1XEUA

Crystal structure of internalin c from listeria monocytogenes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
263
Chain Sequence
ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of internalin C from Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion
molecule keywords internalin C
total genus 79
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xeuA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xeuA01
4IM6A 4GT6A 3OGMB 3RJ0A 4TZHA 3SB4A 4BSUA 2Z65A 5IJBA 4HQ1A 4FDWA 1OOKG 2JE1A 2O6QA 4L3FA 1XCDA 2JQDA 3WPDA 3WPFA 3E2JA 4R58A 2UZXA 4ECNA 3PMHG 1XECA 2OMXA 2WQUA 3W3JA 3WPBA 1KOHA 1M0ZA 4LI1A 4FS7A 5GMGA 4XOSA 4B8CD 2WFHA 4LSXC 2OMZA 3JB9j 2P1NB 3ZYIA 4YEBB 1XEUA 2RA8A 4R5CA 2WQVA 2BNHA 3CVRA 4OQTA 1Z7XW 4J0MA 2A0ZA 2C9PA 5AWCA 3OJAB 4MQWX 1XWDC 2Z62A 2P1QB 3E4GA 4AQ1A 1OZNA 3OJAA 4Q3IA 3W3LA 1QYYA 4LSXA 3WPGA 1M9LA 4GLPA 4U09A 3RGXA 2C9QA 4FMZA 4M7EA 1K5DC 1A4YA 4PSJA 3ZYJA 5IJDA 4PQ8A 2WQXA 4AW4A 5IJCA 3BZ5A 4V2EA 4LSAA 4R09A 4I6JB 2YA1A 2C9RA 3O53A 4CP6A 5AWAA 2Z7XB 1A9NA 1ZIWA 1GWBA 1OGQA 1NM4A 4LXRA 4PKIG 4PERA 4Z8GA 2RR6A 3WN4A 3ZYNA 3WPEA 4R6AA 1H6TA 2OMTA 4Z79A 3ZYOA 3RFEA 1P9AG 3FXIA 3M18A 1M42A 1M9SA 5D3IA 3RFJA 4U06A 2Y5QA 3G3AA 3ULAA 4R0AA 5GQRK 1KOOA 2P1MB 4FCGA 4V2DA 1H6UA 1IX2A 1JL5A 2ID5A 2XOTA 4LI2A 4KXFB 5CMPA 3REZA 4ARNA 3OGLB 3G3BA 3G39A 4R6JA 4EZGA 4R07A 5HDHA 3ULUA 3C6PB 4ARRA 4FD0A 1OTMA 3WPCA 5B0NA 3W3KA 4Y61B 4BSRA 4Q62A 5B4PA 2P1PB 3O6NA 2O6SA 4V2CA 4QC0A 4Z94G 2WQWA 1W8AA 4CNCA 4Z61C 3W3NA 2ELLA 4U08A 3FAXA 3OGKB 1FQVA 1M10B 4WP6A 5GS2B 2Q4GW 1FS2A 4ECOA 2OMWA 2BEXA 3FAWA 4RCAB 3WPIA 4CILA 5AZ5A 4CNMA 1FT8A 1P8VA 2XWTC 4KT1A 2OMVA 3VQ1A 4R08A 4CC4C 1K5GC 1U0ND 2ASSB 2V9SA 4QBZA 4Q3GA 3E3ZA 4LXSA 3RGZA 5GS0A 1LTXA 2V70A 4U7LA 3CIYA 4QXEA 1O6TA 4R6GA 3P72A 1LYQA 3UL9A 2Z82A 5A5CA 4MN8B 1OT4A 3E6JA 4P91A 4WYKA 5IYXC 4RWTC 3BC9A 1P8TA 4UFRA 3W3GA 4CC4A 1DS9A 2ASTB 1OTOA 4NKHA 3ULVA 2RA1A 3CIGA 2Z63A 4K17A 4G8AA 4AY9X 2O6RA 2V9TB 4LSCA 2Z81A 4R5DA 4RCWA 2Z7XA 1WWLA 4XSQA 3RFSA 4NKGA 1PGVA 2P1OB 3G06A 3RW7A 2CA6A 4P8SA 4R6FA 4Z64C 3VQ2A 1XKUA 4C2AB 5GMFA 1IO0A 2IFGA 4PEQB 5CMNA 4L3AA 3DZEA 1SQ0B 3KJ4A 3BCDA 1DFJI 1G9UA 2JE0A 4H09A 3UL7A 3A79B 2UZYA 3GOZA 1O6SA 3UN9A 3TSRE 3UL8A 4C2BB 3RIZA 3RW6A 2FT3A 1FO1A 1YRGA 1DCEA 1D0BA 3C6NB 5AWBA 3BCFA 5GMHA 5HZLB 2OMUA 2OMYA 1OTNA 3G04C 3M19A 5LFNA 5AWDA 5FTTB 2Z64A 4FHOA 3C6OB 4BV4R 5ICUA 4XGOA 4BSSA 1O6VA 4KNGA 4M7EC 3W3MA 2R9UA 5B0TA 4J4LA 2Z66A 3WPHA
chains in the Genus database with same CATH superfamily
3OKDB 3A6BH 2BOCA 3OKEB 4JJHA 1CE1H 5I76B 4F2ME 3O2VH 1CGXA 1HEHC 4PLJD 4U0QB 1VPOL 1A3QA 2PWDA 4AYEC 1RIUL 4WEBL 1KB9J 3VXSE 4H1LH 4YHKH 2OL3H 4E42B 2VDLH 4BELD 1FH2A 1NSNH 1KCWA 2E7BA 1AR1D 1JGLH 1CE6A 1PEZA 4PSPA 2F18A 4FMVA 3BZEB 5AWCA 1C5BH 4L4TA 5ECGA 5CILH 3DX8B 4FQXD 1N67A 5EUOE 3MRJB 4KDWA 3O6ML 5F3HB 1XGQA 4YSSA 3CFEA 1EAPB 2ICCA 2DPKA 1GVIA 3Q2LA 3KCWA 4L2LA 4XHQA 2Y1ZA 5JHLH 2IPTH 1TVDA 3QA3A 4NO0B 5LNGA 1CR9L 3U46A 3NJNA 1G9HA 2YHGA 1GWBA 1G0XA 2XCMC 1WFMA 3KLAA 4LPVA 4MSWB 4FEMA 5EU6A 5FHBL 1E5CA 2O5XL 4PJCF 3M18A 1QLEB 3UIZA 2ZXQA 4IGBD 3GHEH 1BQ5A 3HI6L 4KHXL 4Y2DC 1S9WB 5BQ7B 1EPFA 5SX5H 2OMNA 4RFNB 5F7WC 2VR9A 2VDMH 4H88L 5B7MA 3EYOA 1PQZB 5JHMA 4WO4D 1MCNA 3S88L 4KHTH 4UDTA 4WP6A 1M1XB 1UOWA 3OXSB 4GKNB 1J5DA 2X40A 3NJVA 2VABB 4XOEA 4MNQA 4X98A 4ZUWA 3BW9A 3FUIA 1QA9B 1IBHA 2BY0A 3N2JA 3GS4A 1X6NA 1KXTA 1WJ3A 5CMAB 3T71A 3O4LE 1S9WA 2E8YA 1NGYB 1FGVL 2X9WA 2E7DA 3CH1B 4JG0H 1FAIL 2LLGA 5I18H 4ZOBA 3AM8A 2C9SA 1DJXA 3H3BC 4JFPB 4J3OF 1CWVA 2XZCH 2LGNA 2DEXX 1QNZL 5IMOB 2Y1VA 4HKBB 1DBML 3EYVB 3MGOB 1YYCA 4YGVB 3CFDB 4P9HL 2F5AL 1KY7A 4HC1L 4UILL 2EE9A 5FDYA 4ZS7L 1V3MA 5H2BA 2E7MA 4B9ZA 1FBIL 4XO5A 1XGQB 2ZF9A 1K3ZA 3U82B 1OCWL 1T2JA 4MXVE 4O51A 1LP9A 4BFJA 4LCYA 4JFQB 4ZMLA 4QRPE 1MJUH 4RX4D 4NQSB 4RAVA 1CE6B 1I1RA 4C56B 1U8KB 2IFFL 3BMVA 4L0PB 4XNXH 4YK4C 2BY3A 3LH9A 1P4UA 1TJHL 4EUPA 1E43A 2O1AA 4TVPE 5GRUL 1NC2D 1U8PA 4MJ4A 3C75A 3S3CB 3ILQD 3NMEA 1NBZA 2K9UA 3NCYS 4LEXH 2D7OA 3V0HA 1IC5H 4A6YH 4LPCA 1RIVH 3PGDA 1RUPH 4Z0BH 3TC9A 4KVNL 4QXTA 3RHWK 1KPVA 2X70B 5D7LD 3OKLB 4IM8A 3KEDA 3HC0A 4E2OA 1FFRA 2HB0A 2OAAA 5LQBH 2KZ1B 4P5TA 1NCBL 3VVWA 3IE4A 5IQMA 3UL4A 3NJKA 3BO8B 1CG9A 1ASOA 1H19A 3CZEA 2XZAL 4A63A 1UOLA 2XA8L 3WIIL 5KVEL 5IW6A 3KLHD 2BSCA 3WXVH 4DJMA 2XXGA 3K4ZA 5ELIA 5C97A 5HYQB 3LHAA 4LHUB 4JZJA 1HOCB 3EH3B 1PX8A 4AQEA 2P42B 5I18L 1MCQA 2P5WA 1D5RA 4RMUA 3L17A 2IOIA 3ZE0F 1ZGLB 2V3DA 2KERA 5FUZL 2CO6B 4N26A 2Q8BL 3KM1A 2JKJA 4LARH 1U8IB 5J9PB 1EFXB 5ISZD 3V0JA 2DIAA 4P46D 1N7MH 5K59E 3VXRA 1EO8L 4K9EL 2FHFA 4EZKA 3GBEA 2VJ8A 1W8AA 4CNCA 4N5EC 1U3HC 3RGVD 3X12B 1WEJH 4APQB 5I1AA 3P9MB 5CJXA 2ZWSA 5CJOL 1KACB 3NGBC 3O6LH 1NC4B 5E8NA 1P1ZA 4IBLT 4S1SL 2B08A 2WCSA 3F7YB 3UJJL 5I30H 3GHEL 5CCGE 3D39B 3FU0A 3O45A 3K2MC 1DVXA 3CWGA 3G6DH 4OUUA 3BP7B 3C5JB 3ZQ9A 3HUJA 3QC5X 5D1XD 5CXPA 3TYFA 3FQ1A 4WV1C 5C71A 1BMZA 3MRGA 4BKLA 3TBSB 3NRPA 4OCYH 4OF6A 4MD0A 4QTFA 2HTLC 1AZRA 1W72B 4MHHI 3MUGB 5K9QG 2IQ9L 3AG2B 4PGCA 1SNRA 4B9FA 1CDJA 4OD3L 2HP4A 2JE0A 5EN3A 1Y7VA 3UL7A 2BFGA 1R34A 1E2ZA 1BLIA 1BIHA 3LEYL 4KO9A 1PZAA 3KDMB 4LE8A 1EEZB 4KRLB 4JO5A 1MCOH 3QUXD 1A6ZA 3ARPA 4MS8D 4BD4A 3Q1EA 3INUL 2P28B 1AGBB 3HZVA 4AGLA 4YVNA 2Y7QA 3QIBC 4I13B 2DMGA 5FKAA 3V6ZA 5GS1C 2R2HB 4OZHB 3O4LD 3NPZB 5DVNA 2OMXA 3RWJA 1DBAL 3RLSA 5KVGE 3EFDH 5AW2B 2R51A 2UZIH 1RJLA 3LH8A 4DNLA 2PLTA 3NJFA 3DX9A 3AJ7A 4AQEB 2XN2A 3K2KA 1LP9E 2ARJQ 2AQ1A 2NYZA 1NIAA 1J9RA 4IKNA 1OTUC 1CLZH 2IQAA 4JM2B 5TD4A 4AQ1A 4E9WA 5JNYB 1U8LB 2ZTBA 4KTYA 4U2YA 4EI0A 2WXLA 5F7EH 1RVFH 1RP8A 2PTUA 4NERA 4N86A 1GGBL 1CZ8L 2O30A 2DI9A 5FYJL 2DQTL 2OXHA 2YUXA 3O2DA 4G43A 3U7YL 2G5BA 1EANA 1JPSH 4GNKB 5C7XL 1XH3A 3EF4A 4HQQH 4XMWA 4OCWL 3BUDA 2BSTB 2AP2A 2MWCA 4WENB 4AQAB 2M8XA 7FABL 3QQ4B 2ZWLT 1UJ3C 3PDGA 1OQOA 2DJUA 2H1PH 3FB8B 3PIQB 1RZJH 2IALA 3BKYL 5KS9B 2J8UB 4K8RH 2VZVA 5EULV 2WWMC 4M02A 2FX7H 3EBHA 5AYQA 4YPGA 4GAJH 3ZKMD 5C0IA 2WQWA 4FFZA 3MRMA 2UYLB 3QP3A 4GW1A 1BEYH 4LCWA 5DO8A 1KLGA 4FLSA 4PVNA 2ISDA 3T65B 3ZR5A 5CR8A 2P7TB 1O9WA 3FQRB 1WBXB 3F5WB 2I85A 1OAZH 2NR6A 4LL9A 1FFNB 3V4UH 5L8JB 1HZHL 1YPZE 5TGBB 3PWVA 5BRZD 3DO3A 2X4QA 3RVVC 4GG8A 1BCIA 4FQHB 1T1XB 3BAYA 2DKUA 2VRAA 3TIDB 2KLSA 4BDVA 1T83A 5IB2B 4U1HA 2NY6C 5LGHL 3AS0A 1NOAA 1CMOA 3VG9C 1GKOA 4IBWA 5BS0A 2FJUB 1A8JH 4UM9D 1WBXA 4GT0A 1XIWA 4H8WL 5HGHA 3IDYC 4AV0A 1MCOL 2EIZB 4OV5B 3I85A 3DC0A 4FGMA 3VSUA 5I0XA 3QUMA 4NZRM 4X7SH 3OMIB 3DTUB 1IEBA 3F6IA 4X5XA 3V6ZB 1R0AL 2Y6SD 3MRCB 4JFFB 2Q3XA 4PPTA 1NBQA 5E6YA 4RFEA 4XNQA 1IGFH 3ZO9A 3BQUD 3BT0A 2OMBA 2PR4L 2W92A 2VXQL 3WIHL 4J23A 3HS0B 2QGDA 2Q3ZA 3IK2A 3EUUA 3U7AA 4B5ZA 4KPHL 5KYWB 2ZUUA 4XN7A 2EO1A 4O2FA 1OAUL 3LN9A 4YJZL 1AZVA 2QVMA 3NP3A 4ZQKA 5TE6H 5G5DB 2OSXA 5C0FB 1AC0A 5DURB 1PZ5B 5LDSA 2A77H 3VFGH 3FQXB 3QFJA 1N68A 3HBPA 4L8SC 1U95A 2UY6A 3C5SB 2NY5C 4AKPA 3SDXA 4ZTOL 5C0EA 1R6VA 2FEJA 1QMUA 4ZJ9A 3H0TB 1S3KH 3Q6GL 1TTFA 4KKBC 4K5MA 5SWSB 3MYZA 5IJDC 2K45A 5CD5C 3ME0B 4LLVB 5MHSE 4AY0A 3HRZB 5DMGD 4NN6B 3VFOA 2JJSA 1EHLH 3DVFA 2R69H 1N7ML 4GSUA 4PW9A 3UEQA 3ARBD 3T1FB 2IWGA 4P3CH 4LDOB 4QUOA 4YHLH 3L1FA 4R2GC 3BHBA 3UBXI 2F9BT 4NPYB 4N9GA 1RZKH 1YAIA 1F56A 3GMQB 4Z7VE 4JFDB 2PCYA 2VWEE 2CA3A 3NGBB 4LOEA 5I1GL 4UDUB 4R6JA 3VCLA 4PR5A 2NTSP 3SDDD 1YEFH 2LABA 5DUBB 4DH2A 4NHUB 1IL1A 3RILA 5IVXA 5M95B 2DD8H 4IU3B 4JNXA 5TDNB 3VXQB 5L88H 3S34L 3MCLH 3FS9A 1OE1A 5KJRH 4NKIH 1KLFA 4LSVH 1UASA 3H6JA 4IMKC 1SMAA 4FFZL 4ONHA 4FERA 3ARDD 4N6RB 2R8SH 4JN2B 2PMZA 3AROA 1INDH 3UTSB 3AY2A 3K6SB 1BF5A 3CNKA 4R4FH 5EZLA 3KLDA 3P9LB 4G8GE 3X1GA 4ZFFB 5I1JL 2BRQA 1AO7D 1KJVB 1L7IH 3LX9A 5DJ2B 5DZ9A 2FSDA 3T3PB 2DDQL 2QJDA 4HIJB 4AC4A 3ARQA 1OTOA 5DS8B 1FNGA 1R19A 2IWFA 4YR6B 1D2OA 2XVLA 1UACH 4ZS6D 2CJUL 2WKLA 5G4NA 5JHAA 2BNRE 3ULAB 4XNXL 4NQTA 3ULSA 5SWQB 4XX5A 4MDRA 4OFQA 3ZXAC 3KPSE 4O2EB 5T5NF 4QJ5B 3V4VA 3K8LA 2IGLA 2EILB 4JAMA 3GMRA 3DSFH 4N3UA 1MCWW 4LDCA 1DVUA 4WWID 3KLQA 5A7BA 1XTLA 4H25A 4NP4L 4P59L 4ZO7A 4PS8A 4XNYL 5DDHA 3LZRA 3QJRB 1KEGH 4HFUL 3V0WH 3GMNB 3WL9A 1G6RA 1J9QA 4QYOB 3ZPDA 4N0FA 1MPAL 2WWKT 4J4LA 3CH8A 1RMFH 5EPMB 2BVOA 5FAAA 3QWNA 3EGSA 3LZOA 1CFSA 2N1KA 2ITEA 3AT8A 3PJSA 4HUUB 5KSBF 2BP0A 5JMOC 4Z3GA 5DRXB 1G7IA 5TDPA 4Z3JA 3JTSB 4Y5VA 5CGYD 5KN5B 3ARDC 1N6VA 4QGYA 4F7TB 4AOFA 1KGXA 5MP6H 1M6UA 1OTSC 2EXYD 2WUCH 5FYLD 3QZWG 5HHOD 2APBA 4PB0H 3EH2A 3OKMB 4EBQL 1S7QB 5GS3A 5L4MA 2EDEA 1WWBX 3QHZH 3BGFC 4Y19B 2NPLX 1DL7H 2Q6WB 5ECJE 3L9RB 2HJLB 4P4KB 2OR8A 3D8MA 4TQPA 4P2OA 2W9EH 2VXQH 5F6IB 4UUJA 1AXTH 2JCCA 1A9EB 3G04B 4HUXB 1HCZA 5FYJU 4DP1X 1A65A 2DWEB 5FO8B 2FBJH 4PGDA 3OHXA 4KV5E 2KL6A 1WAPA 3GXTA 2WXRA 4N0UA 4BUQA 2QHLA 3JV6A 2YRZA 1A4AA 1XMWA 6TAAA 4MMXC 1R5IB 2BHUA 2VISB 1MCRA 4MXVF 5HD8D 5CZVL 5FGCB 4QOKD 2YWZA 4WQOA 4A2HA 4E9TA 5AL0A 3FO2B 5CBAB 3NJXA 4UM9B 5GSRA 3NTCH 5JPNA 3EIFA 1BOYA 3FU5A 5E1QA 2G2PA 4WTXA 3DDGA 5CSZA 4HOXA 1SN5A 2B4CH 2FYYB 3C60C 4GIAA 1UQSB 4PYHA 1UM4H 2DH3A 5EBMB 4PJAA 2IGFH 1T2QL 1LQSR 3FF7A 1P8VA 3QQ3A 3E2HB 3P4MB 4QBZA 1CYXA 3KBEA 1HQRA 3WFHA 2BRRH 3A4DA 4U7LA 5KUKA 1HZHH 3FRPB 2Q10A 4AYGA 1X7QB 5DCCA 5F0JB 3X1EA 2XKNB 4C58B 2WQSA 4NKDA 3QUZC 1ACYH 2XQBL 9CGTA 5FIEA 4G82A 3S5ZA 4AE0A 1RJCA 4TVPD 3TJHC 4C8XA 1R5WA 1TTGA 3UG4A 4LCIH 2HG0A 4PMFA 4R6UA 1CLVA 2NXZD 2WWNA 2XN9A 4MBRA 4LSSH 4K7FB 4N0YL 3JVGA 3VSQA 1G1CA 2FIKA 1LEKB 3MRFB 3SDDA 4Z7UB 3VRJB 1ETB1 3L16A 4NHCL 4H09A 5CCHE 2CK0H 5JIDA 4FNLL 1KCSL 2ENPA 1S7VA 3C5XA 1E27A 4MQXD 2BNRB 2C1PA 4G6MH 3ZDYE 5HD8C 1NAMH 4L1SA 2AKRA 3UO8B 3M19A 4IBYA 3M17A 3EJZD 1X3DA 3DURA 1VRSA 1UYWH 2EO9A 5CINH 1FNLA 3P30L 4I1RA 4L1TA 4CBPA 5T1DH 1H3XA 2V9TA 2PCXA 2XJKA 4KKNA 4BSUA 2DQDL 2HVJB 4FI8A 1B90A 4M48H 3MDJA 2XIDA 1B6UA 2QR0A 4RWYH 1MEXL 4FQXA 4FNRA 4QDGA 4XO3A 5KJ4A 4HALA 1F58L 3EFFA 1JGUL 3HBGA 5FYKE 2CZNA 3G9VA 1K9TA 1AGCA 3CBJB 3A4AA 4G1MB 4YXHH 2F58L 4X8CA 4YK4B 2FQGA 1D5IH 1VJSA 2EXTA 2DQHH 4YFDB 3VX0A 1JFHA 1JF1A 2VKXA 3QSKB 3LKRB 4GKLA 3H2PA 2GJZA 4A7GA 1VLXA 5L2JA 1FG9C 3QAQA 1GSMA 43CAA 3NFNA 4GW5B 4ENZA 2C1OA 2YD3A 3IETA 4TSCL 4J6RH 4DW2L 4ZAKD 3LQZB 4I6JB 3QJUB 2J3SA 3APFA 1A1NB 1YJDC 3BDYH 1ADQH 2YQ2A 4HWBA 2OJ1A 2FEDC 4NIKB 3T4AC 1TSRA 4PRBA 2OMTA 4QTIH 2B77A 4CC1A 3RHWF 1D5XB 4Z3FA 1G1OA 1MF2L 2PPCA 1X7TA 2G9KA 1M3JA 2WYIA 3C08L 2XOTA 1PZ5A 1INEH 2CDGB 4ESKA 1XGYH 5JQ6H 1TCMA 1XL6A 5GS0H 3T6WA 1AHWB 2ZOOA 5FYLL 2VMEA 1ZEAH 3NJMA 4KK9D 2HKFL 3S96B 1A66A 3L54A 2JJTC 4POZD 5IG7B 4H8HA 5E6IA 3WKML 4AM0A 3MRMB 4P3DB 3FAWA 3TCTA 3O3EB 2I9LB 3SE8L 3TT1H 1SQ2N 1WP6A 2OMTB 2YPLB 1GC1L 3C2AH 1U0ND 2YN3A 2IIJA 3F01A 5CHNA 2Q9OA 4UIMB 3FB8A 3FOMB 4Z8FH 3E6JA 1AR2A 2YR3A 1T22B 1XZ0B 4ODWB 3THMH 1J0HA 1G94A 1I8AA 4ZMPA 5IEHA 3FTWA 2EYRA 3QDAA 4Q6IB 5AG8A 3CFNA 2PYEB 3HLAA 5E8EB 2YXMA 5EOTB 1T04B 3NG5A 2MHAB 2OZ4H 4WHTB 4F8LA 3G06A 1EO8H 4FI6A 4GRLA 1V7NH 5AOKA 2FGWL 3MRHB 4A7UA 3EFFB 4U1JB 4FQJL 4Y16A 4CDHA 2Q8BH 4TF4A 1DCEA 3RKDD 3KL3A 3BQVA 2XBTA 5HZLB 1A6ZB 1OGSA 1TKWA 2WINA 1KFAH 3SJVD 1E3ZA 1IBZA 5F93C 4NRYA 2EDLA 4KX8A 5JW5B 4OLYH 3PGFH 3L5XL 1E8WA 4P2AA 4FDWA 1S6NA 2MNJB 2R2HA 3GO1H 4OZHA 4N5UA 5H8DA 3QIUC 3MOQA 5DJ8A 3BGMA 2VMFA 3DROB 3RAJL 5A2BA 2DQJL 1GGCH 2ZCZA 1F8TH 4KKAD 3TWYA 5C0AB 3T0DA 3NSJA 3P3TA 2AEIT 4Y4KC 4LCCA 1R3HA 5MERA 4JPIB 4DUXA 1FH5H 1T03L 2BNHA 2IAND 3K71A 4JKWA 1USQA 4OJYA 2KLTA 2DQIH 3ARDB 3LV3A 1WA1X 4WKZA 1I4FB 3NIFE 1AR1C 2FGZA 4UQIM 3RL1B 2GABA 1BQHB 2AQNA 2D7NA 2DQUH 1CGUA 1W6LA 4FHJA 4JKKA 1OAQH 4XMPH 1VERA 2CIIA 3TASA 2FO8A 2VSMB 4BKLB 1CXFA 4QRFA 1H6TA 4DP4X 5HDOA 1KJ2L 1V05A 3GEFA 4R7NA 4R8WL 1N4XL 3PE9A 3KLHC 1MHPH 4XNUH 4ARNA 4G9FE 3SBWC 3U25A 4ATTA 3QWOA 2V9QA 5A6MA 3P0VH 1HIMH 3MRDA 4AIOA 4DPRA 4ZS7H 4PJ9B 3W3KA 4BSRA 5ETUB 4P2YA 1HWHB 1XF3A 4PJHA 4X99A 3ZQXA 3G7TA 4HG4J 2N0MA 1E6OH 1X5IA 5F1KC 3TURA 1UA7A 4KRPB 4QLWA 1D7FA 3B5TA 1QFHA 2EDJA 3CK0L 1B0IA 2FSEA 4FA7B 4DKFH 1EDHA 2NNCA 2HN7B 1T6VN 3L5IA 2XQYG 4PW4A 4HWZA 5IJVA 1KZYA 1NGWA 2HN7A 1KTRL 2P8MA 4MAUH 1KGCE 5F8RC 5CBEA 4I48A 5H94A 3ZKND 1Z5LB 1BMWA 4ELMA 1IAMA 4JB9L 2VLRE 1FFPB 1ZT7B 4H1LB 4QGTA 4QHLB 4WI3A 1L0QA 4YHIA 1P4BL 2C9UA 1BD2B 1DTUA 1S7SA 1XF3B 4WK4B 4PJ9A 3VYPA 5D5MB 3S88H 3PQYE 2AEOA 3WE1A 1QASA 2N0KA 2EIEA 3IKCB 3SKMB 3JWOH 3QUKB 4HXBH 4M56A 3KPRE 4HJJL 4R90H 3G6AB 3ZMRA 4QWWC 1REIA 5L2KE 4A68A 1AI1H 3BUQA 4FTDA 4CJ1A 1ZXQA 3TCLA 3JTSA 1O9VA 2IDFA 4Y5VB 1YEEL 2LFGA 2NY1B 5DZNA 2XV6B 3RNKA 3BAWA 2HTLD 5D1ZD 1GSKA 1MOEA 2WLHA 3G5VA 5LFNA 4OIIH 5AWDA 3MJ8A 3HCVA 3FULA 5ICYA 3OC5A 3DGGB 1BLNA 1H5BC 4XPHL 4UYQA 7TAAA 3TO2B 2Y5EA 3WPHA 2XACC 3LKQA 1JDAA 5AKVA 1E6JL 2WP3O 3EO9H 1G6RH 1L9QA 3IFNH 1P1ZB 2ESVE 5F88B 2L7EA 5JHLA 4KI5E 2C3VA 3GSRB 5F1NA 4I2XA 2XFXB 4R97C 4YEEA 2GVYA 5FA4A 1ZIAA 2OL3B 4C59B 1SGKA 4WW2B 1E3XA 4XXCA 4EZLA 3IJSB 3TLRA 3D48R 5MEOA 2G60H 2XLLA 2FSEB 1DQMH 5T5FH 3SDCD 1XWDC 4MQWX 2DQ6A 4M03A 1JXDA 2B14A 1X5KA 2Z7WA 4LQFH 1T5KA 1QSEA 4GAFB 2WKOA 3H3PH 3FU8A 3VWJB 5JLZB 1VPOH 1Y1UA 1K6QL 3WIAA 4XVTL 4G83A 3L08A 3V8OA 5C1MB 4HWEL 2IAMD 4OGYL 3OXSA 4GKNA 4M7LT 4V1DE 3SPHA 1YQVL 4X83A 4TNVF 3P11H 5DUML 1FNFA 4QO1B 3EKCA 4YDJB 1J5HA 3QAZC 5K9OB 4LCWD 3TIEA 1HKLL 2ZP8A 5BQ7A 3FN0L 3VXUA 4H8QA 4P5TB 2CNYA 2R1YB 3Q06A 5EBLA 3EJCA 3MV7A 3T0EC 1Q94A 2PXYC 3BZ4B 3CDZA 3CZFA 3D9AL 4GLRH 4QRSB 5C09D 1OHQA 4LKCA 4QY8A 3DX1A 4UDTB 1SLVA 2FT8A 1BQHG 1UD5A 5HDRA 1CTNA 1MG2C 3VG0L 2DS4A 2CLVA 4RGOH 3RIFK 1DJSA 2G9HA 3VXMA 1AOZA 2ICWB 3F6LA 3JBG7 1DDTA 1R3KB 2Y69B 4NQDB 4RWTC 2NY5H 1FWXA 2GHZA 3KW8A 3BP4B 5DT1H 2WUBL 3GSNL 5IG7A 5HGGS 4DKAA 4FYRA 3KVQA 5DRNB 4W9CC 4Y19E 4UQ2A 3KGSA 4R7VA 5D4QA 3FQXA 4LFHD 4OKDA 3SPGA 3MMEA 3ARUA 4QY8B 2XPGA 3MREA 3OPZL 3HJEA 3E3QC 2VW7A 3L2MA 4NNYA 2MRYA 1KN4H 2DQIL 4N2OA 4XP1H 1WITA 3QK0A 1JTOA 1ZLWH 5GRYA 1WCBA 2Y36H 5KANI 2WXHA 2HX8A 2IPKA 4X4MA 1S78C 2OKMA 1CBVL 3EG9B 4XTRD 3WFBL 4FOMA 1GGCL 2LU5A 6FABL 1MI5A 3O4LB 1MIEL 3N85H 5EF2A 5DD6B 3X17A 1BYPA 2YIHA 4LVEA 1UJTA 4BZ1L 4OLYL 2J5LB 4ANVA 2HT2D 1NEZG 3EHBB 1KFAL 4ECNA 1GS6X 3X13B 5F7AA 4YSCA 4ZFOB 1H8OA 3QUMH 2TRYA 5E03A 3NZHH 2V7NA 1MH5A 4QLRA 2I27N 1F90H 3MJ9L 4LP4A 3JWNG 5C3LD 3QYNA 4UTBL 5K9OA 3B2VH 1T66C 2ZE0A 4ODSL 3D0LB 4OLUL 4TQ8A 5DD1H 3SPVA 5IOPA 2EVIA 4GKOA 5FXCH 3BH8A 3QORD 4UIKH 5EV7A 3FUNA 3F6JA 3GSXA 1ZHBA 2WTRB 4DGYL 1AGFA 1GA2A 2AVFA 1GYVA 3CVHA 4KUZH 4P2OC 4UIKL 3IJ7A 3MKKA 5ILTL 3KR3H 4Z78B 3H54A 5AB1A 4JKMA 4LBEA 3LRMA 4TNWF 1DEEA 3UEZA 1A7PH 3CHQA 4HF5L 4IKIA 3RFEA 4NN5C 2RFXA 3SGEH 1F6AA 1PCXA 2B59A 3U6RB 1IX2A 3LKPB 3TT1L 2R56H 3SE8H 1INQB 1NMBL 1JF5A 4G3YH 3SD2A 4OD1L 1JV2B 2C1OB 5I0YA 1KIQA 1H3PL 43CAB 4BZ1H 3DTDA 5DK2B 2ED7A 5DVOA 2PUQT 4HIQA 3TO4A 4RCAA 3T3PF 3RNQB 3VXOA 1KJ3H 5C86A 3HFML 1FRGH 3WN5B 1INEL 2A9AA 4JFZH 3OKKB 2JE8A 3I50H 1DVYA 4MX7A 4NO5A 3WFHB 3WNJA 1CBVH 2A83A 2H6UA 3V6OE 1J1PH 1G7PA 2Z93A 1ZLSH 4ZMXA 5CZXC 1SY6L 4XI5C 4URKA 3IJYB 4A7TA 1KTBA 1NEZA 3RWCB 4K94L 3UGXA 3BP6A 2OMYB 3B7RL 25C8H 2P24A 1XAUA 3ROOA 3BC9A 1PG7X 2YJLA 4NPKA 5E9DA 2X4PA 4BGLA 2YOCA 5JW3L 2CHWA 2F2HA 3DYPA 3MLSH 3S37L 5IMMA 3HB3B 4XE0A 1CXKA 2PP8A 5L2KD 3OV6A 4GXVL 3UROR 3GJFH 3VXPB 4KDTA 4BA8A 1SDDA 4JVPA 3DX3A 1AACA 2H3NB 5D1QE 2VDNL 4OZGE 1U6AH 1HOEA 1S46A 1EO5A 5A2JH 3SQOH 3A79B 4GH7B 5ESQA 4EI5B 4YHYB 4M9PA 4ZS6C 3D25B 3FCTB 2R29L 2Q1EA 4GQ9L 2OMYA 1ZVSA 1OWRM 4K55A 4R26L 1EGJA 3HHMA 1WAEA 3QG6A 5EOCL 5DLLA 3VXQA 4PU2A 1SLWA 3WJJA 2X3AA 1WTLA 4Y5YA 4LAJH 1TJIH 5KVFL 1EXGA 4U33A 1HHIA 2VW6A 4H26B 2X38A 2DB8A 3MROA 5AW7B 3OB0H 4P5TD 4A7QA 3TA4D 4DZBB 4JRWA 3ZHLA 3TZVD 5BV7L 3V0IA 1NWOA 2MNUA 4JE4B 4B27A 2JJWA 3MJ8B 5ISZE 1FZOB 1I8IB 2R0KL 2APTA 1T0NB 4P05A 2DYRB 2DL9A 4YNYA 2XNAA 4PY7B 1IGYB 3WBDA 5FLVA 4WHYH 4LOFA 4YDIH 4LZKA 1K6QH 1FNHA 5CN3A 3DROA 5L0QC 5CO1A 5H4ZA 2CLZA 3T08A 4KZDH 4Q9QL 4F9LA 2WJ7A 2N7BA 4JFDD 4Q0XL 4NZRL 4CJ0A 3GIVA 1RUKH 1JVLA 1DQML 4Z79A 4JPWH 3RTQD 5I5RA 4QRRA 4KKBD 3K8KA 4X9IA 4IS6A 1HNFA 1RPKA 5BV7C 2YOAA 4MBOA 3SCMD 1NGXB 4GMTH 1ETZB 2IGFL 1KUMA 1ZD6A 2L7JA 2OR9L 2W9DH 3VM7A 5E8PA 1WC7B 3WPCA 4YLQT 1YEDA 1JHKH 4TNEA 3SPIA 1FIGL 4W6XB 3Q7JA 1HCVA 1MZYA 3BFWA 4AKQA 3IU3A 4Y61B 3MRCA 1LE9A 5BRPA 4N2FA 3OGKB 1UG9A 4RMQA 1KJ2A 3HLAB 4XN1A 3MX0B 5CCJA 4MXQC 3IXAB 2YSTA 4KTGA 2R83A 5C2BL 4PJ7E 3ULUH 1NC2B 1Q0EA 2VDKH 5DMKA 5I24A 5KYNA 4W4OC 5IQLA 3QWOB 4KI5D 3REVA 3FKUS 4U1KB 2MIZA 3FCSA 2GTZB 2I26N 1ZK9A 5GS2D 4BWUA 5JTWA 2VH5L 3SBQA 3SCMC 5DZLA 4AMKL 3ZKXB 3TIDA 4NHUA 1QI5A 3ZHNA 4LU5L 4KNTA 1WAAE 2YMXL 2W9EL 5C07E 4R5VA 2Q86B 3QDJE 4OZFG 5C0EB 3RW7A 1XCTB 5AYUH 3UC2A 5EWIH 3MV8D 4GAGL 5HJ3A 5CMNA 1JZ4A 2IDQA 4QXGH 5J11C 2BCKA 4WUKL 1JTPA 4YHPB 1MAMH 1SOKA 3EADA 1G9NC 4GBXD 4PJ7F 3RTQC 5KYWA 4F33B 2B7DT 1JF6A 3K71B 4HKXB 4DKFL 3DUSA 3W11C 3DBSA 2DIEA 2JCCF 4H8UA 3P4LA 2A6JA 4EO5A 3QRLA 4MA3A 5F1OB 1O7DE 4KZDL 5G4MA 2CJSA 3SDXB 3EJYC 5HY9A 5K9JL 4XBEH 1RMFL 2H5UA 1EIBA 3QO1A 3FO0H 1HIML 3SYCA 4K3DH 4H40A 3ULVE 2UUDH 2VR7A 4HFUH 1E7VA 5EZLB 5T1LD 2VLKB 1MHPL 4XNUL 4AI7A 2OMZA 4X7EC 4HJ0D 4XGZA 3S2CA 4R8WH 4M8VA 1ZV2A 1T4KA 5B1AB 3UAJC 3GSVB 1XSIA 1OARL 4R5TA 1CQYA 1G7MB 1OAQL 3D3VE 3O3BA 4PJEE 5J6HB 1NCOA 4KFZC 1ZVYA 3VFUB 1IL1B 4KNUA 1L7TL 3ARFB 5FEBA 2XIIA 4OJFL 1WFTA 5AEAA 3QDGD 3CVDA 1MHCB 2I60H 2VGLM 3BZDA 4G59C 5LG6A 3WE6A 3ULVA 3FYIB 2FB4H 3DLQR 1EZVX 2D0FA 5EF1A 2GEQA 2H0PA 5D4JA 5FM8A 4MNQB 4BFFA 3DURB 3BWAA 4LLWB 4AK1A 1JG9A 4MNGA 1CGSH 3N1MC 2JF1A 3CSTA 3TFKC 2R4SL 3L5WA 4X9GA 2C9VA 5DQDL 3DBXB 3N42B 2Y7QB 5AVYB 4BZ2A 2DKSA 5D2NE 5KYYB 3QFDA 1WO2A 3C8KA 3UBXA 4PJIF 3Q2VA 4X4XB 4MQ7B 4FNPA 1HXMA 4CMHB 4Y1SA 1HSAA 4MTMA 1E3FA 2WNGA 2QHRL 4CDGC 3D30A 2OMWA 2J8HA 4JEGB 3UCRA 2KDGA 4BUGA 2RD0A 1RZKL 2UZYB 5FYKH 3ETTA 5HJ3B 5F7HA 9PCYA 2E9JA 2IDUA 2C4FU 4GKZB 1NANI 2IGTA 1R3KA 1J1PL 2NY0B 3C9NA 2XKNA 3G5VB 4P57B 3UP6A 2ICWA 5GPRA 3WD5H 3GF8A 4CRPA 2W38A 1B4RA 3APNA 1GTFA 4MA3B 5KYYA 5ADOH 1J9SA 4AUJA 1E7UA 1A7BA 2VOTA 4H2AA 3TCXA 3U0TA 4F5CA 3JTBA 1KIRA 4QHPA 2X4TA 1ZRUA 4HGKC 5D1QD 4BFGA 2N01B 1CLOL 4LOUD 4X4YA 2JK5B 3T0AA 3DO7B 1MKFA 4ZTOH 3ETBJ 1OGTA 1TTBA 1IO0A 4QKTA 4WI6A 4XZ4A 5EDXA 3KWUA 3Q2NA 1Z3RA 3ZE0B 4DN4H 3C8DA 2YAFA 1WZMA 1ERNA 3KPPB 3WE6B 1JERA 1GGIL 1IFRA 2E27H 3WAKA 3SOBH 1S7UB 3GXUB 1GHFH 4DKTA 3ALWA 3MRPB 2CRMA 4EZMA 4J3OD 3VMNA 3WIHH 1CXIA 4LLYA 5LO7A 2HJKA 2WBJB 1IE5A 1HAWA 5EBMA 3MLYL 1VFOA 1AQKH 4AX3A 5JA8B 2QR0B 2R4RL 4N8PA 3BAJA 4NM8L 1A1MA 5FYLH 4HV8B 4UUJB 5GGTA 3MGTB 3RE0A 3GRBA 5DZOA 4JRYB 5CEXB 3BH9B 2B1HH 4R83A 3WO4C 3UBFA 3HOGA 3PAYA 4W9LC 3FSZA 4I1NB 4H8WH 4Y1AD 2H2PC 2G3ZA 5IIEA 1DUZB 3V6BR 4FQIL 4I0PC 5IHLB 1AGBA 1FG2B 3HZVB 4QHKI 4LRIA 2X0WA 1PZ3A 4L3EE 5D2NC 2H3XC 2KHAA 3QEHA 4PRHA 4ZNEA 2DWEA 3HUJB 5CEYA 1A9EA 4NYLA 4P46B 4LCVA 4PJGB 1I9IL 3TO4C 2HLFD 5CGTA 1VSCA 2HXAA 3OB0K 2JI3A 1OGPA 1VACA 3QR0A 4LO9A 4RZKA 1GZPB 4OFKA 5BMFH 2JMRA 3M7FB 1F6LL 3GMPB 3IAGC 4RSYA 1M42A 2WMPA 4YXHL 3PL6A 1G7LB 3FUKA 4FXLA 5EA0L 1T7YA 3D18B 4NKDB 1OSEA 2JELH 3TJEL 1X7QA 1UWGH 1TYRA 2QFRA 4PV9B 43C9B 1TQWA 2YKKA 4EUPG 15C8H 1Q90A 1E4JA 1CL7I 1SVZA 2DQDH 5D5MF 4Q62A 3LKOB 2EP6A 4UT9H 1FVDA 4HEME 5CJXC 4RA3A 1QWNA 3L8QA 1SM3H 5GGSY 4XT1C 3DX7B 3GQFA 1UADC 4CILA 2NY5L 1H0DB 3R8BB 3RUGB 3CN2A 4JFYA 4ALAC 1I1FB 1KLUB 4M4RB 7FABH 2Z8RA 2ZP9A 4MD5A 1IM9D 1B2WL 2Z8WC 3P02A 3UL9A 1B9ZA 1DJYA 2J1YA 3CQPA 4OT1H 2EXWD 4GB9A 4L3CB 3ARED 2C26A 2PKDA 2M1KA 1DSWA 3NUKA 4NN5B 1G5AA 1ZT1B 2HMID 4QHUA 3S4SB 4R7XA 3T5WA 1QRKA 1DANT 4OFIA 4B53A 3EGDA 5F7EL 1S7RA 5CGYC 4XC3H 4P2OB 5MEPB 1G7PB 1J8HE 4RH4A 1DQLH 5CIPB 5C07D 2WVSA 4HIHB 4QXTB 1IEAB 2ZOWA 3VCLB 4UQDA 3RJDA 1UHVA 4JZJB 4KKLC 2YPLE 4HS3B 4P04A 1IGML 1RUAH 5SX4H 3WNPA 3DPBA 5HGDA 4HUVB 3T04D 4K2UL 2D0HA 4K3JH 4KK8D 4E9LA 4Z76B 5IMMB 1UEYA 1KDIA 3SE4C 2ODHA 3B3IB 1F45A 1CG9B 1SJHB 3FO1A 2I9LA 2NY0D 3FMGL 4OZIF 2CHXA 4HBCL 5E8DH 5GHWL 1M56B 1PX3A 4G8GD 5D7JC 1DQQA 3V95A 4LVOC 3PREA 1J11A 4NWTL 4GRWB 1Z5YD 3JB9j 3ZO0A 3W39A 4YHML 2C7UA 3LRSB 4I9WE 4GFXA 4H13C 4PS4H 3IBEA 5JYMA 3UAJA 4QCIB 2SODB 2D3NA 4OD3H 2QMJA 3IS1X 3V9EA 3STLB 4NN7C 1T20B 4UB0L 3TZVC 3RWHA 2YEVB 5E1HB 2Q76A 4HKZA 4R7DB 3R1GH 2WCPA 3GHBL 5HI3D 4NQDA 1PKQB 1FE8H 2QSCL 3ME0A 2Y72A 1IAII 1JZDC 4XNDA 5DJ8B 5E2TL 4LVHB 2E6JA 1BZ9B 3CDGA 4Z8GA 1NMCC 4N90D 5E8EA 5I1HL 2IH8A 2YFOA 1J05A 1RHHA 2IWKA 3DMMD 2MCG1 1J8SA 3R4DA 2DQFB 4UOJA 4KWUA 4AVHA 3T0EA 3D1MC 4HYTB 4U6HB 3MV9E 1NINA 3ABGA 3ILDA 3O6LL 2W60B 3B9EA 3WKYA 4ELKA 2UWEE 3ARFA 3LD8B 3PXLA 1WHOA 5AVVB 1OAXL 3K6DA 3LIZA 2FX9L 3HUJF 4BK5C 2JKRM 1T4WA 4ZNEE 1I8LA 4K9EH 3HC4H 4GI6A 4GY4A 1EQWA 4DVRL 2WWKO 2H2SD 5HYEA 4P2CG 4ZTPL 4CNMA 4K07A 5D96C 3ARTA 4DO5A 5FUZH 4TTGA 3UZVA 3W2DH 5I9QC 2WCGA 4Z95L 3S3JA 4LLUB 4E5XB 3FOMA 1SEQH 5CGBA 4AENA 3RJOA 5JXAL 1JMXA 2OCCB 1Z2KA 2KQMA 1A14H 1A4CA 2EEBA 3WIIH 5H37A 5ALBL 1MLBB 4RMWA 4KJYA 4Q9CA 1F00I 4W9IC 5DC2A 4P5MB 5LJYH 2JB5H 3QPQD 4OGAD 5E8OB 5E5MA 2H2SC 3ZMNA 1DFJI 2GJ6E 3MSPA 4FG6D 3DETD 4C4KT 1JP5A 5JQIB 4R4FL 2BCKB 3DV4B 3TEWA 5F7DB 3L1EA 1B4TA 3ZUCA 2IAMB 4BE5A 4E42A 4G42A 3MFFA 4KVNH 4ABQA 4G42B 1DQIA 2ZNXA 3WFDL 3S4SG 1CYWA 3S36X 3VI4E 3QEGH 4F58L 4PVLA 4G6KH 4XGOA 4M6MH 4G6AC 4XMPL 12E8L 3DGGA 5B8CA 5DMIH 3EYVA 3GB7B 2AQ2A 4NKOA 2DWTA 3AZUA 4D0BB 5I0WA 3W82A 3FH5A 4GJTB 4R97B 3PCYA 2L7UA 3CN3A 1EDQA 4L4VE 2G0LA 4TUJA 3ARYA 3WTWA 1MSPA 3ZHDA 4ENED 3P0GB 4OT1L 2E4TA 3K81A 1ZLWK 5A16B 4YLCA 5ITFA 4Y4HA 1MRCH 5DJDA 4JREB 4P3CL 4R7LA 3ZZLA 5GS1B 3B2DC 2A0ZA 2XVGA 2ZKMX 3NCBB 1DVFD 1PYWB 2W0PA 2VZ1A 4NKMA 1SJEA 5INCB 5J8OA 3ZOAA 1GMIA 4IK7A 4U4BA 4I88A 3ESPA 3U2IA 1XCQB 1SM3L 1YEDB 4FJ6A 3O9WA 4MA8H 1ZT7A 4H1LA 4YHIB 1C08A 1HX0A 4UTAH 5FECB 1DBMH 4OH2A 5IVOA 2NDGA 4C47A 4PGDB 3MI6A 3OR7A 5IBTH 2VDOH 5FO8A 3HAEH 3I9GH 5LAXB 3KPLA 1OGQA 4FE9A 3T4YA 3AS1A 3N42F 3PV7A 4YHOH 1XX9C 1J9CT 2I25N 3DRTA 3VTMA 4WW2A 5IB3B 4N2LA 4HIIB 3E3QE 5EU6B 1MFAL 4P49A 2WIMA 1LLAA 1WIPA 3L5JA 1I8UA 1KXVC 1BFOA 1MJ8L 1OAUH 3LPFA 4YHYC 3JUZA 1ITBB 4JJ5B 1FF5A 3L6FB 1R17A 2FUTA 3JWDH 1I9IH 3FJTA 2VDMB 4WUUA 3FQUA 5F0PB 1HEJC 2CQVA 1XIWD 2NY6B 1VZHA 2AFNA 2CGZA 3P0YL 3P73A 2J1XA 2EE3A 3WAJA 4JE0A 4PJEA 4APXB 3F7RA 3SEPA 1UFUA 2C34A 3TL5A 3L81A 3IMRA 4Q14A 2N1TE 5IWLA 3KMDA 2BCMA 3S3DB 3HI6H 1RULH 2FEDD 4MKMA 3ZTNL 1KV7A 5DVLA 3SDAB 4DZBA 3UTTB 3D18A 2ESVD 4FN0A 1UKQA 4OUUB 1QTSA 1OAKH 3CCHA 4XVUD 3CDZB 5DD3H 3ZTJG 1N8ZB 1IFGA 1O7SA 3PY9A 2YPKB 5C0AD 3OKDA 3GSNA 1XO8A 1TYJA 1IRAY 1XH3B 1GW0A 4X80H 5T1KA 4X0KB 2TSBA 4MDIA 4APQA 3SGDH 3TBSA 3P4OA 1UQSA 4UYPA 3MA7B 3Q9QA 1OLLA 2P5EB 1BAGA 2JCCB 2K9FB 3G04A 5JQ6L 4NBXB 2Z4QA 3VFRB 4HPYH 5K9KA 1M05B 1MDAA 1OSPL 3ZHFA 4K5PA 1YRGA 3HHSB 3TS8A 1U36A 1IUZA 1VCBC 4CVXA 4LL4A 2Y1YA 3OKMA 4M9OA 4EDXB 3RWDA 3GKWH 1YN6B 2YD9A 4FG4A 1FL3B 4Z18A 4YDLC 2WAHA 2YEZB 1UB6A 4UQ3B 2CXKA 3FHAA 3VWJC 5EEYA 3QXTA 4EZJA 4HEPG 1A6AB 3BDXA 1KEMH 2DTML 3US1A 1CFMA 2NW3B 3EGDB 2JE1A 1U58B 1MCPL 3OLIA 4I18B 2ADFL 2DRUA 2W07B 4IU2A 5TDNA 2E7LA 3WD5L 3IJSA 5DSCB 3FTGB 4XB3A 3VFMA 2EICA 5IB3A 2P1NB 4DGIH 2I9TA 1PJ9A 1S7UA 2JKIS 2H32H 3ZZ1A 3KDMA 3ASWA 2JKTM 4JFDA 2CO6A 1NFDF 2EYRB 4FQCH 4H0LC 3VH8B 4XVUC 3X11B 1UXWB 1ZHNB 3E8UL 3OGCA 4KNSA 3B9AA 4LLQB 4WVRA 5KBMA 5C0JB 2F5BH 1OK0A 5DEGB 4MAZA 3W0WD 4QOKB 4PQ8A 2Z64C 1AGEA 2VL5B 2LTQC 1NICA 5AENA 5T1DL 4PRAA 1J1OL 3P30H 4QRUB 4PVMA 2W0KA 1QLFB 5DRWA 2X2YA 4WFED 1H9DA 2RCSH 2YD2A 3FRUA 2O5ZH 4B95C 5FCUL 2ZPKH 1PY0A 2C9XA 5MEQA 4ANUA 4FLRA 3W5MA 1NUNB 1FL5A 3PABB 4Y7MA 5KSAD 3FSWA 1IKOP 1LP9B 3UCQA 3GMRB 1JGEB 2XBDA 1EJ8A 4WO0A 4Y4HD 1HTYA 3U1PA 1ID5I 4GG6F 1XH1A 5T3ZE 1QATA 4FYSA 2YPKA 3VGHA 2E6QA 4H20H 2P1PB 3EJRA 1TEYA 3QJFA 3INUH 1SBBA 5IB4A 3VGBA 3VDBA 4Y1AA 2FT6A 4JPIA 4Q2ZB 1BXVA 3ULUD 4O2CB 1Q0XH 2J12B 2V2TB 3NCJH 1Y18B 3AAZA 3DI2B 3D4YA 3L2NA 3L9BA 3BPNC 5BO1L 5E5LA 5C9JA 1QRNE 4P07A 2EDRA 3IMTA 4OFPA 4AMWA 3NSFA 4Y7OC 2DBLH 2VUYA 3NFNB 2V2XB 4FHKA 5I1LB 1AHKA 5E99H 4OFYD 3IVKA 2FECI 1XF2B 2APWA 1ASQA 1PKQE 2HX7A 4HLZH 3SE9L 3ATFA 2HRPL 3ZL2A 4MB5A 3BJ91 3U7WH 3OLGA 3BRDA 1WGOA 3RVVD 3QS3A 3HG1E 4ZFGH 5HI4D 2WAQA 2PO6C 3RUGF 3LNDA 2IWEA 1D9KC 5KWYC 3UDWC 1F5WA 1R24A 1V3LA 4BFOA 2CWRA 5TH2A 1JGIA 4FXGB 3IEAA 1BYOA 5D71H 5EO9A 1TQTA 2GBAA 3HR5A 2YAPA 5GGUA 3CV5A 4OJAA 1A8ZA 2YEQA 2FBJL 5DFVC 2EDFA 3BEWB 3T1WA 2XN0A 5KSBE 5TPWH 1PBYA 2JXMB 4HJGA 1YVLA 3AVEA 4M29A 3ET9F 4P23A 2VLJE 3T0WA 2JQDA 2X1QA 5F9DC 4EMZA 4YSDA 4KKRA 2GCYB 3VI3E 1B3JA 2CJ3A 1QSED 5G2NA 4XOSA 1I7ZA 1DQJA 4GMSH 1F4WH 4P3DA 4ZUUB 1HNGA 3QDGA 4PRIB 2A4EA 5I6KA 1SQMA 1J86A 3G6JE 3CX5K 1N0XH 1ZS8A 3WV0A 4HCRL 1WICA 2BINA 5DQ9B 3TN0A 3TPUA 3WHXA 4KQ4L 3QUYA 5JW5A 3PJNA 4AVKA 3UZEC 4XXWA 4ZMYA 1OP3K 5PAZA 3BPLB 4JRXA 1OW0A 1BVOA 2GK2A 2WQXA 5DLMH 1UA6L 1UXSA 4WTZA 1X6LA 4FTVB 4Y16B 5B39A 3F05A 2ZXCA 4P9MH 1LO2L 3GMOB 2JQAA 1TQCC 1KV3A 2C7UB 1E28A 3WS3B 3GXDA 1SYVA 4G70B 4P0DA 3HE6B 3RKDC 5JNYA 3BZEA 1VADA 3C6LB 3REZA 3T2QA 3BDBA 4PRPB 5BS0E 2Y07H 5HDHA 2CR6A 4OKVB 2NY1D 1S8DB 2QL1A 1T22A 3M88A 3N41B 4M5SA 2P3YA 5IMKA 4KRMB 4U4IA 3PWJB 3WNMA 2NQDA 3TEYA 1L4IA 4HKJA 1LE9B 2GW5A 2C7FA 4G6KL 2UYLA 1HI6A 1XF4A 5IKCA 3BQUA 3QCVL 5F89A 3MRLA 2LV4A 4HIHA 4PWEA 2NY4B 1ETZA 2WLJA 4AIXA 4FJZA 1P7BA 1KBGH 3NCXA 4KH9A 1EEZA 2XSKA 5CZKA 3STZB 1O0VA 1W8NA 1Y6MR 4PJ8C 3H42L 3ZDXB 2XQ0A 4Z7UE 2BVTA 5L0QB 4XNBA 4F1ZA 3QDMA 3ASOB 2Y3AA 2JKXA 3CN1A 5BOPA 3H56A 2J8UE 3D2UA 2XZCL 1BVKB 3RGVC 3LD8C 3OAZK 3FB7A 4IMLB 1MI5D 4A7SA 3W2DL 3N3EA 1TOXA 5ICZA 4JY4A 2R29H 2G2RB 1DHKA 1P2CB 1G0DA 2GTWA 2WB7A 3C6NB 1HJBC 2R23A 1I1AA 2GTQA 3F04A 1TQUA 2IV9A 2WGNB 4R3SB 1CF8L 3D52A 5A2AA 3WL9B 1X5XA 3BFOA 4R7DA 3IJEB 2B5IC 2H26A 4GXVH 3QUXA 1AO7E 3B6SA 4L1BA 2HH0L 2ZXWB 1C5DA 4U3HA 5TJWK 1OTTC 2VITB 1C5DB 3OVUB 4WF7A 2IEPA 3GBMH 4G8IA 4PTUB 3VE0B 5CBEB 2MH4A 4JX0A 1N10A 2D03L 2MFNA 4O2EA 4OY9A 5C8JA 2VDRH 5ICXA 5EU4A 4N2MA 3UYPA 4OLEA 3T3MB 4OI9A 1I1AB 5I1IL 4OZHF 4TQHA 3OJAA 3LKSA 3O6KL 1AP2B 4BSWA 1BQSA 3DOIA 4IBZA 1UWYA 4MAYA 3W11D 1Q9OA 1W80A 1WWWX 4RETB 3TJPA 5JHLL 3KPMB 1IBYA 1LL1A 4X5PA 2H41A 3I6GB 5DZPA 3QR2A 2E9GA 3C6SA 5EF0A 2BNUB 3HVNA 4M1CC 3QUYC 2QQKH 5FF6A 4M7ZC 1ZVHA 3DXAD 4QHMA 1R0AH 2JJUA 4PVBA 2R56L 4JRYA 3VI3A 4PJIB 5DC0A 1G4MA 3KBHE 1NSNL 2DJSA 4V2DA 4NWTH 5E4EB 4OQTL 3TO4D 1QLRA 1TPXB 3EFOB 5L7XH 4H5SB 1AZZC 3TWCL 4B9CA 1YG9A 2V17L 2XWTA 3C6EA 4GRLD 4P23C 4UT6H 5EOQH 4I18A 1AO7B 1V10A 2BNUA 2BEXA 1JPTL 3GFUA 5EFIB 1JZEA 5J7CC 4HK0A 2VDKB 2VO5A 3ARWA 4NT6A 4ADGA 3WXWH 2X2UA 2CRYA 1AZBA 4BXSV 4CL7A 5LNEA 1EFXA 3UDWA 2B16A 4GUOA 4PBXA 2ARJB 4FQXC 2NR6D 4KMTL 3BUPA 3GLDA 3IDXH 1E4KA 4TL5A 5DS8A 1ZJBA 3MNWA 1U93A 4ACPA 5SX4I 5FYKU 4BQ6A 5HBBA 1WIOA 3P9MA 1ZPLA 2BNRD 3TTYA 1X5AA 1YY8A 2WZ5A 2IANA 5AG9A 4CGTA 3BKYH 5I5JA 4PEQB 1BZ7B 4WUUD 1XGTB 3BPLC 3WFBH 2UZYA 3UN9A 4HCFA 4JANA 2GK0B 1CI3M 4M1DH 4JFPA 2I7SA 2F19H 3V2AR 3FT2B 4WU7A 5AW6B 2J88H 5EUKB 4O5LH 1IEHA 3Q1SL 3T4AB 3NQIA 3CFBA 4WFHE 3HC0B 4FFTA 5ICUA 5F3BB 1CGYA 4GG6E 5DEFA 3CE1A 5CUSH 4JHBA 2IBBA 1OWWA 4YBHA 3K6FA 4HSQA 2X53A 4XR8C 3T3PE 3QDME 3S97C 2AI0H 4PI0A 5FW7A 4NUQA 5CUSL 5FYJH 1BX2A 4HAFA 1X7SA 3A4FA 3LZNA 4HWUA 1RK0B 1UWGL 4LDLB 3AWGA 1SXSA 4I0PB 4UIMA 4IOFD 2YD6A 1L3NA 1MCCA 3PFQA 5EA0H 1VAHA 2QVIA 4EJ1C 2TSAA 4OVVA 3ZT5A 1D7DA 3MBXL 3LZLA 2F1EA 3UJTH 4E5XG 4IBTA 1H6EA 5GGUB 5E1AB 1QTYT 2WBXA 1U8QB 3HKFA 3EFDL 2LU3A 4MJIB 1AANA 4U3XA 1F11A 1ZE3H 4Y4KD 2E8ZA 4MB4A 3V0AC 1KELH 1QFWL 4HDIB 5D72L 3U83A 4XO8A 1K8DB 1MNUL 1I85C 4K15A 3HZYA 4U1NB 1HL4A 1CIDA 4Z7VB 2VQTA 3KCPB 3NPSC 4NIYE 1JD7A 4XCYA 4MCYB 3ZIMA 4POYA 2HUHA 4PGJA 4PRBB 2VTFA 1HL9A 5E51A 4G8EA 1XXDC 3RGVB 4XP9L 1I7RB 3LKPA 2FLMA 1P9MA 2V8MA 3MQIA 3RFZC 4B41A 5DUMH 1ND0B 5LKNA 1S7TA 5BZXA 3Q8EA 4UBDD 3CH1A 2EO7A 2VE6B 4TNGA 5EZOL 1FNGB 5DJ0B 2R1XB 1NLBL 3D3VD 5BVPH 3JTTA 4UV4H 1AKJB 1Z9SB 1LO4H 2OJEA 2V17H 2ZX6A 3LXAA 5EOQL 3TWCH 5JW4Q 1CT8B 1A25A 4G7VH 4F7MB 4A39A 5D1XB 1ACCA 4N2IA 5B3JE 3ETBF 1NCUA 3OKNA 1NKOA 3QZLA 1XIWC 3DO4A 2ZJSL 3F7VA 1FHNA 3SPJA 4JRYE 4NO2A 5DQ9A 3HB3D 3UABA 5J1TC 1NDGB 1CFTA 3DX0A 3F62A 3SD5A 1RP9A 2R1XA 2WLKA 4CSTA 2ASTB 1AD0A 4PV1C 5EORL 4GI8A 3P4NA 3VRLE 2V9TB 2RTTA 3EJYD 4N2CA 2FX8L 2GC7C 4R5XA 5JQHC 1K4DB 1YECH 4F3FA 1S9XA 1TQCB 4YO0A 4E9RA 4YHZL 4YO0B 3ARSA 4I0PA 4P2QA 5FGCE 5T1MB 4Q4EA 4B9KC 5C0BA 4X2UA 5IBLC 3BX7C 5I1LA 2FWUA 2OX5A 4H0HB 3U6XS 4YPGB 7PCYA 4ERSH 4E9SA 4NQXB 4EDWL 3NK4A 3P4NB 4BSVA 2UXVA 3DV6B 4GO9A 5JUEL 2G4GA 4Z5RB 3VRLF 4HEPA 4OLXH 3H9SA 2ZCHH 4GAYB 2EEDA 4DPCX 2XZAH 5BRZA 1FGNL 1I9JL 4OIFA 4YVUA 4GUCA 1ZTMA 5E7FA 4NI3A 5I5IA 3VDAA 1X5GA 2VR5A 3IB4A 1T1ZB 5EZIH 4B8CD 5DJAA 3L3OC 2CALA 2VXTH 5DZAA 2IDTA 4YL9A 5CGMA 2V8LA 4BRJA 3MLRH 2R9HC 5IQ9B 4EOWH 1OW0C 4G9FD 1FL5B 3KL5A 3N1FC 3PABA 4PJFF 3RRQA 5T3ZH 4Z7QE 1HJCA 3N50A 3WGVB 1S9KC 1RIVL 2CUAA 5LXGL 5E00A 4U1LB 4FMKA 3PIQA 3G6AA 3KYAA 5LG1A 3ZYJA 4PBWD 1XBDA 3VJ6A 2GI0A 3U0WH 2FHBA 3TGXA 1WFJA 3DIFA 3WEOA 3JWOC 1NEPA 1EAQA 4O58H 4DETA 2WXPA 3MTRA 5T1KB 4F33A 2DL2A 1D9KB 5JZ7D 2X89D 3V8CA 3RX9A 1MJUL 1RQ5A 1WK0A 3U4EA 4J8RA 3U48A 5C6TL 1MW3A 2A6KA 4M8QA 3QCVH 3QIBA 4CSSA 2YUZA 4O58L 4HLZG 5CLYA 1Y6NR 3AS2A 3MGAA 4MYPA 4L1HA 5L4IA 5B0NA 1JYWA 1F86A 1TJGL 1G7QB 1MCIA 3SGEI 1S4IA 2GAZA 1ZLUH 4UT7L 2R0WL 1BYNA 1G7JB 1TLMA 1HN1A 1DBJH 3CX5J 4YSEA 4PJ5E 2XQYA 1RV6X 3KVDD 3KGTA 4KROC 1T3FA 1WZKA 3GM8A 4APQD 1O6TA 3P72A 3WELA 2V2XA 1DFXA 5DO2C 2XWTB 4F24A 1QR4A 5J5EA 4XB8A 1OAYL 2V3FA 4R5DA 2XI9A 1EJOH 3MOBH 4KHTL 1WWLA 3QZMA 5GXBB 3ZKMC 3QJHB 5IW3A 1JYVA 1ZT4B 5FDWA 4KQ4H 2Y3NA 3VWKA 3W9DA 4L8DB 4Z1PA 1TUPA 4GINA 4PJIA 3C60D 1Q8MA 4UTAA 5BZDB 4RA0C 4XC1H 2O93L 3G5YB 4N68A 3ULUF 1KYFA 3EOBB 4PMEA 3CSGA 1CDIA 4ANXA 3VE0A 2C3HA 3MBEA 3E7JA 1KGWA 1FSKB 4PP2A 3LOWA 1J87A 4Y4KB 3RWFA 2RMNA 2PTTB 2H2PD 4TN9A 3IS0X 3ZMEA 4RLDA 4LVOB 1YPZF 2RAMA 1DJIA 3DXAB 1RXLA 1U93B 4DP9X 3P9WB 4JHAL 1A7RH 4MAYB 2OULB 3QUKA 4I4WA 3U36A 2X0VA 3IKCA 2JIXB 3I9AA 3HNVH 1KGCD 5HHOB 5IJBC 1MFUA 5C8JB 3MBEB 3OAYH 4PP2B 4PP1C 4KV5F 2XY1A 5CILL 3TA3A 4JZJC 1DJHA 2ZOUA 4C4BA 4KO5A 1OALA 1IKNA 2Y7NA 4P2QE 5FB8B 3MRKA 1WFOA 4ZX6A 4LCUB 3HR6A 6PCYA 5ID0A 4X8JA 2BHZA 1WFUA 4JKPL 4WKXA 5TFSH 4BWWA 4Z7NB 1S2EA 3MBWB 1JNHB 3SQRA 3H9ZA 1RJYA 3VXNA 4O4YL 5LAXA 4LOUC 2QPSA 4R09A 1J88A 5CZRA 2CJTA 1P6AB 4TL4A 1JNLL 5B39G 1ORSA 2VLRA 3V9FA 4TV3A 1YEGH 2ICEB 1V3KA 2E7LC 5DHMC 4TSBL 2VABA 1XF4B 2KC0A 4TVSa 5IKCB 2YKLL 5HJDA 3LZFL 4JJ5A 5SWSD 2VDPH 4XRCA 2XU9A 2EYTB 1H3WM 1ADQL 5F7MC 4PI2A 4MS8C 1KB9K 3WU1A 3JT2A 4QC0A 3AW5A 4TRPH 4Z94G 3VU1A 5D1ZI 1X5YA 3OR7B 2IG2H 2VZ3A 3SE4A 3CBKB 2P8PA 4Z23A 3Q6FA 3GIZH 1PG7L 4F7EA 4LPXA 3R19A 1N2RA 1AXSA 2VQUA 4U0RC 5DEJA 1BFSA 4JO4H 1FAKT 2EXYC 1KPRA 3M1BB 1U3HB 2RCSL 2DF3A 2WNWA 2VDNH 4GSRA 1R3HB 3PFUA 5MERB 1NGZB 3KNBA 3SGJC 3WHE1 1WDAA 4WI9A 5GS1A 2VJ0A 3W3GA 4HKBA 4JR9H 5JPNC 3VXRB 2ZF8A 3CFQA 4OM0L 4CU6A 4C56A 4BINA 5LCVA 3AM8C 3H1ZA 1T6WA 5D2NB 2YAMA 1M57B 3QAZB 3D4GA 1KXTB 4TQEH 3HMWL 4X6DE 3OAYK 3ZDZE 2P80A 2VR4A 5IUSA 1QA9A 5IVZA 3S8WA 1K5WA 4RRPA 1IE4A 3I2CL 2RIKA 2WNXA 3CVIL 1GH7A 2GUOA 2Z31D 3VACA 1YEKL 1ES0A 3LTVA 3U9PH 1CO1A 4NHCH 2D9CA 4BSSA 2WLNA 2WQRA 4YDZA 2Z66A 4U6TA 1GZHA 2L04A 2GY7B 3S5LG 5GJTL 3FFDB 2QZ5A 1QBMH 2X6UA 4AJ0A 3FUHA 1DSFL 1HWWA 1U8NB 3VWJD 1M3IA 4S1DD 3VXUE 3TTSA 4JFFE 1R24B 3QCTH 2VR6A 1O6SB 4M7KL 1IT9L 1OL0A 2YXWA 3L9YA 4EIUA 1N0LB 1VKXB 5J1AB 4JN1H 3BIAX 4P2RB 5IREA 4XPBH 1WWAX 1JHLL 1SJEB 1GGYA 3C5ZD 4NS0A 1T2QH 3MLWL 4R9HA 1E5ZA 3QXDA 4TYUA 4U09A 4L48A 2XY2A 5DD6A 3N1QC 3DDFA 2VAAA 5F7LB 4LLMA 4IRSA 2D73A 4A2LA 3AUWB 5CP3H 3EJJX 2HJFA 4JHAH 5DD3L 1K8IA 3NTCL 1O7VA 2HT3D 2CHDA 2XRAH 4KKCD 3MV9B 4MSWA 3ZYNA 4PGEA 4ODTL 5F7YC 4L37B 4LSPH 5HGAB 5C09B 4UZUA 4R0AA 3Q48A 4HJTA 1JNNH 2HPOA 3MLUH 3RU8L 1JZ6A 3AG1B 2F53D 1MY5A 4JK0D 3C5ZC 3RY6C 4QTHA 4IOSA 5CLXA 3FDWA 4NGHH 3P0YH 3D0AA 4UQ2B 3OZ9H 5FS5A 4JM4H 3B2UD 1AXTL 4JBSA 5EUOB 1RZIA 1KJMB 3KWWB 3GS0A 5KYXB 4PRIA 4AV5A 1WZAA 4HK3N 4XB7A 5GZOA 5E4EC 3MJ7B 2J25A 2VLLB 3WDJA 1IKFL 1XGUA 1DN0A 1EHAA 2WUCL 1UGKA 1SN0A 2BC4B 2IO5A 1HESA 2X3CA 3T9WA 5LGKA 1Z5HA 4BFEA 4S10A 4S1RH 3FSOA 3RFZB 1RUMH 1TQBC 4DO6A 1DBJL 2EH8H 1OCRB 4LPWA 3L5HA 1B3IA 4I87A 2R0WH 5CP7B 4KGJA 1XSKA 1J0ZA 4ZOEA 5I8CA 3HG0A 5DQJB 4EXKA 3F12A 2X7LA 2VLJB 4RCWA 3VH8A 4G7SB 3IFLL 4FQ1H 4MMZB 3EBGA 2QPUA 4B50A 2I5YL 3UACA 3E8VA 1JPGA 3CMOH 3FFDA 4XN4A 1JYXA 1KN2L 2VCOA 2A9NH 3A0OA 1P53A 2GT9A 1G0YR 4HHGA 4NQED 2OMVB 2WBJD 2Y6SC 4ZW3A 3DZEA 3FTGA 4LKXB 1MFVA 4ZXBA 1CURA 3WNNA 1ID2A 2W07A 4IU2B 3QHFH 5DRWB 4AE1A 1LMIA 4EI6B 1FI8C 1FO1A 1E27B 3JVFC 3DPBB 3ELQA 2AJVH 1YYLH 3U2SA 2DWYA 2YJQA 1D9KD 5C0AE 3W3BA 2NSMA 1UB6B 4NJ9L 3TZVB 3WIFB 2AQ3A 3SB3A 1G84A 3WY1A 1T0OA 2P52A 3ZZQA 4HV8A 4BKTC 5FYJD 1X4XA 4OB5L 1QVOA 32C2B 1BAFL 4LI1A 1L7IL 1C8QA 4BCXA 4ZPTB 5EFIA 3H7LA 1INDL 1TTAA 3CC1A 3U4EB 1R4XA 3W3LA 3CFUA 2JB5L 3R06B 2XG5B 5DGRA 2WBKA 3FU9A 4NQCE 3LXUX 5BZDA 1MFCH 1AMXA 2ARJA 1XH2A 2DD8L 3DI3B 5MENE 3O2DH 5E56A 5AYTA 5JXAH 4D3CL 4M5ZL 2YD7A 4EPSA 3CTTA 1VEOA 4PV8A 1P2CA 4BH8A 2O6EA 2X4TB 4MVBD 4R96A 4ERSL 3KPTA 1NBVL 4Z95H 5I71C 3N06B 4N2DA 3RA7H 2A6IA 1RD6A 2NY3B 3CLEH 3N44B 2K3TA 4ZYKB 2WLLA 1KGYE 1FZOA 1I8IA 1X9LA 3D07A 3OR6A 5LBSL 2AJSL 3C9NB 3D4CA 4P57A 3IXTA 4ELMF 3F7PC 5EU3B 4L4JA 3S9DB 4FXKA 5A2FA 2BW5A 2X5PA 5IW1B 1M6OB 3KPMA 3OBAA 2QDWA 3CHXA 2FO1A 1DE4B 1L3WA 2XWEA 3FUEA 3NZSA 5KSVA 3AWEA 2XBZA 3BAXA 1G1YA 1GYWA 2EDOA 2BSED 1S7RB 3HLKA 2A0LC 4S1DC 5I6LA 5J1SC 1JIBA 1NCDH 2NOYA 4OIIL 2NR6C 4TTDD 4IRSD 3NESA 3VI3B 3MRHA 3N0AA 3RKPA 4X8JB 3VXSD 5TE6L 1F4WL 5C0BB 5T1MA 2BWIA 1C08B 4AIEA 3BH9A 3L7FA 4KY2A 3L45A 4U1GB 4OZ4A 1ED3A 4EI5D 1NCJA 1H3UA 4AZ8A 5GRZA 1A7OH 4QR7A 3T2NL 3GHBH 3V5KB 4EN3A 2O6CA 2WSPA 1OY3B 5TPWL 1YEWA 3QUGA 3CDCA 3VXPA 1P5VA 1YNKL 3OXRA 4I4WB 4PJFA 4YSAA 5FKPB 2KT6A 4P2RD 3HE6A 5HVHC 2MCPH 4JB9H 1XF5B 4XMKH 3VNZA 5ICZB 4KY1L 4RBPH 3G5ZA 5HHXL 4E0RA 3DX6B 2P24B 3HVDA 4XP9H 1CDGA 1U3JA 1T7XA 3ABMB 5L2KB 1F2QA 3BKJL 2IV8A 3QO0A 1NTDA 2NTFB 1Q9LA 3FT3A 1G7LA 2ZAHA 5B8CB 3IJEA 2NUPB 3QNZB 5E8DL 5GHWH 3EOTH 1DBBH 1LDPH 2JKWA 3HNSL 3LEVL 3WHXB 2P9RA 4WKZB 2Z65A 3HS0A 4PG2C 1W91A 5DD5L 5GIRA 1OP4A 2PW1A 4K23H 2E9WA 2D7TH 1OAJA 4K5NA 4JY4B 1NDTA 2DBLL 2B5IB 1ET7A 3OQRA 2HG5A 2DWSA 1H5BA 2RR3A 2NNFA 3WNIA 1BFTA 5C70A 4OZGB 2B59B 4JFUA 4XVSH 4ZXBD 5HDBE 1MLBA 1P84J 1AS7A 1PL3A 3GB7A 1F97A 4GQRA 5T3ZD 2J6WA 4HD5A 4IBSA 3AMKA 3RTQB 5GS0C 2QZQA 1FZKB 5IB5A 3GEWB 4JG1L 3Q3GA 1S8DA 5KVDH 2X4RA 1VF5C 4WGVB 5B4MD 2WY3B 5ENWA 3OKOA 1QPKA 5IBUB 4XO9A 3FNKA 1G7QA 5F7DA 1MHCA 1TQBB 4OGZA 1CFQA 1SYVB 4YE4H 3MUHL 2AK4E 1WS8A 3VB8A 3ZTJH 4BGDA 1T03H 2YSSB 4HFWB 4M1DL 4WI5A 3UZQA 5TQ2H 1X9UA 1G7MA 5TGBA 3II3A 1HS6A 2GTZA 2P45B 4RIRA 4UZGA 1LNUA 4JCWA 1L9MA 3REVB 3Q3GB 3O9WB 2OSLA 1EAPA 3ULUA 5HDQL 3DWTA 4W9JC 1DFBL 4QNPF 3VI4F 5T3XD 4AENB 4HC1A 4OKVA 3HRZA 3VFOB 2QQLL 3RZCC 5HP5A 2D7QA 3QPQC 4C55A 5FYJE 2JH2A 1GGBH 2DLGA 4GRMB 3ISRA 4M43H 2PO6D 5DJDB 5T5FA 4B9IA 4CAGA 5F6HI 5J6GB 3ZE0E 5AZ5A 3L4ZA 1NGPL 3ZQWA 4FQCL 2ED8A 3AADB 3O3BB 4CN1A 4QRRE 3E38A 3RVWC 4PB9L 3ZT6A 1B0GA 4G7RB 3H7BB 4M1GL 4DVBB 3MV8B 1JK8B 1U3HA 4NUJB 4Z7OF 5BV7B 1M7IA 2EE0A 1ZCRA 2F61A 2XV0A 1BWWA 1JPTH 2RA1A 1BHGA 2GBTA 4Y9EA 2P5ED 5HVFB 1MCPH 2W81C 2FJGA 3O41A 3ISYA 1MHHA 3STLA 5D2LA 3TN0B 3MRNB 3UTSD 2B1OA 3S7GA 2DQGL 1CGVA 2X28A 2EIMB 4RESB 1HHHB 5J06A 2Y9RT 3AY4C 3GJEB 2X4NA 3V7MA 4QRQA 5JW4R 4KI1A 1HQRB 1MUJB 2YAHA 3O6FA 5DA4A 2ZOKB 2YGPA 3IFOB 3HZKB 1ORQA 4Y2DD 2IDCA 2FWLB 3F65A 3BESR 1OZUA 1EXUA 3B5GA 4BBWA 1KIUA 3RTQA 3BEVA 3G08B 1AQKL 4ONFH 2A5UA 2Y25A 1EUUA 1X5HA 3ILEA 4P06A 4B0MM 3BVVA 5KSAB 4LEOB 4KTDH 2K7PA 2O6PA 3WPFA 3K80A 4YWGL 4OCSL 1RJYB 3UZEA 1JZ2A 4NENB 2AABH 4FABL 1XB6A 2EECA 4KK6D 4OV6F 5CFHA 4JQIA 1RURH 2EDWA 4HP5A 2RQEA 1QUPA 2CGYA 5B22A 3TIEB 4HPOH 3SBRA 1RULL 1CICA 3NCMA 5D1ZC 2FWOA 4X6DA 3T3MF 2Y2WA 3PWPE 4QHUB 4Q3IA 2P80D 2QLVB 4LAQH 4GLPA 1CLOH 4U1SA 2FQEA 3MZGB 4B96A 1DYZA 1JXFA 1HEZB 3MJ6A 4PM1A 2HH0H 2IANB 1AH1A 1RK0A 3IDMA 5CU9A 1BX2B 5E2WL 3KPRB 4FZ8H 3UAJD 2YD1A 4FF9A 4UQCA 3RPIA 4BWTA 5TE7L 2BSRB 1H15A 1JRHL 2OBGA 2VKWA 3ZDYF 3FXIA 1MWAH 3FRUB 2Y5QA 2CKBA 5FYKL 1OZTG 3EGXB 5F72S 2ADIA 3Q2WA 4WDIA 4X9FA 4L8CA 4ZSOE 1S5IH 3U30C 1WBYB 3B83A 4YHOL 1DJGA 2EAEA 2WTOA 4CMMA 1SJVA 4JQIH 4PJXE 2ZKHL 5FA3A 3SDAD 4XOBA 1QSEE 3WJMA 2X2HA 1C1EL 1N8ZA 1ONQA 2F8IA 3MJWA 3GMNA 2DY2A 5KVEE 1TJXA 3PP4H 4YH6A 1KB5A 4R4ND 2BSSA 2ZYSA 3O11B 1XR9B 4PJ9D 3U2JA 2YAOA 4OM1L 5JIMA 4G6ML 1RK7A 4WO4B 1KBGL 5IFJA 4Y9GA 4YN3A 1HYSD 5DGQA 1CU4L 1J0YA 3RTLA 2XWRA 4W93A 1JAEA 5E94A 4E41A 3W81A 3CFJB 5I19H 5GZND 2IBZY 2ALWA 1UXWA 1ZHNA 4JUSA 3EO0A 1LMKA 4GP4B 3PWNA 4CW1A 1SYSA 4QI3A 3DKHA 2E6PA 1U2HA 4LKXA 4ZXBB 5E9AA 4LVNB 3ZW3A 2GT9B 4TULH 1EHKB 2NYKA 4GLRI 3VFMB 4U1MB 3P1VA 4L3EA 3FBQA 3BN9C 4Z7QB 2WIIA 3FL7A 2ZOLB 5D1QB 3SGDI 4U7KA 4JFWA 1LO2H 2ZOLA 5D1QA 4ZZFA 2X88A 1E4XL 2YPVH 3FRPG 4LLYB 4U6VL 3BAKA 3J27A 4EIGB 4CVUA 1UA6H 2HJLA 4P4KA 4QD2E 1DQDL 1ILUA 3MUGA 4Y19A 4MA7H 5D1ZB 2Q6WA 4JY5L 1ZTXH 5FLUA 4NJAL 1F1AA 4HCRH 4W9ZA 3VGDA 5DUJA 3DPDA 2K8MA 4N8CH 3E6HA 4JY6A 2V5RA 2X4PB 4ZUVB 4QXWA 1TLKA 1Z7XW 4JDTL 3TYGL 5I6XC 5T1LA 4YHNB 1BREA 5IBLD 3O45B 2HJKB 2WBJA 3POCA 3FT9A 1A4BA 4FI7A 5IP4A 1W9XA 4PV9A 2XG5A 1IM9A 5CSGA 1MRDL 2NSQA 5ISZA 2IBGA 2HWZH 5IHHA 4LNVA 4X5WB 4URTB 3TEXA 4OZIE 3LNFA 1AC6A 2ZCLH 4LHJB 2Q8AL 1VB9A 4HH9B 5ABAA 4NNXB 2WTPA 1ZS8B 1FN4B 3K2UH 4D8PB 2K1MA 1NMAH 1KGUA 5BNXD 3FB6A 3LN5B 4JQXC 3U6RA 3NAAL 4WNQA 4ALAL 2W95A 4OLWH 1IGIH 3WJJC 4W9KC 4ZFGL 5CP7A 2OYKA 2WZPD 1NKRA 2R69A 3VYOA 2VJXA 3B9KC 3LPGA 4U1IA 5AW0B 3WLBA 3BP5A 4U7SA 2W0FA 3REWB 3L7EA 2EKJA 3PWJA 5TF0A 2HFTA 3V0WL 2OR9H 4U7MA 4Y2DB 3WUZA 5ACLA 4NP4H 2OMVA 3KJ4B 3ZDYB 3VQ1A 4HS6B 4B97A 1KGIA 3CIYA 2IXQB 3MGTA 3O3DB 2CPCA 2E4FA 4NZ8A 4XPTH 2C4FT 4DP8X 2HA1A 1CXLA 3ZK0A 1OT4A 1CTMA 5HGBA 4FXGA 5GSVB 4CUCA 4QXVA 3OWEA 4D3CH 5FECA 1FPTH 4FEIA 4TUKH 5I8CB 1PY9A 4M3HA 2CJUH 5IVXB 4JGMA 2GJ6D 2BY1A 2FT7A 3AACA 2WVVB 4MS6A 4MDJB 4MNHB 3H55A 4R0LA 1A6WH 1T04A 1WHPA 3TJHD 1ODUA 4QF1A 3VRIB 4N9GB 1JOIA 1FFNA 1FL6A 1KNOB 3F5WA 2VXSH 5DR5H 4OZFA 2L3BA 4C57C 3VFNA 2FR4A 2ZPKL 1XQ4A 2FL5B 1LD9A 4FRWA 3WDIA 2Y7LA 5LGYA 4MCZA 3R0NA 1HH6B 3VGAB 4PJCA 4PJGF 1AY1L 3M8OL 1LK2B 1M71A 3BZFA 3NPSB 3RGVA 5KJRL 1F6AB 1C16B 5KZCB 4KJYB 1N3NA 4XC3L 2HPTA 3B2XA 4A66A 4XSQA 3TNNB 2R2BA 3VD5A 1GXEA 1FFOB 5FHAL 2DEWX 1CD9B 3NIDB 4JQXA 3ZDXE 1OIOA 2OTPA 3OL2A 4MDJA 4X7FC 5A3IC 2NXYB 1KENL 3NN8A 4JRXB 5FO7A 4BFIA 3HG2A 2ZCKL 4FS0A 1YMHA 1KYUA 1M0ZA 2MKWA 1HKFA 3LRSA 1T0MB 4YHPA 3TVMB 4BQCA 2Q7YA 3DRQB 3QIWD 3AABA 3PHQA 3STZA 4DP5X 1WFIA 5AW1B 4DAGL 1R1CA 5EOCJ 4PRNB 5IHWA 3A3YB 4WFGE 1WBZB 3CZLA 1A7NH 2VN7A 3UC0L 2AJZA 3QJQB 3IAPA 4X8XA 4P9HC 3F7LA 1UTDA 3BP5B 1E4WH 3WTVA 1FV1A 3GI9H 5H37H 1MQKH 2ICEA 2G3XA 3LB6C 2FVNA 4HPOL 3RY4A 3JUYA 1X4YA 1IC4L 1FVEA 3X3FH 3IXAA 2ARWA 3CAFA 4AW7A 1XIWB 2A6DB 2XETA 4Z7IA 5CN2A 1LNUB 2AQTA 3C2SA 3FFCB 4JO2H 1E5AA 4Y2LA 4ZT1A 5TH2B 4N2GA 5D1XC 1JNHA 3FZUC 1FO0H 2EH7L 3LDBB 3MN8A 2H8PA 3CDFA 1VCAA 1KTLB 1MW2A 5I73B 1CC3A 1SXAA 1T1XA 1C7SA 3HN3A 3QULB 4LPTA 1S3RA 3FBKA 3LS4L 4M6NL 3T6XA 1AQ8A 3P2TA 4N24A 2YGQA 4HHAA 2ESVB 4XGZB 1U42A 4FQIH 1NC2A 5F9WB 2DQFA 2OYLA 3GIVB 4A7VA 1K2DB 3MU3A 4RBPK 1LHZA 4A2MA 3FQNA 2A7BA 4OBRA 1V7ML 4M5TA 4ZUUA 4WEMB 4P46C 5ILTH 3NOIA 2MCAA 1KTJA 2XG4B 4NM8H 3IYLW 3KPNB 4PWGA 2A6JB 5AAWC 4Y4FB 1QLFA 3LS4H 4M6NH 3WS6C 2VERN 3MLYH 3QG7H 5IESL 2DQCL 3L48A 4MJ6B 3HFFA 4P23B 2XDHA 4WTZG 1FC1A 4X0KA 1OF2A 3QEUB 5DS1A 1N2RB 2CRZA 1QSFE 2DLFH 1N18A 4GUQA 3GBDA 3PHOA 5F9JA 1D6VL 4ZUTA 4JLRA 5KYUB 1NGPH 2VDOB 4HG4K 1OVZA 2XX1A 1YPZB 1BIIA 4M43L 1ZA3A 1UWXK 4RNRB 1BEYL 1QRND 3AB0C 2BIMA 3QORC 2XQYK 4MRBA 4M7LL 3FPYA 1E4WL 3TBYA 1WISA 4D0DB 1UZ6F 1XXFC 1SYSB 4XCCL 3U6XA 1HT6A 4MA8L 3QZWA 2NW3A 3QUHA 5IF0B 1VFAA 2OCFD 3I3BA 2WVUA 4U2ZA 3SN6N 2QGEA 5JZ7C 3TA3B 3MX0A 4LOVA 1O5DT 4LLAA 3K5RA 4W9HC 1BFVH 3RVTD 4XH2B 3OJAB 5JHDD 3GXPA 3ZN6A 3IM1A 1RUQL 2CDFA 1NIDA 2Q20A 1N5YL 3OPZH 2BFVH 1HILA 5E8PB 4HXAH 4Z3TA 5I1DB 2DQEH 5SWZE 1PSKH 1CICC 1U8MB 2V5TA 4N4YB 1CZ8H 1E0OB 1U58A 1LO5B 3JV4B 1NANH 3OLDA 5DK3A 1N64H 2WUBH 5F1NB 1YY9D 3UX9B 4LXRA 2LLLA 4XVSL 2PYEA 3QEGL 4F58H 5B1BB 4FP8H 5I75C 2W88A 4PRHE 4Y4FC 4WU5B 1BPLB 4J39A 4Q9RL 1NWPA 5IM7B 4ELME 2O5NA 2XV3A 1S7QA 1BG9A 3L4WA 4J3TA 4PD4J 4KKLD 5LBVA 2BSEA 1OM3H 5MEQB 1I1CA 4NQEB 4ONGL 1UH2A 3X14B 1MRFH 3RNKB 1S9YA 4LF3A 3SO3C 4I77H 4YBQC 1HK6A 2ADJA 3FCGA 3G5XB 4I0KA 4ZW8A 1OTMA 3IDGA 3KPNA 1HU8A 3BQUC 3MXWH 1G7IB 2K70A 5TDPB 5E4OA 1QP1A 4PRAB 4QRUA 1DBBL 5C08E 3ZLQC 3KPRA 1CICD 4MDIB 2JLPA 5J13B 4PRDB 1TVHB 1BM3H 4UT9A 1BVKA 2WB1A 3KYMB 3E6FB 1F4YH 1N59B 3QCUH 1FPTL