4XSQA 5LFNA 4RWTC 4I6JB 4R0AA 3W3JA 4K17A 2P1OB 4J0MA 3G39A 4WP6A 1IO0A 4U08A 3ULVA 4PEQB 1P8VA 5ICUA 2WQVA 4LXSA 3M19A 1WWLA 2V9SA 1D0BA 3UL7A 4QBZA 4FHOA 5IJCA 4EZGA 2ID5A 2BNHA 3C6PB 2JE0A 2P1MB 2RA8A 4WYKA 3P72A 5D3IA 2FT3A 4BV4R 3RGXA 5B4PA 5AWAA 1M9LA 3WN4A 1Z7XW 3RGZA 1XWDC 1LYQA 1H6TA 3CIGA 2C9RA 4NKGA 3G06A 4R6AA 1OGQA 4OQTA
chains in the Genus database with same CATH superfamily
3AM8C 3FT2B 1U95A 3RJ0A 1FL6B 4ZD3H 3FB6A 4W6XB 1MZYA 2BSEA 2OK0H 4B96A 4UOQA 4IBUA 2H32H 3RYMA 2DTSA 1DJYA 3P0GB 5EU4B 4G8IB 3OJVC 5IBTL 1OSZA 2PCYA 3LH2H 1R75A 4ENED 3ULUC 1XR9B 2I7OA 3SKOA 4JHZA 2B4CH 4HC1L 2K70A 2P5WA 3SE6A 3QUMA 3FTSA 1R46A 2N7SA 5E2TL 5I18L 1DVFC 5MEQA 4K3JH 4ISVA 4LDLB 5D96B 3QJVB 3VE0A 3FPXA 4ZS6D 5JOPE 3REZA 4RCAB 4QNPE 1SVZA 3GZQA 2WYZA 4C8XA 3STZA 1A4KA 3U9WA 1SJVA 1URIA 5BV7B 1A7PH 4K3EL 3B2UD 4PJIB 1OAYL 5GJSH 3FT4B 3FT4A 1U8PB 1FO1A 3G6JE 4O5LH 1QNZL 4JPSA 2CKBA 3NJNA 1O6VA 4FQJH 3BGMB 1XF1A 3RVVC 4H8HA 5JW4M 1LP9F 1HI6A 2ICWJ 2GJRA 1A9EB 1YEJH 1HL9A 4M6MH 4XNUL 3VYNA 3ZVVA 5AYTA 4R58A 4YHPA 1JXFA 2EZ0D 2BHFA 3VGHA 3WO4B 2HFEB 4YR6B 4MMXA 4IHOA 3ILPB 3V52H 5GZOD 1I9RL 5F7MC 2IPUK 4V33A 4Z7QF 4Z5RB 5CIPA 2N4IA 4APQA 2R9UA 3TJEL 1S7UA 3O3EA 1MW1A 4ZMQA 1J88A 4DQOH 5DRXB 3OKYA 1GC1H 3OZ9L 4QMEA 4PJHF 3O4OC 4TNFA 2VYRE 1I53A 1MJUL 1QOKA 3L7EA 3Q5TA 4KVPA 3FFDA 1JE6A 2H45A 3CSGA 4MJ6A 4FXLA 4FZEL 2Q4GW 2NCMA 1BZ8A 4A2FA 3SGKC 2EO1A 2VAAB 1Y6MR 3S4SG 1J8SA 4HF5L 4WHDA 2CDFB 1RU9H 3MLWL 3RIFK 3TBSB 5E6UB 4ZOBA 2DLIA 3LEXA 3N44F 3UAJC 5E7BA 4IRJC 1OTTD 1IKOP 2CMRL 4FD0A 4YDKH 2YXVA 4OCXL 3IJHB 3EHBB 4WI4A 1D9KD 3HVNA 4IM8A 1R5VA 4WI6A 4D2NA 3S34L 3FBKA 5GS0A 3LVEA 4L2LA 2HVJB 3UTSE 2PWFA 1RZ8B 3TO4C 2K8MA 3MLZH 4YIQA 3K5SA 3AS2A 4HIHA 4R4FL 3G39A 4JL2A 2V2WA 3BP7B 2KZKA 4MBRA 5GGSY 1AZRA 2VW4A 3P3TA 1TZOA 1U8NB 2FWOB 3DYMA 15C8L 3MJGX 4BM7A 4XB7A 1AH1A 1KY7A 2IPUG 3LSOA 3QORD 3WN4A 4FI8A 1Q72L 5TQ2L 1KCUH 4ZUTA 1X5JA 3OLDA 3L4TA 2DYSB 2QLYA 4IMLB 1RURL 3DX6A 3SE3A 2EYRB 1TLKA 3TNNA 3GSXB 1OPGL 1BXVA 4RDQG 1UKSA 5DS1A 4CMMB 3QIUA 3KPRA 3KPRB 5AOZA 1JK9A 2G2RB 1WBZB 2XVLA 3BDYH 1OLLA 4I9WD 3QUZC 5ENWA 3L3JA 2YAEA 3K2KA 3BH8A 3BSZA 1Z9NA 4H25B 1W6LA 1V7NL 4Q9RL 2W5PA 1B9ZA 5ESAB 2L0DA 1SEQL 4NT6A 3UN9A 1BBDL 1JWMB 2DWTA 4PJ5A 4IGBC 4Z76A 3HW7A 4PJ9A 1F02I 2G9HA 4X7FC 5D7LD 3J2PA 4NUJA 5BW7A 1GH7A 3L3DA 2AEQL 1XGYH 2PYEA 4ODVH 1HWWA 3WFHA 3HHSA 4E2OA 5GS0L 4KU1A 1S8DA 1X5XA 4GRLC 3REVB 2NX5B 5ANHA 4LEBA 2C34A 4P5TB 4QRUA 5T3ZL 3B3IA 3CVHB 2BNUB 3KYOB 2XUWA 4IJTA 1Q8MA 3O81A 2EDTA 4LHUB 5KJRH 2JJTA 1CYXA 1NMBH 1NM9A 3BP6B 4FP8L 1Z1WA 4MAUH 2PWEA 5CKGA 2VDLB 1G9MH 1UXLA 1YEJL 4GIAA 4A7VA 2ROYA 1P2CB 4R3SB 2Q86A 1KB3A 1FVEA 1U6AH 1QQDB 1M7IB 1G7LB 1PEWA 2VZ1A 3KL5A 4I0PA 4P2RD 5ALCL 1YNTB 3SE9L 3T0EE 4NP4L 4EI0A 4LLQB 3HEIB 2YPLB 1DFBH 1GL4B 2IWEA 4QO1B 4KTDH 4AY9X 3P3SA 2IBZX 5DRZB 1NBCA 3NYKA 4G7VH 4P5MB 4Y89A 5EWIH 1EK3A 4YDIL 3NIFB 2R0LH 1EDQA 3HZMB 2KZ1B 2RACA 4G6FB 1VFBA 5IW3A 1GYAA 5ADOL 1KTDB 3HRZB 3EDDA 4YX2L 4QC0A 4R09A 5D7KE 1UT1A 4FTVB 4MN8B 2YN3A 3CPLB 3QQ3B 1IC7L 2J57A 1E8XA 1R24B 3OAWA 4GFXA 1QASA 4WEMB 2ZUVA 4P5RA 3BQUA 2XVBA 2X4RA 5FKAA 3VXRD 2ZZUT 3SQBA 1YPZA 5IEKA 3JWNH 5DJ8A 5A2IH 2PTTA 1DSYA 2EILB 4JS7A 3BESR 2UWEE 4LB8A 2HT4C 5DCCA 4EMZA 2BWDA 5JW3L 3MOBL 4AGMA 4RIRA 2AV1A 1E3XA 3MCLH 3QUML 1Z7XW 3VSTA 5HDBE 5IMLB 2Z8WC 5ABZA 1ZHNA 5LDSA 3Q13A 2HYMA 3FONB 4JDTH 3BDBA 4OCWH 3IDUA 4EUPA 2B4CC 3GOZA 1LMKA 1HEZA 5DJAB 5C0ND 3DETC 1HHIA 3WNMA 2WBWB 2YRBA 4ODUA 1YA5A 5C0RL 3A4AA 3T0ED 2X10A 1MCHA 4XX1G 1XGYL 2K78A 2VC2L 4DW2H 1M6UA 4A2DA 3DX1A 2BFVH 4GXUN 5GS0D 4JO2L 3CFIC 1DVXA 2F19H 3ERXA 3CN3A 1TSHA 2OXHB 3CSYA 4HS8H 1U8MA 2Y25A 3CFCL 4AGQA 3CCHB 1DBKL 3ZTCC 4J4LA 5AVQB 4HLEA 4H8WC 4I1RA 4IRZL 4GLRH 3U2JA 3RILA 1Z3RA 2ZWYA 1FO0B 3UZEC 5J11B 5BO0D 2YSTA 5IQOA 4XMLH 5J13C 4EE2A 4HIPA 4J1UA 2CXGA 4N20A 4W1TA 3WENA 5KSBF 4WY7L 4AITA 5D70H 2IBZY 4G8GB 5FOBA 2FZ3A 4DP6X 3WY1A 5DMGC 3EOAB 5ESVA 5GZOA 1RLBA 5FGRA 1TZGL 4X9BA 5GGRA 3VFGH 2CDEB 3IFLL 3KR3H 4NIKB 2OZ4H 3UZQA 4MAUL 1WZ1H 2CGYA 1DBMH 1NOLA 3GPEA 5T1KD 2NZ1A 1WBXB 1UT2A 1X5AA 1XV8A 2DIBA 4XCYB 1A02N 1JDAA 2WC7A 4TKWA 5JDSB 2NYZA 5CZRA 2NY6C 2WWOA 1F2QA 3WNKA 3QC5X 5I1LA 2RFXB 1TTGA 3S3PA 4IIZA 4YHYB 4UIMB 1IEHA 5IWLA 2B2XL 3QCVL 2DMKA 4XGZA 1RIUH 5EDSA 4BFBD 25C8H 3OGLB 1TSRA 1KN2L 1WA2X 4U1IB 3MCLL 3ESUF 4LSUH 2MOGA 5DK0A 3Q6FB 2XXMB 5DJXA 5F0PB 1UJ3B 2DLFH 3KPMB 4H5SB 1DQQA 4TLSA 2YKLL 2YD0A 3KLSA 4PQXA 1J9QA 1QFUL 4I0PD 2XWXA 3BPCB 1S9YB 4GKZB 4HUVB 3MRCB 5GGVH 1P53A 3PPEA 5T1KB 1OP5K 3N41F 1FSKC 3H9SA 4FYRA 5IJCC 1H3VA 2OSXA 1Q0YH 1CWVA 2C9SA 3WKQA 1UACL 4XPHH 5J89A 4UAOC 3C6PB 1VKXA 3RGZA 1GOHA 3RY4A 5E4OA 3CIGA 4JQXC 3FZUD 4OUUB 1KPUB 3TBTA 4FYSA 3EO1B 4C4KO 1SXZA 1KFAL 1F1GA 2BSRB 1JK8A 4KNQA 1YDPA 4YHPB 1FV1B 3KS0J 5BVJA 5J57B 3LXBA 3RY6C 5AD0B 5AD0A 2IDFA 2DI7A 4E9WA 4CC0A 4MAYA 5I1JH 1ADQL 1JZJA 1KCSL 1H3PH 1VENA 3OLIA 5B3SB 2B8OT 5IJVB 12E8H 5KVEE 4OCYH 4NRZA 3OHXB 4KXBA 4NLAA 4G9FD 3ZDZE 1NGYA 1RUMH 2CO7A 3LZLA 3UBXB 2C3GA 3GUFA 3JWDC 4HLZH 3INUH 1EZSA 4PJDE 4TXVB 3UX9B 4EJ1C 6PAZA 4PJFB 3VFNA 2CJSA 1IEAB 1YEIL 2XTJE 2YUXA 4NIYE 3LQAH 1MCRA 2PXYB 3MUY1 4CUCA 5E70A 2UWEF 5D1ZI 4PJDF 5FYLD 2FBJH 4YZWA 1PZCA 2X0UA 3CDGB 4NUMA 4LSVL 4YBHA 1QSEE 3LEXB 3TYGL 1UXSA 4L4JA 4A7QA 1NAKH 4GAJL 4Z3IA 5CCHE 4HZLA 3QB7C 4G9FE 1KCVH 1SGKA 2H2PD 3NVQA 4QJ4B 2B7DT 3X13A 3G04C 1BQHA 1BQHB 3RU8L 1T0OA 3L5WB 2DH2A 4HKBA 4JZOA 1MWAA 2MPVA 2F7IA 4H1LH 5B39A 1S7RA 5GQBA 3SQOH 5JLZA 1JWMA 2HG0A 1YNLH 1EGJA 5FM5M 3FJTA 3O8XA 3C87A 1YY9D 1A6UH 4PLNC 2Z31D 3DROA 1Z9PA 4MHHG 2Q86B 4GMSH 4LASH 4XP1L 4CP6A 4XNMA 5I1DB 1UA3A 2G9KA 3MV8B 5K39A 5J3HD 1ONQB 4JR9L 4LU5H 4R08A 2AAAA 2OCCB 4QGYA 4GW4A 1KIQA 2DB8A 3F04A 2VDML 4V1DE 2D4FA 3P11L 4U3XA 3FCGA 4BWTA 5E95B 4PJ5E 3WSQL 3W56A 5E8PA 2A4CA 4M4PA 1T21B 1IM3D 1S5HA 2AQ3A 3T3MF 5EUOF 3U1QA 2OMZA 1DVFD 3S37H 1RJYA 1DSWA 1INQA 3AS0A 3LB6D 4KI5C 2AK1H 1IGCH 4HX1A 25C8L 1I8KB 5AWBA 2PTTB 5ABAA 1UB6B 2H1PH 3QUMB 2ICWI 4X99B 3SPGA 1OP4A 4E42A 5FXCH 5BVPL 2FEJA 2I85A 2I27N 2XBZA 4OD3L 3A3YB 4L3EB 5FK9B 2DPKA 3HS0C 4BQ9A 4LBEA 2Z7ZA 1B4JL 3D3VE 4XVTH 1GGYA 4KMTH 1TTBA 4X5RA 3HMXA 4XXWC 5GGVL 4F37K 5EFIA 3F5WA 5EF2A 4PLKD 3BKMH 3WGUB 1IKFH 4LLWA 3ARWA 1T7XA 4OCYL 3RNQA 2VZSA 4OZ4A 3VQ2A 3LIUA 3RGVC 5ECJE 1HHIB 1KN4L 3FO0L 3TVMB 4JEGB 3O45B 4FYTA 3ZRFC 2DIJA 3QQDA 3UTSA 1WYJA 2XG5B 2HN7A 2L7EA 1RZGB 2VDPH 4R5VA 3HN3A 4MJ4A 2Z65C 3L4ZA 5IB5A 4R3SA 1BQKA 3BWAB 4KY1H 3QJXA 5D7JC 1AO7B 3VXUD 1GJWA 5CSBA 4RIRB 3FSAA 5IVNA 1B6DA 1RZ8A 5BRPA 2AJZB 4YO0B 1QSEB 4OCSL 2NNCA 3A22A 3AT8A 4YL9A 5GJTH 1XGRB 1FO0L 1QHOA 2E8YA 2H2PC 1D5ZB 1DUZA 3NSYA 4XN2A 2FECL 4NM4L 4ZNEA 5K1VA 1CI5A 5D4HA 4WHTA 3V0WL 2IV8A 5T8IA 4FQQB 4QHMA 4UT7H 2DQGL 4JY4A 4AGLA 3KYMB 1I7TA 5C3LD 3HAEG 1ZPLA 4M8QB 5FCUL 1I1AA 1R9FA 3QHZH 3MRFB 1OHZA 4QF1A 1NC2B 4H1LG 4WGKA 3BAXA 2NTFB 1UEMA 2AQRA 5EULV 2IQ9H 1A5FL 3MOAH 4PJ8A 2VXQL 3HI1A 2XZQL 4IQHA 1KYOJ 1TETH 1PLBA 4G6AD 5CJOH 3GMRB 5E0QA 1XWVA 2R4SH 3E1F1 4WUKL 4TSAH 3LIZL 4TOYH 3T0DA 2R69A 3FUMA 2NMSA 1JVKA 2P46B 5DD0L 1QLEB 1FYHB 1U8MB 4ICXA 3OBAA 4LP4A 5E6ID 1IGCL 1BHGA 5T1JA 4JFFB 2XPGB 3FB6B 5CJQL 1YG9A 4OF8A 1EZVX 5KS9A 3DX6B 4IU2B 1THCA 4XN1A 3TXAA 3KJ4C 2E27H 4MA1C 3IE9A 1T2QL 3AQYA 5GIRA 3MLXH 3FO2B 3E6HB 1KWKA 1RHHA 5L4MA 1T4KB 4BCYA 1RULL 2ZUQC 1NUDA 1A6VL 4OV5A 1VRSA 1KTJA 3WEMA 4GQ9L 4HBCH 1KGWA 4NX0A 4XZ4A 1S7SB 3ZRCC 1EAQA 3WLWD 5MEQB 2W59A 2DYPB 2WYTA 3RFZC 4EIBA 1CDUA 4OLWH 1V8HA 5LGHH 1ZTXH 1UWFA 3NCCB 4Z7VE 1BOGA 1JF6A 2V9SA 3NOIA 4JRXB 4RNRB 3GJFB 4UOW0 3G5ZA 5EOTB 5BS0D 4LKXB 3VXSE 5DMKA 4NZFA 5JQ6H 5JO5A 3LAFA 5CP3A 3LRHA 5AKVA 3T8XB 2FBRA 1XH1A 2MMXA 4ZZFA 2BPBA 1NL0L 3UTTE 2D3LA 3L1OH 4N2HA 1OCWH 5E99H 4XI5D 1CDGA 4ZT1A 4AZUA 4CVWA 4YWGH 1NCBL 1Q4NX 4YHIB 5CN2A 1ACYH 2HSIA 4BIKA 1QRNA 3IPEA 5L2KD 1AXSA 2XZAH 3S48A 2NY2C 5C9JA 4KVNH 1FP5A 2DQTH 3NH7H 5IHWA 2QHRH 2AS5M 1SJMA 1HINH 4TMPA 5J56B 2AERT 1AZVA 2R29A 3MODL 4XTRC 3EGDB 1KLUA 1XGPA 2FSDA 4OBSA 3AADB 3IMWA 4KMQA 1SLUA 1TT6A 4DKFL 4YMPA 4F9PC 3N3EA 4YFLF 1YYLL 1CQKA 3ZL4H 1SUHA 2E7CA 3EOBA 5HYIA 5E1QA 4MNHB 2ROXA 4OZFG 5F70A 4TSAL 3TYFB 1DQJA 1EAPA 2DEXX 3QUKB 3PL6D 4DFIA 4K5OA 5IHUL 3CIQA 4RFOH 3ZDZF 3D18B 4UINH 3VTMA 5K5YA 3EUUA 4P8QA 4HCRH 2JVUA 5F1KC 3OHXC 2H47C 2PW1B 1CFNB 3BPCA 3MSPA 2KHAA 4NP9A 2JB5L 1EHXA 4JZNA 1F58L 1MFCL 2IEPA 4AYDC 5FYJH 1GS7A 5AVYB 2WIMA 1VACA 2VDKB 3GSRA 3HZYA 5DURB 1N8OE 3CMOH 3KXFA 3PMHG 2Z1PA 3QPXH 4R2GC 1T7YA 4HJSA 1EVUA 3SPVB 4N87A 4X6BA 4JFYA 3ESVF 1BEYL 4LVNC 5I74B 3LY6A 5FV1L 3GLEA 1VB9A 3JTSB 5BJTB 5LGJB 4U09A 2BSDA 3PG2A 1JHTA 1S9VB 1HDMA 5DMJB 3KVDD 4FXGC 4UZSA 3OG6B 2WAQA 4FKHA 5CGYD 3L3JB 3HRZC 3HI1B 5EU5B 3E3ZA 3DVGA 3DVGB 4G9DA 4NB7A 1DBBL 4RGMB 4UTAL 4ADJA 4M7LL 5E6IA 4Z7AA 1IVLA 4M48H 2O61B 3FKUS 5F0LB 4D0DB 2ZOKA 1IX2A 2VN6A 3Q5YA 1IC5H 4PREA 1J1XH 2W8CA 2HG5A 4WVRA 4CMHC 4X4KA 1H3PL 1LE5B 4XI5C 3DK0A 1YECH 2Z0BA 4OIAA 2YPKB 4EAEA 5ABDE 3RWIB 3W11D 4I2XB 1QABA 1ETJA 2WUBH 4HFWA 3FF7A 3SCMD 2HX8A 2F2HA 1XIWB 4U3HA 3ETBF 4MD5B 4NZTL 4ZO8A 1AZZC 4GUQA 4OB5L 1F0LA 1ITCA 4QUOA 3SD2A 3BP4B 3DIFB 1JZ8A 4YQXH 5HYSA 5IMMA 2C9XA 1BMZA 4NQCB 4JRFA 5F88A 1H3TA 3H9SD 1M2OA 1T5XA 2DMBA 5C0GB 5JMRA 3BAWA 1AZCA 1JERA 1R3LA 1PS3A 2AMUA 3BSZL 4XE5B 3IGAB 1P5UB 3D2UD 5D7IE 5EA0L 5EZOH 4HOZA 4S0SD 4LCCB 4XPBL 3VXUA 5FM4A 1MY7A 1U3HA 2AZUA 1T1WA 4R0LB 2WFHA 1E5ZA 3OF6A 4FQHA 2ZUTA 1E3FA 4G5AA 2K6ZA 1SXSA 1FGNL 1MFCH 1FDLH 1XAKA 2VLLA 3P4NA 4MJ5B 4P59L 4ZFOB 3EFFB 4BWWA 5FECB 4AE0A 3HNSH 2CGRH 3GXTA 1KEGL 3NFPA 3NFPB 1CURA 3D85B 4AH2A 1F4AA 4NERA 4YEEA 4GRWB 1TJIH 4XNXL 1R19A 2XG5A 2X41A 4FNUA 4JJ5B 4QTHA 4W9DC 1DJXA 1HVXA 1NPJA 1MFNA 1J10A 3D30A 5MP6L 5I6OA 3F2LA 5MEPA 4YGAB 2DBJA 5L7XL 2ENSA 3HFML 4G5ZL 4F33A 1P5VB 4P2YA 2WSDA 2W81C 3Q2NA 1BYNA 1GMEA 2BH0A 3KPOB 2NR6D 4GAGL 5KSUA 1BQLH 1EXUA 1P7BA 2X3AA 4UWQB 3VWJC 1MJ8H 3BEWA 5GRUH 4CSTA 5AALA 4DVBB 4WK2B 4LNRA 5JXAH 1CL7H 4YHML 3H7BB 2R9HC 2R2HA 3BN9D 4ONFL 4ABVA 2Z1KA 2GY7B 1ET7A 1RFDL 2ENYA 4IMKA 4P9ML 4F5CE 4JO3L 2YOAA 5LBVA 4QRBA 3QDJE 4CNIB 5C8JA 2RBLA 1P84K 3BAYA 3C2SA 5FFOA 2R29H 4H20H 5E9NA 3BYTA 4BUQA 1MCWW 2IO5A 3EJZC 4P99A 1H3XA 3E6HA 1AKJB 1T7ZA 4LNVA 5FO2A 3VGBA 3WS3A 2OV0A 3HBQA 2IALA 5C0CD 2HTLC 3I9GL 1NANI 1N9PA 4U4BA 1AO7D 3L5WA 3CFDB 1AE6H 5K1NA 4X4XA 1OAQH 3FT1A 1YEFH 2DMGA 3UP6A 2QKIC 2A0LD 4Y0GA 3UGUA 4AL8H 1YSOA 3FTVA 1FYTE 3KLQA 4JPQA 1Z5YD 2Z31B 3P3RA 4JDEA 2WB1A 2QGBA 1R3HA 5F96H 2ID5A 1CICA 3SZ6A 2ESVD 1XGUA 3RKPA 2ADFH 1J87A 3LIZA 1CE6B 4Q89A 3SGDI 2A9NL 3O9WD 4X5QA 1URZA 3R06A 4AVJA 2XRAL 4WEUD 1ZIWA 4LCIH 2Y36H 2GT9B 5AKRA 3KHQA 1JGEA 3II3A 4LQFL 2HMID 3PV6B 3VQ1A 1WFMA 2XV2A 4HGKC 4XO3A 3SDYH 4NZTH 2AQTA 1MRDL 4ARNA 2XWBB 4DH2A 1U8KA 3SB4A 5HYJE 3MOBH 3CMOL 1LEKB 4TL5A 1QRND 3P11H 5DEFA 1UQSA 4J3VA 4NQTA 3QFDB 3SHSA 3A4DA 4EF3A 1C9SA 3S3JA 2XZCH 1T2XA 3B1UA 4P3WA 2B3IA 2IH3B 4DKDC 3OR6B 1CGSL 2XV0A 4JG0H 3EO0A 4E41D 1B2WH 3NFNA 3U0WL 1QSZA 3ZHFA 1MAJA 1S4IA 4NNXA 4ZMLA 4HJTA 3C6NB 4WW2C 2QQKL 1ZV2A 4QRSB 2YA1A 43CAB 2Q7YA 1IGIH 1OSEA 4U1MB 1NUGA 4X9GA 2YZ8A 4PH8A 4GRWF 3H56A 4DZBA 4L3FA 4J12A 1U3HD 4FQIL 4P2OA 4LI2A 2RB8A 2G5UA 2DJSA 4MDIA 4UM9D 3TVMA 3Q1SL 3DARA 3CZEA 4ZO9A 2H3KA 4OGYH 5AW8B 5SWQB 3NRQA 3ZHNA 3VVVA 3KG5A 4YBLC 4Y4KB 5IB5B 1P6WA 1DQTA 3QJRB 3HC3L 5DWPA 1MY5A 4BKTC 2FD6H 2E76C 4N90D 5ACZA 4EIUA 3RTQB 4X7TB 1BOYA 3IJ8A 2BIOA 4F57H 3NBNA 5AWCA 5A2BA 2UXGA 2CR3A 4XMWA 5DJYB 1KJ3H 1L6PA 3JTSA 5E0FA 3F7RA 1IB5A 3OAYK 5BJTA 2Z81A 3CDCA 1KV7A 2QT6A 5E6RB 3VFRA 1GAFH 5DTFB 1CZ8H 2P28B 3UYPB 4BFFA 4HG4J 1BREA 4NAMA 4KTEH 1KIUA 5C6WH 3BT2H 4P3DA 4WUUB 4LLDA 4EN3A 5KSAC 5DD3H 4WK0B 1V10A 5LQBL 5DF0A 1JCKA 2Z7XB 5D1XB 4R5XA 4APQB 1DQDL 3L2NA 2NX5E 2HLFC 2RQ8A 3NCFB 4PR5B 2ODIA 4RBPH 1FT8A 1QSFB 3QR2A 5AL8A 1EEZA 1QBLH 2G5BB 2HMIC 3S34H 1T2JA 2BNRB 3OKLA 3V7AE 3EF7A 3GSWB 3S3SA 4F8PA 2D7NA 5IROD 5KSAB 3D12B 1KXQA 2OTPA 2YD6A 3EOBB 4GG8B 4F37F 5BUGA 5C0EB 1G7MB 5IP4A 1KOAA 5F1NB 4NOFA 5HHVL 3OKMB 5C92A 1XB3A 5DFVD 4FZ8L 4TULH 1CB4A 1USZA 4XVOA 5C70A 3H53A 4KBPA 1Q9KA 1KYDA 5KEZA 3PGDA 1MI5D 2D0GA 1I3RB 5J12C 4X4MA 4UINL 2OTUB 4TVPL 4DOHB 3APCA 4KHTH 3G6AA 2UUDK 1BFOA 1CGXA 5JA8B 3RUGA 4I2XA 5KSBB 2IANE 5I8OH 5D55A 2YR3A 1OE1A 3PDOA 2J72A 3QQ9D 3NCYP 4BUHA 1G5AA 2EEXA 3GSXA 1OCZB 2AJXL 4MVBC 1OD7A 3GMMB 3ES6B 1H8OA 2EXWC 2WQSA 3H85A 4S10A 3K4AA 3TH2T 2EDEA 2QADB 4PJAE 4NBYB 3LHPH 5IQ7L 2CU9A 3PY9A 2COVD 3VGFA 2BIHA 4RFNB 1TR7A 2ITCB 5MEOB 3NQIA 3KGRA 4OF0A 3FQUB 5K9JH 4F7KA 1AQDB 1ZY9A 1MH5B 2EH8L 3FU7B 3L3IA 1GGCL 3ARBA 3JWDL 4FQCH 4FS7A 3UCQA 4AV0A 2QFPA 4UM9B 3FQWA 3WIFB 4L4TE 4CBPA 4ZTPH 5LVEA 2FX8L 1YJDL 5D1QC 1A6TA 2A6DA 3C5XA 4R83A 2BNRE 5DRNB 5D2NA 4JG5A 5JHAA 2NZ9D 1WFOA 3NA9H 2WW8A 2EH7L 1DDTA 1BIIB 1SQMA 4OGZA 1NGXA 2NY7L 5FW6A 4AW4A 5KSVA 2WXJA 1NEUA 3IJEA 2VDQB 2V7HB 2XWTA 4XCYA 3IVKA 1KLGB 2WD0A 3CZJA 4PD4J 5T3XE 1CN4A 5B4MC 2IOOA 1T0PB 1S7XA 5J1AA 1ZTMA 4FOMA 3ZDXB 1BFVH 4HKZB 2WSPA 3PREA 4M8RA 4DKFH 4PYHA 2NY5H 3WTYA 2VDNH 5FKAB 4IJ3B 5HDQL 2VLRE 3P9WB 2ADJB 3ARBC 4DKEL 4NHCL 4BQ8A 5F7FA 3EXJA 4LI1A 2VQUA 3TNMB 1QRNB 5EEYA 1CXLA 3ZT6A 3WCYA 2C5DC 4Z5RA 5FK9A 3MCYA 1CFSA 3HI6L 4TQHA 3RWFA 2P5WD 2JIXB 3ARFA 3NABL 4HLZG 4U3SA 4ZMXA 1S2EA 2QVFB 3ZUNC 2BVOA 3GLDA 3MLTB 4HC1H 1D6VH 4KROB 1H15B 4X8JB 5I0ZA 2VITB 1Z9SB 4XCEB 4N6RA 1I9IL 1IIKA 1E9PB 1KIPA 4ZDHA 4MXWH 3ZK0A 5DSCB 3L5JA 2XIIA 1UWXH 3LPFA 4I18C 4ZPTB 3DYOA 5AQ0A 1VPOH 3CX2A 5EV7A 1DE4B 1H6TA 1SFDA 4M93B 3WPDA 3D4CA 3K4ZA 1V3LA 3OX8A 4RFEA 3F3HA 3IDIB 3RUGF 2Y1ZA 4X8CA 1AD0A 4RGMC 2QZQA 3OHMB 3DGGA 4L37A 1BJ1H 2JH2A 5DK3A 2F54E 4HT1H 2YFOA 1S5IL 1G7JA 4HMCA 3IXTB 4N2DA 1CT8A 2NY6B 1M71B 4XHJC 4E41A 3M45A 5JW5A 3KYNA 2NY2B 4WCYL 1XQ4A 3II2A 2FEDC 1FAKT 5DHVB 2EC9U 3HE6C 1Y0LB 3VYOA 3B6SA 2UY6B 5F7EH 3ZE2B 5DA4A 1KN4H 2A74A 4ZUTB 5LDUA 1A4JA 3S36H 1GS8A 5KYUB 1ZWIA 5DD3L 4XE0A 2G60H 1UH4A 3V4VB 1ZT4A 2XKNB 2JKSA 2GBVA 1GZHC 3WY4A 3G3AA 3ULVD 2SEBB 4TQEL 1WWBX 1FG9C 3FUIA 4B50A 2YPLD 3L95A 1HE8A 4JFUA 1J1PH 3KXFD 2OSLB 1QBLL 3RFEA 3GSUB 3HKFA 2UZIH 3VFVB 4B7LA 1ORSB 3DPDA 3RWCB 4BK4A 4M4RB 1ZLUH 4MJ2A 3R7RA 1AIFA 1LO0L 2OK0L 1DLHA 3MRPB 3KLHD 1A8JH 1AE6L 1DQIA 4QXEA 1MCDA 5T1MB 3MZGB 1UZ6E 5AVWB 2WZ5A 5D70L 1LP9B 1AZNA 3T6WA 5EZOL 4HIIA 4JKKA 1N4XH 2LW3A 4O02A 4LO9A 2NUPB 3P40A 1ZDSA 1ZHKB 5CFAA 1EHAA 4DW2L 4CVZA 3MOAL 3BP5A 5F3HB 2WBJB 4JPVL 4B0MM 2XRAH 4KXCA 1PJ9A 2DEYX 4FFZA 1KCWA 3WS6C 2YXWA 2E47A 5E51A 4QYOB 4M7ZB 1U21A 4O9HL 3H9SB 3C60B 3O3BB 4OCLC 1JGIA 3WY3A 1X7SA 1QNZH 3IDJA 5FF6B 4NQCD 3S9DB 4DKEH 3VRLE 3EYOB 3FO1A 3B7UX 5I8EA 2FX9H 1AR1D 1UB6A 2ZYRA 4NQED 1I7RB 4QXGL 2YD9A 2ENQA 2ZXWB 3CJJA 1FLTX 5MP6H 3E38A 1SJEB 4OKVB 5TDPA 3LZNA 1ZLSL 5L2JB 1BBJA 3U36B 4OZHB 1XH3A 3O2WH 4FQ2L 2X05A 3HFMH 4UTBA 4M93C 2Q8BL 4BHUA 2WVVA 3ARGC 2YGPA 3JV0A 3B83A 4P0DA 3UYPA 4NKGA 4X7CC 1EFQA 4GQ9H 3FYIB 5DZAA 1J1OL 4DP4X 4POYA 1OB1B 3SGJA 3RX7A 5IB3A 1ZS8B 5FV2A 1CFSB 2YK1L 4QTIL 3PRZA 4IGBB 1HHKB 2XY2A 5HDLA 3WKMH 3BDYL 4V2DA 4V1DB 3UTQA 3TCLB 4F8QA 2PP8A 3B2PA 3B34A 4KK6D 4NQDE 1QFWH 3HFFA 3ZHDA 2UZYB 1GWBA 3JWNC 2E86A 1KCRL 4PKIG 4PJ9C 2ALAA 2HH0H 1FVCB 2R59A 1D7BA 5JQIB 2B2XH 3QCVH 5A16B 3IRCA 1UENA 5IVOA 5C0FA 5KN5B 1UTDA 4JN1H 4MA8L 5L4IA 4FABH 4QCIA 4O00A 4FLQA 4KVCH 5DQ9A 1T66C 5D72L 1HAUA 2VE6B 2J1WA 2X70A 2H32A 2OJEA 4RA3A 4BBWA 4PRHB 1NQBA 2ZP8A 2Y3NA 3Q8AA 4WTZG 3AREC 4AYBA 4CU8A 1P84J 4EN3B 5C0AB 5IFAH 3RZWA 2XA8L 3MRMB 4U1KB 5ID1B 4WJ5B 5HXMA 4HAKA 2D7MA 3U83A 3L08A 1HHGB 4DP0X 2QQNL 4TVPE 1KUMA 2I26N 3MX0B 2GSGB 3CWGA 1QO3B 1ID5I 1M3IA 1WQVT 5HJDA 3GSNL 2ZUQB 2LR4A 4PBXA 3GMMA 4UNTA 5DUJA 1RZ7L 3FTXA 4ZMVA 1E5BA 3NCJL 4DPRA 4UT9H 1WWCA 1SEQH 1NJ9B 4K7FA 4PRPE 4WNQB 4KI5D 3ZKMC 2RMNA 3L95B 1ACCA 4H8WH 4XO8A 4YDVB 1ES0A 2XWJA 4MCYA 3QUHA 2IOIA 3DTUB 2CR0A 4HFUH 1AQDA 3FU7A 4AQAB 3FTWA 4A55A 4P48A 3HZKA 5MEOA 3OGKB 4M5YL 3GXMA 4JM2D 3A67H 1OPGH 1SYVA 5L4FA 3WU1A 2OMWA 4N5EC 4D3CH 3QEGL 1MKFA 4PJXE 2X4QB 2X44D 1UG9A 1JL8A 3MGOB 3SDAA 5ID0A 5GRWA 1WZKA 2IG2L 3DUUB 4M43H 3VD5A 2VKXA 1BQSA 3CZFB 3CK0H 2ZSVA 2VLMD 3Q2WA 2D9CA 2JJUA 5FOJA 1DN0B 1FZKB 4Z18A 5K9OA 1EJOH 1F45A 4UILH 3P72A 3DUSA 4ACPA 1SXNA 4XCNA 5FLUA 3MLUL 4IRSC 5CU9A 5F8RC 4ZNCD 4U0RB 2R56H 4WI0B 5IK3B 4AM0Q 4EKXA 2E56A 5CLWA 1RZFL 4U6TA 1LO3H 3D07A 1XCTB 2EDRA 3B5GA 3BPNB 3T4AA 3D34A 3FUEA 5LUMA 5ILTH 1A6UL 4J4PD 4MMZB 3LXUX 5GS0H 3D9AH 1W15A 1KXVC 4QO1A 1KPRB 1J0YA 2GY5A 1ZA3A 1ZA3B 4OZHE 3FOMA 1GAFL 1RUKL 1TFPA 4HHGA 4X5XA 5FAAA 1FNAA 2NXZD 1M4KA 4FKEA 4HGWA 4I9WE 4JREC 4UUJA 4XMXA 5AOIA 4XWGL 1GZQB 4NRXB 2PPFA 3RUGE 1E4JA 4A2HA 5E8EB 4JCLA 3MRIB 5CSZA 3BZFA 5E8EA 3VRLF 1QLFB 2I07A 2X89D 4KY1L 1EVTC 3TA4D 2V5YA 3L5XL 3GIZH 4UT6H 2FEEL 5DUPL 1C12A 4RQQB 3BIAX 3AREB 3D4ZA 2ZX6A 2C1PB 2WWMD 3GLZA 4G6AC 4EI5A 1YUKB 1KXHA 4QLWA 4YZFF 1KBVA 5KYYA 3AXLB 4IM6A 4KOBA 4P3DB 1F8TL 3OMIB 1FFPB 3V4PH 2OA9A 4BZ1H 7PAZA 1VGKA 4PUBL 3UTTB 4BFGA 5FTTB 1GRWA 4ONHA 2AJVL 3F58H 2ZXGA 4PRAB 4ZZKA 1ZVHA 4GW5A 4PCKA 1H8NA 1N19A 1FRGL 1WAAE 2I24N 4BSVB 2RCSL 1G6RB 4XXDB 3FT3B 4FCGA 2XA8H 2JE8A 2GUOA 3NJKA 3MJ8A 3RHWF 3UTTD 3TURA 3RFJA 1ND0B 2NDFA 4WFHD 2WXMA 1H6UA 4WF7A 1JZ6A 4Y19D 4G8IA 2AHIA 6PCYA 3EBGA 5FW8A 4I4WB 4JFSA 1CFVL 1Q0YL 1MAKA 4LRIA 2OQJB 2Y7NA 2WZPA 3VSQA 1I1AB 3S3CB 1DQVA 2BC4A 4XVJH 3EADA 3O41A 4M43L 4KGJA 1QTSA 1DVUA 4OFYD 4KTGA 2SEBA 3ELQA 5IJKA 1MRFH 4N0UB 5CZVH 3RZCA 3I3EA 3L1EA 1YYCA 2CRMA 3MX0A 2AK4B 2ZAHA 2JF1A 3JV6B 1LO4L 1IV8A 1AGCA 1RZIB 2KPNA 2EXTA 2OZNA 2GTZB 2EEDA 5C0RH 4XP4L 1V3KA 3WY2A 3IFOB 4ZUUB 3ISWA 4GXFA 2Y24A 5FUCC 4Z7IA 4ZW8A 5INCB 4PP2A 2ZAGA 4HJJL 4LOUC 5LBGA 1DEEB 2PPCA 4UQAA 2BIIA 4OZHF 4MHHI 4G6KL 4YGVB 3RPIA 4AZ8B 1FL3A 4F92B 4XVUC 2MOQA 1H6FA 4RMTA 2XN9B 1TXKA 4OGAD 2G60L 4G3YH 5IM7B 3ZE1E 5JOPD 1MHCA 2WIIA 2EACA 3UAEA 2WXKA 4BYHA 4Z23A 3T8MA 3LIZH 4Q3IA 2CIIA 3IXAA 1B0IA 4XOSA 1IM3B 5IOPA 2WVUA 5D6CA 5JXEC 1EIBA 2J88L 1CVRA 4L3EA 3ETTA 4LCIL 1AYOA 3BKYH 2OMTB 4PJBA 4PIBA 4UQDA 3NZ8A 3ZDXF 3OJMB 1U8HB 4J3SA 4UI2A 5IK3A 5C0FB 5KN5A 4JGNA 3KDMB 3IDNA 1BG9A 5LNDA 1A9EA 1CE1H 3T0WA 3MLXL 3IDXH 1Q9WA 4LSTH 4PB0L 4QRUB 3FQRA 1NIDA 5DU7A 3ZSSA 3K1KC 3TBWB 3Q01A 3HUJB 3HUJA 4J3OC 4JRYD 4RX4A 1U36A 2J8UA 3HB3B 4JX0A 2BOLA 3KWXA 3ALPA 1E5AA 1C7SA 1HH6A 2K7PA 3T77A 2IADA 1NDMA 1XO8A 1CFVH 1FF5A 5B22A 3D25A 3SDCD 1XGTA 1GZQA 1YY8A 4NRXA 1XGPB 2NY3B 4L0PB 2R7EA 3OJDA 2C1OA 1JPSL 3K6SA 1IGIL 2JCCA 4P9HH 5DRZA 4K94C 4LSRL 2XPYA 4MX7A 4ZAKA 3OL2A 4ZXBA 3PP4L 5HJGA 4DVBA 3QUXA 2Y69B 1VFAA 2QKIB 1WBZA 3FN9A 4QRRB 1N2RB 4IDJH 1Q38A 2GQHA 2MKWA 2Q3AA 2ENPA 5JMOC 3BZEA 4PSPA 1BWWA 1R3KB 3MUUA 4Q4IA 4Z0BH 5LGKA 1J9TA 1CIDA 4ERSL 4ZX4A 1A47A 3BJLA 4PJ8C 3F84A 3QR0A 1I1YA 4GYBA 4ZW6A 4A39A 5ID1A 2CRIA 3MV9D 1E4KA 5EUOA 1T4WA 4Y16D 1OW0C 4RGOH 3QDJA 4KZEL 2YK1H 2WBXA 5KZCB 3DX4A 5A1AA 4OJYA 3I50H 3GSUA 4TQEH 4XT1C 4YHZH 3QJUB 3MUZ1 1AFVL 2VL5A 1JN6B 5C0CA 4NNYB 4PJ7F 3SJVB 5C9KA 5DO8A 4IHBA 4QRRD 1UM6L 3RGVB 3M19A 1GOFA 2YO3A 3MBWA 3OKDA 4EZJA 1QLRA 1QLRB 3E1ZA 3GWJA 4YHLL 1FJ1A 3RPKA 1CFBA 1ZWIB 2AK4E 2FQGA 4OLVH 3CHQA 4OZIA 2IAAC 3UBHA 1USQA 5FGBC 3BH8B 2Y5TB 4I3SH 4RZKA 4YDVA 5C0GA 3A6BH 2BVQB 1YEIH 4LCWB 4EI6A 3IMTA 4D0DA 4ARRA 3I74A 5C3IA 5IB2B 4WJ5A 2EP6A 2K9UA 2EDMA 3GM0A 1IBGL 2VM9A 3C6LD 3B2VL 3X1EA 1ONQA 2PPAA 4LRNH 3BVDB 2ZYIA 2VR8A 2FE0A 1ICTA 3O3EB 5GS1A 1UM4L 3X1BA 2AJUL 2VSKB 2YZ1A 4Q9CA 1WGVA 5B7EA 3SYOA 5ISZE 3BZ4A 3GJFA 4ODTH 3BAIA 3O6KL 3QAZC 4L8BA 1QI5A 4QT5B 2HRLA 1NGZB 3MLVL 5D7IA 3SY0B 3PAZA 4HJ0D 3QNZA 2YPVL 4FG6D 1QR1B 2QSQA 4GRLB 3CVDA 4OZFB 2ARJA 2C1PA 4C55A 3X3FL 3KPQB 3LQZA 1BLIA 4MQXD 1IC5L 4QHLB 1E90A 3FS9A 1E9QA 4J2XA 4WSKA 4NKIL 5B7MA 2I32A 2LABA 4MASA 4LF3A 3MRHB 2CBOA 3IRZA 1DP0A 1R3IH 3LNEA 4DPBX 2GAZA 3HG5A 4PS3A 4EXKA 4NKDA 1MVFA 3SO3B 3UZQB 5I30H 3HN8A 4UMSA 3WHXB 3CLEL 3LZOA 3QO0A 1AC6A 1NTDA 4BDVB 1AY1H 5IMKA 5F6IB 1E9OA 5IQ7H 2IG2H 2LLGA 3AW5A 2OYPA 3GFUA 3QDGD 5C7XL 2UYLB 2NW3A 4PS8A 4WO4A 4FL4C 4JJ5A 1QBMH 1BMWA 1S46A 4AV4A 3K2MC 4MS8C 3DVNA 1IKNA 3MLUH 3N1FC 5JHLL 2R56L 4LEOA 4ANUA 1YJDC 2B9AA 4NQVA 5CP7A 2ZOTA 4KVCL 1SBSH 1KENH 4FG0A 1CYGA 5EU7C 5KSUB 5DD5H 1CIUA 1OW0A 3LZRA 1MLBB 5T1KA 2B39A 3ASWA 3GEFA 4NZUH 4Z7VB 1C8QA 4BSVA 2WBKA 3K2UH 3U9PH 1HILB 4XSQA 3KXFE 2BMKA 1BFVL 2A74B 2VTFA 4JY4B 4K3GA 1ZTXE 5LG1A 3UYOD 3GI8L 1PAZA 4WI7A 5JYMA 3UPRA 2H1LM 1QKZH 3GGWB 5GGTL 1MFBL 2XXFA 2IJ0C 1OARL 4B9IA 3Q43A 1OE2A 3U0TB 3U1SL 2PR4L 3MFGB 4BFRA 5IMMB 3KPTA 5F96L 4X8XA 1TJHH 3QWRA 4UOZA 1TYRA 3K46A 3ARDD 3NJIA 3SEPA 3BAEH 2ZWZA 1RIHL 4G7YL 1AHWC 1CI3M 1ESOA 5HBBA 1GSMA 2FJHA 3JWOC 4HUWB 4YDLC 2DMCA 3C6LC 1D3CA 4XNMB 4Z7OE 5B3NA 4YDJA 4F8NA 3CZNA 1JXGA 2XIBA 4X6CF 1I7ZB 2AXWA 5CMAA 3MA9H 1Q72H 1A3RH 3PL6A 4IW4C 2WXIA 3VXPA 2V17L 4EI5D 4HPYH 5IJBA 1PD1A 1YVLA 3TEWA 3HLAB 1BA9A 2W38A 1TF4A 3DIFA 4HZLB 3QJOA 1PY0A 3I75A 2J43A 1IGJB 4P4KC 1QRNE 2PR9A 3PWPB 3PWPA 4JM0A 4N8VA 5FHAH 3ZTDC 1FI8C 1EZLA 3FMGL 1S5HB 4XP9H 1OWWA 3T3PF 3QDMD 4KXZH 4XP5H 3NCXA 3L3OC 1HKLL 3HIZA 3K6IA 1IBDA 4IIQC 5C0IA 1PEZA 4ORZC 2F5AH 3HNVH 3KLHC 4GAYA 2IF7A 4I8DA 2YUZA 1BZ9A 2AMGA 3ZLQC 3G5WA 4ZSOA 1TVBB 1A6ZB 3QDHA 1NC4B 5SWSA 4GW4B 2ZCHL 2X4TB 2V3DA 5KSAA 1Y18A 1Q9LA 2DM4A 4QDGA 1AP2B 5IBLC 2V7HA 2XWTB 3IVKB 4HJJH 5SWSD 3UZVA 3FXIA 1MI5E 1YN7A 5F93C 1BMGA 1CF8H 5TTRA 4QKXB 1X7QA 5F7LB 4HEMA 3ZMEA 1L9RA 1YNKL 2ED6A 2ZNWA 3P4MB 2YC1B 4N2OA 2X6AA 1S9WB 3CFKA 3FFCB 5INDB 2HN7B 5B1BB 3L4CA 4JFPB 3NJXA 4PHXA 4JVWA 1AR1C 4P5KA 1DZ0A 1T1YB 4AQOA 2ZX5A 1U8OB 4JMNA 1F5WA 3U2SA 4QNPF 2OBGA 6CGTA 5C07E 2HUHA 1DFBL 5A2KH 4J0MA 1WS7A 4B9CA 1DJHA 3D39A 2R9HD 4XZUA 3Q6FA 4WIQA 4TLTA 1DQLL 4FTVA 2H32B 5FWRA 5HI3C 3RVTD 1OF0A 1UWGL 3IDGB 4A6YA 2D31B 5DMIH 3H1ZA 1XX9C 2X7LA 5D1QB 4LPUA 2WKLA 2X3CA 3N50A 4W70A 3SOBH 3VQ2C 2EDBA 3P9LB 5AAPA 3ULUF 1OO2A 4K5NA 2MCPH 4WWKB 4M6NL 5DZLA 1QR4A 1JNNL 2BY3A 1BW8A 2CDEA 3S37X 1RJLB 4N8CH 3CH1A 1XVSA 4KZDL 3PHOB 4W9JC 3QJTB 4LLVA 3GSWA 5IROA 2IDSA 3W0WB 4LXRA 3WTVA 3TBVB 2WQUA 5I18H 2A77H 3AY2A 5C0EA 2PXYC 1BQHG 2PPEA 4NHUA 1U3ZA 4WU7B 1KWGA 3DKHA 4GW1A 4NQCE 3IAGC 1B4JH 3EO9L 1LK2B 2A73B 3ZT5A 2NZIA 4QXUH 2ARWA 1M42A 3D39D 4JM4L 3TCTA 2EYSB 3L7FB 1EUUA 3ABMB 1HAWA 5CILL 1E50A 1XR9A 5D1QD 2LV4A 5BZWA 3GI9H 4XBGB 4IGBD 4Q0XH 3UBXI 1YPZF 2H8PB 2YPKA 1O9ZA 3BWZA 3ESOA 4QY8A 1E6JH 3BVTA 3VNZA 5E8NB 5D93C 5C07B 2VLKA 1C5CL 1CLZL 1R3JB 1A3QA 4AVKA 1PGVA 1XF2B 5KJ7E 3D3VA 1IILE 1F11B 1HKLH 2QELA 4EDXA 4M03A 3BFOA 3QDGA 1BD2D 1P4IL 5D1XE 3EOTH 2QVIA 2CLVA 2R0ZH 3CN4A 1I3VA 3IGUA 4HS6A 4GKSA 1DEEA 2XWTC 1CL7L 1JK9B 4YHMH 3C6EA 5GZNC 5DJYA 4RSYA 2BO0A 2ZCHH 3IDIA 1GA2A 2FB4H 3D0LA 1E4WH 5BRZD 3VFPB 4L29A 1NICA 2NY4B 3LS5H 5EZJA 4J1UB 3CLFL 3RWHB 5G5DA 3SDAC 2IH1A 3HR5B 3RJOA 4JKPL 3UJJL 3VX1A 1TMQA 5HHMD 1A6ZA 4XC3L 3SQRA 1NAMB 1P5UC 2AANA 2VDKH 3T2PA 1IC4H 2VITA 3E9TA 2V9QA 2GIMA 1KLFA 4Z95L 5CR1A 4K73A 1HX0A 3L6FB 2A9CA 4FJZA 1JXJA 2IV9A 3MLZL 3X17A 4A7GA 1OAKH 4AEHL 3NP3A 3JT0A 1W91A 4ODXA 4LK4A 3MRFA 1KF9B 1TVDA 5D1QE 3W37A 3ABKB 3P9MA 1PZUB 2J6EA 3UJIH 3RG1C 4MNHA 1XWDC 3LEYH 2CNYA 2E7LA 3BISA 5IKCB 3ZR5A 4AT6A 1Z5LA 5I6KA 4FEIA 4QJ3B 5CJQH 1NLBL 2ZXCA 1RURH 1IAIM 1FFQA 2A6JB 1A0QH 1GMIA 1LK3H 4IKJA 3ZY7A 1MLBA 2VDNB 3LKQA 4KRPC 1QSEA 5CLYA 5GGUB 1H3UA 4I3RH 3UTOA 2ZKHL 3KCWA 1I1FB 3BW9A 3QFGA 3CC5A 4Y4HA 1W72A 4DSYA 4EUPB 3VGGA 4OKDA 4KJWC 1CICD 2OMVB 1ZLWK 4OJDH 1CGSH 1KT2A 4G7QB 4HIIB 4KRNA 4OZGA 4DEPB 5AAWA 2YAOA 3BVNB 1JZEA 3N44B 3P77B 1KTCA 1T4KA 3FCBA 3BH9B 4H8PA 1W8EA 5HGBB 2ODHA 2QV2A 5F7NC 4FXTA 3GJFK 3RZCB 4Y2NA 1TENA 2DQEH 1YEEL 3ARGB 3GXUB 4UQIM 5AG9A 3VD0A 5DEFB 2VGLM 2DWSA 1KACB 4RISH 4R9HA 4HCRA 2QVTA 3MJWA 1RXLA 3B2UC 4JG9A 3VFUB 5CCJA 5FYJU 1FS2A 4QRFA 4P5TC 1G9HA 2NW2B 4MVBD 4RA0C 4ICWA 3ZTNH 4Z76B 1WEJL 5FUCE 3NJLA 2DZEA 4M1GL 1ZCRA 4JJHA 3MFFA 2ZKXA 4W9ZA 2EO7A 3H9SE 1TTCA 1DQMH 1G7QA 3V4VA 3MRJB 4EDWH 3LS4L 3H3PL 1M05A 3DGCR 5D7IB 1WA1X 2QEJA 4PUBH 1D7CA 3D85D 2PCPB 2YBGA 2YQ3A 3H9ZA 4OM0L 1I75A 4WWOA 3JTBA 4MLSA 4WUUE 4XC1H 3TF7C 5M7QA 2OXGB 3F7KA 4W9KC 2NXZB 3U2IA 4P57B 3A21A 1CF1A 4DWHA 3PDGA 4PLKC 4N0FB 1X4ZA 1GYVA 3MLYH 1LVEA 2IXQB 5KBMA 2ZCKL 3QDGB 3UAJD 2G0KA 2WP3T 5INCA 4BK8A 3WIHH 3TH4T 1IJNA 2ZSWA 5AOMA 1BD2A 3EG9A 2LU3A 4Y5VB 4PW3A 3VGAB 1DQJB 1EAPB 4C4UA 3D3VD 1ZGLA 4WHYG 1PZAA 1ZVNA 5DQJA 2LOEA 4NQDB 4XBMA 1U42A 1UD4A 3Q6GL 3IEAA 1AVAA 2JLLA 1K8DA 4MZ2A 5I71C 2P1MB 2I9LA 3LMJL 2VSCA 3BHBA 3CUPB 4NO0B 3VFOB 2WANA 2V17H 1UA7A 1EUTA 1KGIA 1NFDB 3HCVB 1ZMYA 4W9EC 4KJPD 2IAMB 4OQTA 5CHNB 1XIWD 4NI3A 5ICZB 5SX5K 3GHPA 2ED8A 1F00I 3MPCA 1WD9A 5ADPH 2Q0ZX 4CC1A 5HY9B 1XTMA 2WO2B 3DSNA 3F8UB 5HYQB 3RTQA 4DETA 2DDQH 2XETA 3T3PB 4JO1H 1GW0A 1ZPUA 1CTOA 2GKIA 5T5NF 4LBEB 4P8SA 4S1SL 3IS0X 2PABA 4IS6B 5CMPA 2E46A 1DJZA 2DIAA 2CO3A 3LD8C 2NSMA 3K0YA 1OALA 2O5XH 5T5FH 1MIMH 4MDRA 4WI5A 1HXKA 4PI0A 4AL8C 1F4XL 1T20A 5DYOB 3WOVA 1CICC 4E9QA 3AQZA 3ZDXE 4OQTH 4OJEH 3HMWH 2V8MA 1AYRA 3RNKB 2X4RB 1LO2H 4NPYA 4Z7QE 4X7SL 4GINA 4ZMPA 1EX0A 1KGJA 1MHHA 2O5YL 3J07A 3QDJB 1XCWA 3KWWB 2R7EB 3OJDB 2ZOLA 3MRNB 5C0JB 2KMWA 5CEZH 1JV2B 3P0YH 4GT7A 2ZP0T 4IOSD 1OZTG 2JE1A 3BLKA 4XVUD 3FT0A 3EIFA 5JHLA 3W3NA 3T71A 1XD1A 4TSBL 4XN8A 2EIJB 4Y2DC 2Q8BH 4CKQA 1C5DA 3W3GA 5C0AD 3MV9A 2VAJA 1T89C 1U92A 2A6IB 2YGNA 3BD5A 1KYUA 1CDCA 2UWEA 2WNWA 2P8LA 2P8LB 4IU2A 4TTDC 3V7MA 4LKCA 5DDHB 4JFDA 4LDEB 2BOCA 3CHSA 3U6XS 1IEBA 3ARDC 4JO8A 5HGHA 2JJTC 1ZS2A 4B27A 3QCTL 5ITBH 4XBGA 6TAAA 4GSDL 1D6EA 3K6DA 2NYYD 4E68A 4TVPD 2I5YL 4Y16C 4APQD 3KAAA 1NBZB 4JFQB 4OZGE 4UT9L 4ZFFB 4GG6B 3L3KA 4LLAA 5KG9B 2XN1A 4ZG1A 1A9NA 4M5SA 3BPOB 3I02A 2WCGA 3OWRA 2Z4TA 3PXLA 5HZLB 1JYVA 2L7QA 5GGRB 2CWRA 3P0VL 1DN0A 1FZKA 4Y1TA 5K9OB 1MFEL 3NPSB 3LHPL 1OQXA 1GKEA 1PFCA 5DRWA 5D7HA 5H2BA 1L9OA 1XF2A 2A2QT 1OT2A 2J6WA 4I48B 5CMAB 4QHUB 2A7BA 5BQ7B 3FQNA 4OJFH 5L2KB 1A7RL 2FJGB 5CD3A 3DIDA 2X6MA 4C56A 4QBZA 4HUUB 4NQSA 3OZLA 2KBGA 2NY3D 4LLMB 2G4EA 5I8OL 2RALA 5I0WA 4RGNE 1ERNA 5ECGA 2A83A 2EUZA 2NNAA 3PHQB 4JO3H 5FLVA 3A6OA 4LSPL 1GTNA 3PUUA 3HB3D 4I0KA 1RULH 4Z7UF 3HPLB 4AX3A 1FZOB 5JNYA 2IDCA 2R2HB 5TDNA 3C60D 2PYEE 1QFOA 3AWGA 4PJXF 3Q8FA 3D50A 3QXTA 1W16A 5DUBB 1QZNA 2NY5L 4BK5C 2NNRA 3BD3A 2P5EE 3G7TA 4JFVA 5I1JL 3KPPA 1ZLDA 2WHVA 3ZE2E 4R96A 1H8LA 3TBSA 3TWCL 3QG6B 2WBJD 4AQEA 3QFJD 3Q3GB 4R7NA 4RAVA 4APXB 1OGTA 4ZUVB 1LO5A 3RFSA 1XF4A 2X87A 4QTHB 2BSRA 5I73C 15C8H 4ESKA 5DK0B 1ANUA 2F54B 2YPVA 4MQXC 4PRDA 4WTXA 4DZ8A 4E9XA 1D6VL 4NQVB 5CP7B 5DQDH 4G83A 1JL5A 3OAZH 5C0BB 4A67A 4JY5L 1FUNA 3F7LA 1EGJH 3KPRE 1A3LH 4LCUB 5GGUA 5F44A 4PRPB 1RZKC 3U4KA 1HNYA 3WE6B 4M7JH 4AQ1C 3ZDWA 1WCBA 2YGOA 1H3WM 3KW8A 5D96C 2R8SH 4R97C 2WWNA 2XPGA 5BOZG 1SN2A 3FHQA 4ABQA 4EUPG 1BZQK 4G1EA 4GBXB 4BZ1L 1ETZB 2CCVA 3O3DB 4UDTA 2BXYA 1TTAA 2PWHA 4QRPB 5K9KA 1J9CT 1T6VN 3D05A 4QXGH 3VQ1C 1J12A 5AOJA 4B9PA 1I85C 2VXSL 4AOFA 4B9GA 3OGMB 2Z9TA 4NN5B 1FQVA 4IHOB 3WBDA 3HG1E 5FYLL 1A4CA 5HVFB 1CD9B 4M8UA 4ONHB 2EVHA 4F58L 2YAFA 4NO2B 3BUYA 1WFIA 4JGMA 2NY6D 5IOPB 3DROB 2XTLA 2VABA 2WQAA 2FEDD 4X9HA 4KI5F 2GBTA 3PUCA 4JRXA 4RNRA 5E8DL 3CCHA 3RBSA 4N86A 2OLDA 1GW6A 4NUJB 5FYKL 3I3BA 3NA4A 1F4XH 1A6AB 4AMKL 4QY8B 2CK0L 1CC3A 2XBTA 5CILH 5TE4L 1RZJL 3D06A 2VIRA 1F90L 4RMSA 2QPSA 2P7TB 2Z8SA 1KIQB 3KYMA 1BX2B 1QFWL 4HMDA 1UXSB 4OD1H 1F18A 1OK8A 4AMXA 1X5KA 4X5LA 1RHHB 1S9XB 3DUSB 4DCQA 4AYID 4AH2B 1V54B 3P3UA 4LE8A 2DS4A 1IM9A 3L3KB 4N8VB 2P80D 3US9A 3G06A 3U7AA 2D3VA 3MROA 2AABL 2HX9A 1OQOA 1XCXA 3D39E 3NIDB 2GTZA 3VX0A 4E5XG 3QNXA 2HLAB 2BFGA 1F4WH 2VMDA 1MDAA 2YAMA 2MWCA 3B9KC 1WTGT 3GMPB 4FI7A 2W07B 1EDYA 3M86A 4IRSD 1YECL 4DGUA 5KVDH 1UXWA 4PMFA 5FUZL 2F54D 1A3LL 2IWKA 4WFED 5GHWH 4NM8H 2BSBA 2YD5A 3QZNA 4LOFA 3ILQD 1HN1A 3WJMB 1ZHLA 3RNQB 4ZI8A 4KH9A 1B3IA 3C8KB 3D18A 4N2CA 4XBPA 3QFJB 4L1BA 4RWYH 4AVIA 4YQXL 3B8SA 2ICEA 5HYSB 4F8OA 1E8WA 3G6DL 3WTSA 1MQKH 3NCJH 1PZ3A 1MHHB 3H42L 2JELL 4YX2H 35C8L 5I26A 3OF6D 3CLWA 1S78D 1FBIL 4D9LH 4HJGB 2F15A 1Z6JT 1IM9D 2WOYA 2MNJB 3HLKA 2EKJA 2RHEA 4KKLD 2PP7A 1NCOA 1P7QB 5I1HH 1MFDL 3IJYB 4MQTB 4YO0A 2ADIA 1VFAB 4DP1X 3EDEA 4PS4H 1JDDA 3ZXAC 3H2PA 5F1NA 3BRDA 4U1IA 3HJEA 1O6TA 4MA3A 4P91A 3WL9B 4J3UA 3NJJA 1ILUA 4ELKB 3KEDA 1R4XA 1OEZW 3E8UL 3FMGH 3OB8A 1UADC 1X7QB 4ZMWA 2HFEA 1M1XA 4KO9A 4CC4A 3HNSL 3O45A 3VM7A 1AI1L 1NFAA 3N1MC 5BS0E 4XPFH 4UILL 4JM2B 4X4YB 4CNCA 1DBKH 1BWMA 1SXAA 1HH6B 3FRPA 2P45B 2WV3A 2M26A 3V6ZA 1JTTA 2UZYA 1K4DA 1VGKB 1T1YA 2CO4A 5E5LA 5B1JA 4XNAA 1GGIH 2YPLA 4LESA 2K3HA 1HXMA 5HTSA 4KKZA 2JNZA 3TIEA 2PP9A 3N43B 4RAUA 2APSA 1I82A 4MX7B 4NJAL 2CHXA 4ZFGH 4AXWB 4J3TA 3F7PC 4RH4A 2X0WA 4TN9A 5C0DA 4NZTM 5EO1A 4CJ0A 2H4EA 1CXEA 4W4OC 4U08A 2Z35B 3OGCA 4PRHA 1HKFA 1T0MB 1LQSR 3CZGA 3IU3A 1P7HL 4HS8L 4K94L 2MQCA 3N2JA 5E4EC 2DLHA 3P54A 1M7DA 4PBVC 1W0WB 4R4NC 3PGDB 3GTNA 3VGDA 4TRPL 4KDTA 3N04A 4Y1AD 1ZK9A 2VXUL 1P4LA 4LHJB 5GPRA 1UVQB 2G3XA 4N2IA 1I9EA 4Q6IB 4LMQI 4WHYH 5TGBA 4RCWA 2D0FA 2GJZA 3O3AB 2BP8B 2Z6FA 3LH8A 4Z7UB 4F7CB 4AKOA 3N1QC 4BKSC 4R4BA 3ZT7A 2IDQA 2NCEA 3QHFH 4NZRL 4UYQA 3OZ9H 5J9PB 3HKZA 4IEFA 4HFUL 1JHKL 2ENJA 3S3BB 2E74C 4AYFA 3NJGA 1EV2E 4YBLB 2Z93B 4QXVA 4FFWD 3JZ7A 4OCMC 3T1FA 1IEBB 5FA3B 2XQBL 4PGBA 2DQHH 3FQUA 2BVQA 4F7MB 3ATFA 3RVUD 3REWA 4YDKL 5IR1A 1G5GA 1XF3A 2BCMA 4GRMA 4KHXL 5E9DD 1OAYH 2ZXEB 3DTXA 2GJ6B 2GJ6A 3QP3A 4YK4C 1DVQA 3U7WL 4MJIA 4QYOA 2Y7SA 1JCVA 3JTTB 4UBDD 3MRLB 2FGZA 5MHSD 1RVFL 1V7NH 5DHDA 2UXVA 1CXKA 3MYZA 1P6FA 3DVFA 2GFBA 3FQXA 4GKLA 4NUGL 4RFNC 5JIHA 1R33A 3SODB 3FFDB 3EJPA 4MJ6B 4BZ2L 2QTVA 4PCYA 4C56D 5DJ2A 5G4OA 1DQKA 4HIJA 1T5WA 2GI0A 3BQUC 4M61A 5DJZA 4PVLA 1CGUA 4ZAKB 1CK0L 3CFBB 4WV1B 4BH8B 4C59B 2GTWA 4YNYA 1AR1B 1TQCB 5I23A 1ZE3C 4QRTA 4LCVA 3R8QA 5CFHA 5I1EL 3P73B 4NQDD 4FQXB 5GZNA 3WFBH 1KB9K 3VG0L 5KUMA 4R6GA 3BX7C 4YXHH 3Q44A 2XTJC 4PTUA 4PY8J 1RAMA 2DJMA 4E5XA 4NKOB 3MNDA 4FRWA 3WIHA 5IFHH 2PF6A 4R97B 1VADB 1FORL 1JPFA 1RUPL 4WI2A 2EDNA 3W57A 3N9GH 2P80A 4N6RB 5ILTL 1QLFA 2I07B 1PZ2A 5I66A 2PW2B 4NCC2 2IANB 2BNUA 3BIBX 3KYOA 4IBWA 3DK2A 3DETD 2PN5A 1QYGH 1QUPA 3ULVA 2NW3B 5GRJL 1P8VA 1UFGA 3OAZK 4LIQL 4JRLA 3SE8H 4DGIL 1HI6B 3RI5F 5JOEA 3BLBA 4OLYH 4NZRH 3LHAA 4PRDB 2D7TL 4YC2C 4AENB 1M7IA 3PYCA 4O2EA 4OW6A 1U4EA 4LSVH 3WTXA 1YQ2A 3UJTL 3F7YB 3QC6X 4FA6A 3CHRA 2R1WB 3R1GL 4H8VA 1PF3A 5TE7H 4TTGA 2ZKMX 2IAMC 1DN2A 1Y7VA 1ASQA 1WIOA 3EJQA 4BQ6A 5HYJD 4TRPH 2ARJQ 1GOGA 2J4WH 1X4YA 1MFUA 3TV8A 1R0AH 1R5IB 2QPUA 3PDDA 4N1HB 1E4HA 3JSSA 1NPNA 1Y6KR 2A0LC 4Y1AA 1ETZA 2H0EA 5AOLA 3S2AA 2BVPB 4JHWL 2PYEB 2WINB 2E0PA 4IU3A 4ZXBD 2DL9A 3WMSA 2X4OA 3EYFB 3LV3A 1FFTB 4KKPA 4C83B 2EE9A 2F18A 5IQNA 1FC1A 1JUFA 3T08A 4UV7L 3ZZ1A 2XWZA 4MCMA 3VH8G 3ROOA 3T8VA 1QUNB 2CG9X 2E59A 3D8MA 5BRZA 4IBVA 3BKML 2A9BA 3KNBA 1VJSA 2J44A 1OAXL 1GIGL 3CGTA 4DGVL 3G5VA 5I0YA 2E9JA 4HK3J 1KJMB 3MJ7A 3MJ7B 3S35H 2OL3A 5IHLB 5LJYH 1J0JA 1WD8A 2CKBH 4FF9A 1AO7E 2MCAA 2WO3B 3K8LA 5IT2L 1P7KA 2L4OA 3QNYA 2VLKD 4PJIF 3CFCH 1AG6A 2F7OA 4LHUD 3CXHJ 3OVUB 2ITFA 4L0ZA 1B4LA 3BHBB 4NO0A 1UKTA 2EUWA 4ZUWB 3UAJA 3IAQA 3HUJE 4WWPA 4YVUA 3ZMRA 4KQ4L 1YRGA 2ADGB 3NIGE 5FHBL 1OP5H 3TWCH 2GI7A 5F0JB 1KJ2B 2LTQC 3VFPA 3PHQA 5AKTA 1JPGB 1J05B 3M88A 3L3IB 3WPEA 1T22B 3D7PA 3RE0A 2BSCA 2R29L 2IH8A 2HB0A 4H20L 4PRNB 4BCZA 3HE7D 1GHFH 2WBJC 3SBWC 5CCGE 1JVLA 3QHZL 4PLOB 3I9AA 4LPVA 2VC2B 5C09A 2Z92A 4FFZH 3RL2B 5F7HA 1XB6A 2XXGA 2Z7WA 2PYED 5IFHL 4KHXH 1WO2A 5DVLA 1I1CA 1ZVSA 4XC1L 3PABB 5D6DC 2GSIB 3GSNH 5DJXB 2ZX9A 3EYQC 2CRYA 3L81A 3MV8D 1RERA 5HYJB 3S5LG 4AYSA 5EPMB 4G1MB 2VERA 4PD4K 3MLVH 2AXHA 3FTUA 4MMZA 4OTXL 1MCSA 1MHPL 1EO5A 2ZCZA 4MS8D 5KYXA 4F2EA 4H8WL 3G6DH 4TLKA 4OCWL 4YXLL 3MREA 3VFNB 2O6SA 4PJ6A 1Y1UA 3RUGB 5KSBA 3DMMC 2R51A 2AFNA 4KZCA 3KDPB 3NAAH 5F8QC 2VZ3A 3TBVA 3H7BA 1DBAH 3KR3L 1QFHA 3L54A 5CINL 1PNCA 3V6OE 3NIDE 1G7MA 3TYFA 1S7QB 4LEXH 5A6MA 1L7TH 1LWHA 3CFTA 4ELKA 1VGEH 4G1EB 4L9DA 2BY0A 4PB9L 5LBSL 4ZDHB 5DVNA 3X11A 3APFA 2J2ZB 1PDKA 1MF2H 3IU3B 2CJTA 2V5TA 5DD0H 2X4PB 4HWBL 1AY1L 3DMMB 3VI4B 3CFEB 2P1QB 3W0WD 2QQKH 3CZKA 5FO8A 3KWWA 1EXGA 4J3OF 1E67A 2DDQL 3IFPB 2R69L 1K2DA 2YXMA 3RFZB 2F0CA 1YUHA 1QI3A 5D7JA 3ZTJH 2D03H 3U9UB 1HXMB 1UWYA 2X4SB 3GXNA 4HIEB 5ETUA 3S97C 1JPEA 4C4BA 5KSAD 4NGHH 3HS9A 1FZMB 1W80A 5B39G 2X89A 1OV8A 5I1AB 3QS2A 5TDOB 5TDOA 3CLEH 3ZKND 1NBYA 1UASA 4JPIA 3REWB 5IR1B 2NYKA 3LYRA 4R6FA 1Z5HA 5EORL 1L9SA 2KKQA 2QMKA 2VLJE 4K94H 3II1A 2Z66A 1NGYB 3T6ZA 4K71B 3FCSB 3G3LA 3MTRA 2MIZA 1ZT7A 5JPMC 3U4BH 4Z8GA 4NS0A 4XPGH 2E8ZA 2PR4H 2X1WL 4H88L 4MNQE 1ACYL 1EHKB 3EDJA 3MRLA 2CNZA 1X6NA 3QRGL 4XWOD 1KJ2H 3F64A 1WG3A 2BJMH 3VWJB 1N0XL 2X53A 1U8LB 1ED3B 2WLLB 2FJGA 4GP4B 1NCCH 4X6EB 4ZYKB 2WWMC 2H2SD 4LRIC 4XVSL 4XPTL 2EE3A 5BMFL 1FHNA 3CSBA 3CFJA 3NIFF 1RP8A 1UB5A 1YZZA 3GC3A 3MODH 4QXUL 4Y2LA 1UYWH 4GI8A 3VI3E 5D7IF 5CEZD 4Y4KD 3EJTA 1L7IL 4BZ1A 5CGTA 3GPSA 4L4VA 4CAGA 3F7QA 1NSNL 4HSAC 5DD6A 1GIGH 4DGVH 4WYKA 3R19A 4NBXB 1P7QD 1SF5A 2V9RA 4A2GA 4AEHH 4LLYB 4IGBA 1JHLH 1CG9B 3GRWL 1AS7A 3LKSB 4K0OA 1I8MA 1CLYH 3N40F 5KVFH 4UT6A 3VE0B 5EC2B 2XBDA 4QD2E 3IXAB 4ODWB 3Q06A 4OZFH 5ICZA 4Z77B 5JIPA 3Q0HA 3DPBA 3QDME 5AVXB 4ZPTA 2FX9L 2GITB 3DOSA 1RH8A 3X1NA 4PJXA 3AITA 1KBGL 1Z9OA 3H2WA 1UGKA 2VMEA 4HH8A 3ZE1B 4TQ8A 1K6QL 4CRPA 5FYJL 2FB4L 4UIMA 3QPQD 5DMGD 3W39B 1IIIA 3CU7A 3O9WC 3ARRA 2V8LA 2D3JA 4PY8I 1E28B 1JVOA 3OKOA 4LIQE 4AT6B 4W68A 1MCIA 3D51A 3WHE1 1OB1A 3C12A 4NNPH 3ZTEA 4PRPA 5T3ZH 1BAFL 1HXYA 3MGAA 1A3ZA 4KDWA 1EXUB 3IETA 4P57A 3T3ME 2YIHA 5A6IA 1KXVA 4LSCA 3TO4A 1TYEB 3R18A 2DQFB 4X6CB 4Q6KA 4Z6AT 4NN7C 1BZEA 3KLKA 4IKNA 2E9WA 4JDZA 3O0LA 2C4FT 4CNIA 5KS9F 2OMVA 5JHBA 3BT2L 3U4BL 3IWVA 1BZ7B 3L1FA 2OQJA 1NCHA 4XVTL 1O75A 2EC9T 2EKSA 2YA2A 4RWHA 5F1IA 2Z82A 4AQ8C 3ARFD 5BZXA 1ZSHA 3W9EB 3Q05A 1QYGL 1VIWA 4Y88A 3ZKNC 3L4WA 3S7GA 1O5PA 5IUCA 1R6VA 3UH8A 4WP6A 2GK2A 4G8AC 4P4RA 4LXFA 3E2JA 2NDGA 3VFUA 5FCUH 1QSED 5J1SC 2IH3A 5JIQA 1QTPA 4JM2C 3GSNB 2MQGA 3KNBB 1IFRA 3T8XA 3V0EA 4IOSA 5JPNC 3NJHA 2NY0B 4Z3FA 3KEHA 5JHDE 1FNEB 5CSGA 3ECUA 4NQDA 4YFEA 2Z62A 1SN0A 3VMNA 4WW2A 1REIA 2KLTA 3QI9D 1ULVA 3NABH 1JPSH 4YDNA 5DJ2B 3HBZA 2NY1B 3LRKA 1IO0A 4JHWH 2E75C 4LVNB 4NI6A 3OB0H 4ZMAT 2G0LA 4GMTH 2FLRT 5IJCA 3PGFH 3WTUA 3G9VA 1IMHC 3TM6A 1ZLEA 4EPSA 3C5JB 4U7MA 5L9DL 1VPOL 1G0DA 1QI4A 2XG4A 2C9RA 2Z4QA 4QYAA 5EOCH 5GJSL 3L3GB 2Q6WA 3ZMNA 4ZX6A 4KJQD 3RGBA 4ERSH 4K8RH 5CBAA 3KW7A 3LRLA 4GUPA 4B5EA 4HGWB 4YH6A 5JNYB 3QI9B 4PSJA 1Q1JL 1ECYA 4XNZB 4QRRA 3QDAA 4XMPL 4I18B 2A38A 4I85A 2F9BT 1U3YA 4FULA 3SKMB 3QEHB 4XCEA 3VGEA 4H26B 5EZLB 2AV7B 4PWHA 2DYRB 4OM1H 3MVSA 5HHPA 3ESNA 1O7DE 3BKJH 1XGQB 1JZ7A 4YR6A 1DR9A 3FOLA 5D7LB 1G7PB 1HFUA 2XNAB 3IDYB 1NDMB 3QRLA 5LCVA 2DJUA 3IJ7A 3MRNA 1S7TA 4CN1A 3ARDA 3AMLA 3PL6C 4OY9A 2MPAL 2UZPA 3DO4A 4DP8X 3ARGA 3TV3H 4WGVB 3D9AL 1NMCB 5J4MA 1PX8A 3ZX1A 1MN4A 1P5VA 3WXVH 4PJGA 1KELL 4JO4H 1JG9A 2DQTL 3DX7B 3IGFA 4HQQL 4DTGH 4CVUA 4GS7C 1LDSA 4S2SA 5BZZA 3DV6A 3WE6A 1S9VA 3CV5A 3NK4A 4JPKH 1E42A 4LRNL 3B9EA 1A5FH 3QQ9C 1G4RA 1DO5A 5EN3A 5EU5A 4FFYH 3D85A 2D31A 1PNDA 5F7AA 4KJYB 1DZBA 5EPMA 3RKDD 1N64H 3VXTB 1OIOA 3UTSB 3UTZB 3FQTB 4N0YL 4PWKA 3GZKA 3HR6A 4UQ2B 3EBIA 2W0PA 2XZZA 4KQ3H 2H8PA 2YPVH 1JP5A 3I2CL 1F8TH 1G9MC 1HQ4B 1HQ4A 3V4PL 5I73B 4K3HA 5JHDA 3OXRB 5JYLA 2CKNA 4JB9L 5I9QC 2YMXL 4L3CA 5E5MB 5KZCD 1D9KB 1B9KA 1HWGB 2P48B 3UYRL 1MRDH 5I1GL 3OLEA 2N3JA 1JJUA 1U2CA 1P4BL 4KK8C 4WU7A 1SQ2N 2Z8VC 1HOCA 5E5RB 5I6XB 2Z34A 3HNTH 1NGPH 1YO4A 2WK2A 4JFEE 2Z93A 5AUMA 5FFLA 3WG7B 1IAOB 4CGUB 2Y5TA 2P5PA 2X4PA 1INQB 1E6JL 3HC3H 1ZT1A 2OTUA 5AB0A 2WB7A 1IAIL 3CUPA 5B8CC 2WXLA 3PWNB 1GGIL 2R1XB 4PGEA 1MCOL 4AG4H 1MRFL 4L9LB 3V0VA 1LGVA 3CAFA 4PGDA 5ESVB 1M6OA 1MCPH 2R83A 3NK3A 2DD8L 3DBXA 1JYNA 1MVUB 5JIIA 1A4KB 4NN5C 3STZB 1IE4A 1J0HA 1XGZA 3EOYG 3GS0A 3RWJA 2PYFB 3KVPA 2ZTBA 2R1YA 2VXTL 3WKML 3L5IA 1FFNB 3DX9A 1BJ8A 1OCRB 4L8SC 3OPZL 1DQDH 4WFFD 3GDBA 1UXWB 2VR4A 3KYAA 1PG7L 5SX4I 3WNPA 4QXWA 3AWEA 2V37A 1RJZA 3BLPX 2HCZX 4HWEH 2EE0A 1K8DB 3UL8A 4XCFH 1OSZB 4IRSA 4JJOA 2HH0L 3HG3A 5AW5B 4YHNB 5MENB 3TX4A 3ULSB 4HEPG 3US0A 2FAUA 1UJ3A 3KPMA 1IAMA 7FABL 5D1XC 3W9DB 2Z7XA 2ZAIA 3EJYD 3MHZA 4HKXA 1PKQE 4PJ7E 2ITEA 4XODA 5E4AA 3GO1L 4HPOL 4O51B 5J06A 3I6KB 3FK3A 4EO5A 4ZPVB 3PJSB 1ZV9A 2N1TE 4N0CD 2APWA 3BO8B 3QUYA 5AB9A 3QDMA 1QFPA 4LPYA 4UAHA 5C08D 1MCWM 4MJID 2L8AA 5D2NE 3GMLA 2BNRA 2VDRB 1WZMA 5I2IB 3RIKA 4JPWL 4L4TA 3NRPA 4FYQA 1PW3A 3LKOB 3GHBH 3QJFA 3CFJB 2YEQA 4S11A 2WLHA 5FYJE 5ES4B 2AQNA 4BFOA 4TZHA 4R84A 4L4VE 4EZLA 5BW7C 2IFFH 3WHE0 3FQRB 1X9RA 3OKNB 3ULVC 2R8SL 3H3PH 1KIUB 3UP1A 4PJAB 3BUYB 2EIZA 3GRBA 3LKQB 5H94A 3WSQH 3EYVA 2J8OA 3Q6GH 3V55A 1PQZA 2AJXH 2C9AA 2V9TA 3AXHA 2FLMA 2VOTA 4UOW1 1FPTL 2ZD0A 1DCEA 3KPNA 2HKFH 5DR5H 3TO4B 1FAIH 1TPXB 2DTMH 1OGAB 3BVXA 5T1LB 5ALBH 3ZOAA 3BKJL 5LXVA 1VKXB 5DZ9A 1I7TB 3VWKC 5J7CC 1HU8A 4LSDA 1MDTA 2VDMB 3AFLA 2VJ0A 2G2NA 5AVVB 3O11A 4YLQT 2XKNA 4PS7A 4X4ME 1R17A 4PV9A 4TSCL 2WZ0A 4UTAA 4MMYB 5BOJA 4PTTB 4O4YL 2JCWA 1OTUD 3KBFA 4NGHL 1ZDQA 4Y19B 1U3NA 1ZGLM 4AMKH 1OLZA 4OZFA 4XXCC 4V11A 3NP4A 5T3XL 2BNHA 5DI8A 1T5XB 2BVUA 5JW5B 3VRIB 2MEJB 5BZDB 4HK0A 4LFHG 4A6YL 2VMFA 3WV0A 4NO5A 1DQML 2NYYC 1I8IA 3CIAA 4HH9B 1AQHA 2UY6A 2WN3A 1CF8L 5IQLA 1SEBB 3ZTJG 4AY0A 4Z0XA 3ARGD 3LNDA 4C2BB 3O4LD 1XSJA 2ZSWB 2ZUXA 5JUEH 1HJBC 2ZJSL 1RUQL 2F53A 5D5MF 4BZ2A 1CE6A 3PFQA 4ZFQA 4F1ZA 4FA7B 1KNOA 4LARH 4M1DL 3RVWD 4WO4D 4HZAA 4Y9EA 1ODUA 3LNGA 3O2VH 4HPOH 2NX5A 4JG1H 4ODBD 3V4PA 4B9ZA 5FYLE 4YFDB 1R5WA 4XH2B 5AYUL 3RAJH 4FTVD 2Q8AL 1AD9B 4L8CA 2Y2TA 4LPWA 2BXZA 3QXWA 1U8KB 1HSBB 1BQRA 2X0VA 2G5RA 1PD6A 5JLZB 3S2CA 4JFHE 1QA9B 4F58H 5FA3A 4EBQH 2VW6A 4KKLC 3PXJA 2LT9A 1I9IH 4WTWA 4TVUA 2X88A 4I5BB 5LB1A 1I8KA 3V6OA 3RWFB 3TVMD 5I5IA 2CGRL 1KEGH 4Y2DB 8FABB 4KWUA 3LKSA 1OD9A 4N2BA 1JYXA 2BHUA 1D5BB 2OMUA 3MLTA 3TONA 4GSDH 1H0DB 3B7TA 4NENB 1HHJA 5LAXA 5I0VA 4HIXH 5I5MA 4AXWA 1DEDA 1MIEL 1X44A 2MCMA 4OD1L 5I6NA 4P23C 2MCPL 5D9SB 1HCFX 4OIIL 1QFUH 3C2AH 3CC1A 1MCOH 1ZHBB 3EJUA 4LLDB 1HE7A 3OV6A 3ABGA 4AG4L 4KKCD 4RMQA 3MLRH 3MV01 1OSPH 4BSUA 3NSDA 5F89A 2JKIS 2JI3A 4NFDA 2JK5A 3VACA 2ZX7A 4JQVA 3QARA 4A7UA 2EJ1A 4TPRH 5DEJA 4CW1B 3NZUA 3PIQB 3HI5H 2BWIA 1T22A 4W6YB 1T03L 4BSSA 4GMTL 2OR8A 4O02L 3EO9H 1JGVL 2JQZA 2YMOA 4YFLI 3RZCD 5C09E 3R8BB 1WAAF 4ONGH 3UDWC 4LLVB 4ZXBB 3V0HA 5D2NB 4HW6A 3PV7A 4G8EA 5AW7B 3O8XD 1E4XL 5JORA 3HMWL 2O6EA 3MBWB 2GITA 3OKDB 1FPTH 4PCTA 2LE9A 2FATH 4ABWA 3FH8A 4Y7OC 5DTFA 5AZ5A 2Q1EA