4U08A

Structure of leptospira interrogans lrr protein lic11098
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
391
structure length
391
Chain Sequence
QTYYRNITEALKNPQNVRILNLSGSKLTTLPGEIGKLQNLQLLNLDDNQLIALPKEIGKLQNLQQLHLSKNQLMALPEEIGQLQNLQKLKLYENQLTAIPKEIGQLQNLQELNLAHNQLATLPEDIEQLQRLQTLYLGHNQFNSILKEIGQLQNLESLGLDHNQLNVLPKEIGQLRNLESLGLDHNQLNVLPKEIGQLQNLQILHLRNNQLTTLPKEIGQLQNLQKLLLNKNKLTTLPKEIGQLQNLQKLKLYENQLTTLPKEIGQLQNLQELDLDGNQLTTLPENIGQLQRLQTLYLGNNQLNFLPKEIGQLRNLESLDLEHNQLNALPKEIGKLQKLQTLNLKYNQLATLPEEIKQLKNLKKLYLHNNPLPSEKIARIRKLLPQCIIYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords LIC11098
publication title Structural characterization of a novel subfamily of leucine-rich repeat proteins from the human pathogen Leptospira interrogans.
pubmed doi rcsb
source organism Leptospira interrogans serogroup icterohaemorrhagiae serovar copenhageni (strain
total genus 144
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4u08A00
4R5CA 4M7EA 4GLPA 2WQWA 4MQWX 2WQXA 3WN4A 4ARNA 3W3LA 1H6UA 1DFJI 1W8AA 4QXEA 4LSXC 4YEBB 3RJ0A 3G06A 3UL8A 2WFHA 2Y5QA 4KT1A 4R07A 4U06A 3ULAA 1U0ND 2ELLA 3UL7A 4AW4A 1WWLA 3ZYNA 5IJBA 1KOOA 3CIYA 3OGKB 4U7LA 4FHOA 1OZNA 1FO1A 5B4PA 2JE0A 3G04C 4CILA 4K17A 1KOHA 3RW6A 4CC4C 3OGMB 4BSUA 3G39A 1DCEA 3REZA 5B0TA 3TSRE 2RA8A 2O6RA 4J0MA 4CP6A 4FCGA 4L3AA 1FT8A 2Q4GW 3CVRA 5B0NA 4V2EA 4RWTC 4R6GA 1XECA 3A79B 4I6JB 3OJAA 1JL5A 3O6NA 4Z94G 1O6VA 4FS7A 1SQ0B 2JE1A 4FMZA 5CMPA 1A9NA 1LTXA 5FTTB 3BZ5A 4R0AA 4LI2A 4B8CD 1H6TA 4NKHA 4M7EC 2V70A 5AWBA 5GS2B 3WPGA 2Z62A 4G8AA 4PSJA 4RCAB 4LXRA 3C6NB 4FDWA 5GMHA 5D3IA 1XKUA 4CNMA 4L3FA 4R09A 1K5DC 3E6JA 4EZGA 4Z79A 4V2DA 3RFSA 4J4LA 3E3ZA 4V2CA 4AY9X 1OTOA 4CNCA 4C2BB 3WPBA 2O6SA 2P1OB 2Z82A 2XOTA 5HDHA 4U09A 2BEXA 1IO0A 4OQTA 2O6QA 2OMWA 3W3JA 4R6FA 3RW7A 4LSAA 1XCDA 1XEUA 4LSCA 1OOKG 3M18A 2WQVA 4BV4R 4ARRA 1QYYA 1G9UA 2P1PB 4ECOA 1D0BA 1M0ZA 3W3KA 2IFGA 5AWDA 4Z64C 3W3GA 1O6TA 2Z66A 5AWAA 4XGOA 2R9UA 5IYXC 3RFEA 2P1MB 4P91A 1K5GC 2BNHA 1XWDC 2JQDA 3E4GA 4MN8B 4ECNA 3KJ4A 4R58A 3FXIA 4P8SA 2WQUA 2ASTB 3E2JA 1ZIWA 2Z63A 5CMNA 3WPHA 4PQ8A 4C2AB 5GMFA 1P8VA 2Z7XB 3G3BA 4WP6A 4Z8GA 1O6SA 2UZXA 4IM6A 3WPEA 3M19A 2RR6A 1P8TA 5GMGA 1M9LA 4LI1A 2OMZA 1FQVA 3RGXA 2OMYA 4BSRA 4XOSA 4Y61B 1A4YA 4WYKA 4Q3IA 2V9TB 5IJCA 4LXSA 4PKIG 4Q3GA 3RGZA 2FT3A 3RIZA 2A0ZA 1M10B 4NKGA 5A5CA 4U08A 4R6AA 1FS2A 4FD0A 3C6PB 4QBZA 1M9SA 3C6OB 4QC0A 1Z7XW 1DS9A 1OTMA 3WPDA 4GT6A 3P72A 5GS0A 4Q62A 3RFJA 1YRGA 2Z64A 4LSXA 3O53A 1OTNA 4H09A 2CA6A 3VQ1A 3OGLB 3UN9A 2OMUA 3JB9j 4KNGA 3WPIA 5IJDA 3UL9A 2OMXA 2ID5A 2OMVA 2OMTA 4RCWA 3ZYJA 4TZHA 4PERA 1PGVA 4HQ1A 4Z61C 4BSSA 3GOZA 4KXFB 2Z7XA 5AZ5A 1OGQA 2Z65A 3W3MA 4R08A 5LFNA 1P9AG 2ASSB 4CC4A 4PEQB 5GQRK 5HZLB 3ULUA 3ZYOA 1GWBA 3WPFA 4R6JA 2P1QB 3G3AA 3OJAB 3PMHG 4R5DA 2Z81A 3DZEA 4XSQA 3CIGA 3ULVA 2P1NB 2XWTC 3SB4A 2UZYA 3VQ2A 3W3NA 3ZYIA 2V9SA 5AWCA 4UFRA 3WPCA
chains in the Genus database with same CATH superfamily
4R5CA 4M7EA 4GLPA 2WQWA 4MQWX 2WQXA 3WN4A 4ARNA 3W3LA 1H6UA 1DFJI 1W8AA 4QXEA 4LSXC 4YEBB 3RJ0A 3G06A 3UL8A 2WFHA 2Y5QA 4KT1A 4R07A 4U06A 3ULAA 1U0ND 2ELLA 3UL7A 4AW4A 1WWLA 3ZYNA 5IJBA 1KOOA 3CIYA 3OGKB 4U7LA 4FHOA 1OZNA 1FO1A 5B4PA 2JE0A 3G04C 4CILA 4K17A 1KOHA 3RW6A 4CC4C 3OGMB 4BSUA 3G39A 1DCEA 3REZA 5B0TA 3TSRE 2RA8A 2O6RA 4J0MA 4CP6A 4FCGA 4L3AA 1FT8A 2Q4GW 3CVRA 5B0NA 4V2EA 4RWTC 4R6GA 1XECA 3A79B 4I6JB 3OJAA 1JL5A 3O6NA 4Z94G 1O6VA 4FS7A 1SQ0B 2JE1A 4FMZA 5CMPA 1LTXA 1A9NA 5FTTB 3BZ5A 4R0AA 4LI2A 4B8CD 1H6TA 4NKHA 4M7EC 2V70A 5AWBA 5GS2B 3WPGA 2Z62A 4G8AA 4PSJA 4RCAB 4LXRA 3C6NB 4FDWA 5GMHA 5D3IA 1XKUA 4CNMA 4L3FA 4R09A 1K5DC 3E6JA 4EZGA 4Z79A 4V2DA 3RFSA 4NZTM 4J4LA 3E3ZA 4V2CA 4AY9X 1OTOA 4CNCA 4C2BB 3WPBA 2O6SA 2P1OB 2Z82A 2XOTA 5HDHA 4U09A 2BEXA 1IO0A 4OQTA 2O6QA 2OMWA 3W3JA 4R6FA 4NZRM 3RW7A 4LSAA 1XCDA 1XEUA 4LSCA 1OOKG 3M18A 2WQVA 4BV4R 4ARRA 1QYYA 1G9UA 2P1PB 4ECOA 1D0BA 1M0ZA 3W3KA 2IFGA 5AWDA 4Z64C 3W3GA 1O6TA 2Z66A 5AWAA 4XGOA 2R9UA 5IYXC 3RFEA 2P1MB 4P91A 1K5GC 2BNHA 1XWDC 2JQDA 3E4GA 4MN8B 4ECNA 3KJ4A 4R58A 3FXIA 4P8SA 2WQUA 2ASTB 3E2JA 1ZIWA 2Z63A 5CMNA 3WPHA 4PQ8A 4C2AB 5GMFA 1P8VA 2Z7XB 3G3BA 4WP6A 4Z8GA 1O6SA 2UZXA 4IM6A 3WPEA 3M19A 2RR6A 1P8TA 5GMGA 1M9LA 4LI1A 2OMZA 1FQVA 3RGXA 2OMYA 4BSRA 4XOSA 4Y61B 1A4YA 4WYKA 4Q3IA 2V9TB 5IJCA 4LXSA 4PKIG 4Q3GA 3RGZA 2FT3A 3RIZA 2A0ZA 1M10B 4NKGA 5A5CA 4U08A 4R6AA 1FS2A 4FD0A 3C6PB 4QBZA 1M9SA 3C6OB 4QC0A 1Z7XW 1DS9A 1OTMA 3WPDA 4GT6A 3P72A 5GS0A 4Q62A 3RFJA 1YRGA 2Z64A 4LSXA 3O53A 1OTNA 4H09A 2CA6A 3VQ1A 3OGLB 3UN9A 2OMUA 3JB9j 4KNGA 3WPIA 5IJDA 3UL9A 2OMXA 2ID5A 2OMVA 2OMTA 4RCWA 3ZYJA 4TZHA 4PERA 1PGVA 4HQ1A 4Z61C 4BSSA 3GOZA 4KXFB 2Z7XA 5AZ5A 1OGQA 2Z65A 3W3MA 4R08A 5LFNA 1P9AG 2ASSB 4CC4A 4PEQB 5GQRK 5HZLB 3ULUA 3ZYOA 1GWBA 3WPFA 4R6JA 2P1QB 3G3AA 3OJAB 3PMHG 4R5DA 2Z81A 3DZEA 4XSQA 3CIGA 3ULVA 2P1NB 2XWTC 3SB4A 2UZYA 3VQ2A 3W3NA 3ZYIA 2V9SA 5AWCA 4UFRA 3WPCA
chains in the Genus database with same CATH topology
4R5CA 4M7EA 4GLPA 2WQWA 4MQWX 2WQXA 3WN4A 4ARNA 3W3LA 1H6UA 1DFJI 1W8AA 4QXEA 4LSXC 4YEBB 3RJ0A 3G06A 3UL8A 2WFHA 2Y5QA 4KT1A 4R07A 4U06A 3ULAA 1U0ND 2ELLA 3UL7A 4AW4A 1WWLA 3ZYNA 5IJBA 1KOOA 3CIYA 3OGKB 4U7LA 4FHOA 1OZNA 1FO1A 5B4PA 2JE0A 3G04C 4CILA 4K17A 1KOHA 3RW6A 4CC4C 3OGMB 4BSUA 3G39A 1DCEA 3REZA 5B0TA 3TSRE 2RA8A 2O6RA 4J0MA 4CP6A 4FCGA 4L3AA 1FT8A 2Q4GW 3CVRA 5B0NA 4V2EA 4RWTC 4R6GA 1XECA 3A79B 4I6JB 3OJAA 1JL5A 3O6NA 4Z94G 1O6VA 4FS7A 1SQ0B 2JE1A 4FMZA 5CMPA 1A9NA 1LTXA 5FTTB 3BZ5A 4R0AA 4LI2A 4B8CD 1H6TA 4NKHA 4M7EC 2V70A 5AWBA 5GS2B 3WPGA 2Z62A 4G8AA 4PSJA 4RCAB 4LXRA 3C6NB 4FDWA 5GMHA 5D3IA 1XKUA 4CNMA 4L3FA 4R09A 1K5DC 3E6JA 4EZGA 4Z79A 4V2DA 3RFSA 4J4LA 3E3ZA 4V2CA 4AY9X 1OTOA 4CNCA 4C2BB 3WPBA 2O6SA 2P1OB 2Z82A 2XOTA 5HDHA 4U09A 2BEXA 1IO0A 4OQTA 2O6QA 2OMWA 3W3JA 4R6FA 3RW7A 4LSAA 1XCDA 1XEUA 4LSCA 1OOKG 3M18A 2WQVA 4BV4R 4ARRA 1QYYA 1G9UA 2P1PB 4ECOA 1D0BA 1M0ZA 3W3KA 2IFGA 5AWDA 4Z64C 3W3GA 1O6TA 2Z66A 5AWAA 4XGOA 2R9UA 5IYXC 3RFEA 2P1MB 4P91A 1K5GC 2BNHA 1XWDC 2JQDA 3E4GA 4MN8B 4ECNA 3KJ4A 4R58A 3FXIA 4P8SA 2WQUA 2ASTB 3E2JA 1ZIWA 2Z63A 5CMNA 3WPHA 4PQ8A 4C2AB 5GMFA 1P8VA 2Z7XB 3G3BA 4WP6A 4Z8GA 1O6SA 2UZXA 4IM6A 3WPEA 3M19A 2RR6A 1P8TA 5GMGA 1M9LA 4LI1A 2OMZA 1FQVA 3RGXA 2OMYA 4BSRA 4XOSA 4Y61B 1A4YA 4WYKA 4Q3IA 2V9TB 5IJCA 4LXSA 4PKIG 4Q3GA 3RGZA 2FT3A 3RIZA 2A0ZA 1M10B 4NKGA 5A5CA 4U08A 4R6AA 1FS2A 4FD0A 3C6PB 4QBZA 1M9SA 3C6OB 4QC0A 1Z7XW 1DS9A 1OTMA 3WPDA 4GT6A 3P72A 5GS0A 4Q62A 3RFJA 1YRGA 2Z64A 4LSXA 3O53A 1OTNA 4H09A 2CA6A 3VQ1A 3OGLB 3UN9A 2OMUA 3JB9j 4KNGA 3WPIA 5IJDA 3UL9A 2OMXA 2ID5A 2OMVA 2OMTA 4RCWA 3ZYJA 4TZHA 4PERA 1PGVA 4HQ1A 4Z61C 4BSSA 3GOZA 4KXFB 2Z7XA 5AZ5A 1OGQA 2Z65A 3W3MA 4R08A 5LFNA 1P9AG 2ASSB 4CC4A 4PEQB 5GQRK 5HZLB 3ULUA 3ZYOA 1GWBA 3WPFA 4R6JA 2P1QB 3G3AA 3OJAB 3PMHG 4R5DA 2Z81A 3DZEA 4XSQA 3CIGA 3ULVA 2P1NB 2XWTC 3SB4A 2UZYA 3VQ2A 3W3NA 3ZYIA 2V9SA 5AWCA 4UFRA 3WPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5C A;  4M7E A;  4GLP A;  2WQW A;  4MQW X;  2WQX A;  3WN4 A;  4ARN A;  3W3L A;  1H6U A;  1DFJ I;  1W8A A;  4QXE A;  4LSX C;  4YEB B;  3RJ0 A;  3G06 A;  3UL8 A;  2WFH A;  2Y5Q A;  4KT1 A;  4R07 A;  4U06 A;  3ULA A;  1U0N D;  2ELL A;  3UL7 A;  4AW4 A;  1WWL A;  3ZYN A;  5IJB A;  1KOO A;  3CIY A;  3OGK B;  4U7L A;  4FHO A;  1OZN A;  1FO1 A;  5B4P A;  2JE0 A;  3G04 C;  4CIL A;  4K17 A;  1KOH A;  3RW6 A;  4CC4 C;  3OGM B;  4BSU A;  3G39 A;  1DCE A;  3REZ A;  5B0T A;  3TSR E;  2RA8 A;  2O6R A;  4J0M A;  4CP6 A;  4FCG A;  4L3A A;  1FT8 A;  2Q4G W;  3CVR A;  5B0N A;  4V2E A;  4RWT C;  4R6G A;  1XEC A;  3A79 B;  4I6J B;  3OJA A;  1JL5 A;  3O6N A;  4Z94 G;  1O6V A;  4FS7 A;  1SQ0 B;  2JE1 A;  4FMZ A;  5CMP A;  1A9N A;  1LTX A;  5FTT B;  3BZ5 A;  4R0A A;  4LI2 A;  4B8C D;  1H6T A;  4NKH A;  4M7E C;  2V70 A;  5AWB A;  5GS2 B;  3WPG A;  2Z62 A;  4G8A A;  4PSJ A;  4RCA B;  4LXR A;  3C6N B;  4FDW A;  5GMH A;  5D3I A;  1XKU A;  4CNM A;  4L3F A;  4R09 A;  1K5D C;  3E6J A;  4EZG A;  4Z79 A;  4V2D A;  3RFS A;  4J4L A;  3E3Z A;  4V2C A;  4AY9 X;  1OTO A;  4CNC A;  4C2B B;  3WPB A;  2O6S A;  2P1O B;  2Z82 A;  2XOT A;  5HDH A;  4U09 A;  2BEX A;  1IO0 A;  4OQT A;  2O6Q A;  2OMW A;  3W3J A;  4R6F A;  3RW7 A;  4LSA A;  1XCD A;  1XEU A;  4LSC A;  1OOK G;  3M18 A;  2WQV A;  4BV4 R;  4ARR A;  1QYY A;  1G9U A;  2P1P B;  4ECO A;  1D0B A;  1M0Z A;  3W3K A;  2IFG A;  5AWD A;  4Z64 C;  3W3G A;  1O6T A;  2Z66 A;  5AWA A;  4XGO A;  2R9U A;  5IYX C;  3RFE A;  2P1M B;  4P91 A;  1K5G C;  2BNH A;  1XWD C;  2JQD A;  3E4G A;  4MN8 B;  4ECN A;  3KJ4 A;  4R58 A;  3FXI A;  4P8S A;  2WQU A;  2AST B;  3E2J A;  1ZIW A;  2Z63 A;  5CMN A;  3WPH A;  4PQ8 A;  4C2A B;  5GMF A;  1P8V A;  2Z7X B;  3G3B A;  4WP6 A;  4Z8G A;  1O6S A;  2UZX A;  4IM6 A;  3WPE A;  3M19 A;  2RR6 A;  1P8T A;  5GMG A;  1M9L A;  4LI1 A;  2OMZ A;  1FQV A;  3RGX A;  2OMY A;  4BSR A;  4XOS A;  4Y61 B;  1A4Y A;  4WYK A;  4Q3I A;  2V9T B;  5IJC A;  4LXS A;  4PKI G;  4Q3G A;  3RGZ A;  2FT3 A;  3RIZ A;  2A0Z A;  1M10 B;  4NKG A;  5A5C A;  4U08 A;  4R6A A;  1FS2 A;  4FD0 A;  3C6P B;  4QBZ A;  1M9S A;  3C6O B;  4QC0 A;  1Z7X W;  1DS9 A;  1OTM A;  3WPD A;  4GT6 A;  3P72 A;  5GS0 A;  4Q62 A;  3RFJ A;  1YRG A;  2Z64 A;  4LSX A;  3O53 A;  1OTN A;  4H09 A;  2CA6 A;  3VQ1 A;  3OGL B;  3UN9 A;  2OMU A;  3JB9 j;  4KNG A;  3WPI A;  5IJD A;  3UL9 A;  2OMX A;  2ID5 A;  2OMV A;  2OMT A;  4RCW A;  3ZYJ A;  4TZH A;  4PER A;  1PGV A;  4HQ1 A;  4Z61 C;  4BSS A;  3GOZ A;  4KXF B;  2Z7X A;  5AZ5 A;  1OGQ A;  2Z65 A;  3W3M A;  4R08 A;  5LFN A;  1P9A G;  2ASS B;  4CC4 A;  4PEQ B;  5GQR K;  5HZL B;  3ULU A;  3ZYO A;  1GWB A;  3WPF A;  4R6J A;  2P1Q B;  3G3A A;  3OJA B;  3PMH G;  4R5D A;  2Z81 A;  3DZE A;  4XSQ A;  3CIG A;  3ULV A;  2P1N B;  2XWT C;  3SB4 A;  2UZY A;  3VQ2 A;  3W3N A;  3ZYI A;  2V9S A;  5AWC A;  4UFR A;  3WPC A; 
#chains in the Genus database with same CATH topology
 4R5C A;  4M7E A;  4GLP A;  2WQW A;  4MQW X;  2WQX A;  3WN4 A;  4ARN A;  3W3L A;  1H6U A;  1DFJ I;  1W8A A;  4QXE A;  4LSX C;  4YEB B;  3RJ0 A;  3G06 A;  3UL8 A;  2WFH A;  2Y5Q A;  4KT1 A;  4R07 A;  4U06 A;  3ULA A;  1U0N D;  2ELL A;  3UL7 A;  4AW4 A;  1WWL A;  3ZYN A;  5IJB A;  1KOO A;  3CIY A;  3OGK B;  4U7L A;  4FHO A;  1OZN A;  1FO1 A;  5B4P A;  2JE0 A;  3G04 C;  4CIL A;  4K17 A;  1KOH A;  3RW6 A;  4CC4 C;  3OGM B;  4BSU A;  3G39 A;  1DCE A;  3REZ A;  5B0T A;  3TSR E;  2RA8 A;  2O6R A;  4J0M A;  4CP6 A;  4FCG A;  4L3A A;  1FT8 A;  2Q4G W;  3CVR A;  5B0N A;  4V2E A;  4RWT C;  4R6G A;  1XEC A;  3A79 B;  4I6J B;  3OJA A;  1JL5 A;  3O6N A;  4Z94 G;  1O6V A;  4FS7 A;  1SQ0 B;  2JE1 A;  4FMZ A;  5CMP A;  1LTX A;  1A9N A;  5FTT B;  3BZ5 A;  4R0A A;  4LI2 A;  4B8C D;  1H6T A;  4NKH A;  4M7E C;  2V70 A;  5AWB A;  5GS2 B;  3WPG A;  2Z62 A;  4G8A A;  4PSJ A;  4RCA B;  4LXR A;  3C6N B;  4FDW A;  5GMH A;  5D3I A;  1XKU A;  4CNM A;  4L3F A;  4R09 A;  1K5D C;  3E6J A;  4EZG A;  4Z79 A;  4V2D A;  3RFS A;  4NZT M;  4J4L A;  3E3Z A;  4V2C A;  4AY9 X;  1OTO A;  4CNC A;  4C2B B;  3WPB A;  2O6S A;  2P1O B;  2Z82 A;  2XOT A;  5HDH A;  4U09 A;  2BEX A;  1IO0 A;  4OQT A;  2O6Q A;  2OMW A;  3W3J A;  4R6F A;  4NZR M;  3RW7 A;  4LSA A;  1XCD A;  1XEU A;  4LSC A;  1OOK G;  3M18 A;  2WQV A;  4BV4 R;  4ARR A;  1QYY A;  1G9U A;  2P1P B;  4ECO A;  1D0B A;  1M0Z A;  3W3K A;  2IFG A;  5AWD A;  4Z64 C;  3W3G A;  1O6T A;  2Z66 A;  5AWA A;  4XGO A;  2R9U A;  5IYX C;  3RFE A;  2P1M B;  4P91 A;  1K5G C;  2BNH A;  1XWD C;  2JQD A;  3E4G A;  4MN8 B;  4ECN A;  3KJ4 A;  4R58 A;  3FXI A;  4P8S A;  2WQU A;  2AST B;  3E2J A;  1ZIW A;  2Z63 A;  5CMN A;  3WPH A;  4PQ8 A;  4C2A B;  5GMF A;  1P8V A;  2Z7X B;  3G3B A;  4WP6 A;  4Z8G A;  1O6S A;  2UZX A;  4IM6 A;  3WPE A;  3M19 A;  2RR6 A;  1P8T A;  5GMG A;  1M9L A;  4LI1 A;  2OMZ A;  1FQV A;  3RGX A;  2OMY A;  4BSR A;  4XOS A;  4Y61 B;  1A4Y A;  4WYK A;  4Q3I A;  2V9T B;  5IJC A;  4LXS A;  4PKI G;  4Q3G A;  3RGZ A;  2FT3 A;  3RIZ A;  2A0Z A;  1M10 B;  4NKG A;  5A5C A;  4U08 A;  4R6A A;  1FS2 A;  4FD0 A;  3C6P B;  4QBZ A;  1M9S A;  3C6O B;  4QC0 A;  1Z7X W;  1DS9 A;  1OTM A;  3WPD A;  4GT6 A;  3P72 A;  5GS0 A;  4Q62 A;  3RFJ A;  1YRG A;  2Z64 A;  4LSX A;  3O53 A;  1OTN A;  4H09 A;  2CA6 A;  3VQ1 A;  3OGL B;  3UN9 A;  2OMU A;  3JB9 j;  4KNG A;  3WPI A;  5IJD A;  3UL9 A;  2OMX A;  2ID5 A;  2OMV A;  2OMT A;  4RCW A;  3ZYJ A;  4TZH A;  4PER A;  1PGV A;  4HQ1 A;  4Z61 C;  4BSS A;  3GOZ A;  4KXF B;  2Z7X A;  5AZ5 A;  1OGQ A;  2Z65 A;  3W3M A;  4R08 A;  5LFN A;  1P9A G;  2ASS B;  4CC4 A;  4PEQ B;  5GQR K;  5HZL B;  3ULU A;  3ZYO A;  1GWB A;  3WPF A;  4R6J A;  2P1Q B;  3G3A A;  3OJA B;  3PMH G;  4R5D A;  2Z81 A;  3DZE A;  4XSQ A;  3CIG A;  3ULV A;  2P1N B;  2XWT C;  3SB4 A;  2UZY A;  3VQ2 A;  3W3N A;  3ZYI A;  2V9S A;  5AWC A;  4UFR A;  3WPC A; 
#chains in the Genus database with same CATH homology
 4R5C A;  4M7E A;  4GLP A;  2WQW A;  4MQW X;  2WQX A;  3WN4 A;  4ARN A;  3W3L A;  1H6U A;  1DFJ I;  1W8A A;  4QXE A;  4LSX C;  4YEB B;  3RJ0 A;  3G06 A;  3UL8 A;  2WFH A;  2Y5Q A;  4KT1 A;  4R07 A;  4U06 A;  3ULA A;  1U0N D;  2ELL A;  3UL7 A;  4AW4 A;  1WWL A;  3ZYN A;  5IJB A;  1KOO A;  3CIY A;  3OGK B;  4U7L A;  4FHO A;  1OZN A;  1FO1 A;  5B4P A;  2JE0 A;  3G04 C;  4CIL A;  4K17 A;  1KOH A;  3RW6 A;  4CC4 C;  3OGM B;  4BSU A;  3G39 A;  1DCE A;  3REZ A;  5B0T A;  3TSR E;  2RA8 A;  2O6R A;  4J0M A;  4CP6 A;  4FCG A;  4L3A A;  1FT8 A;  2Q4G W;  3CVR A;  5B0N A;  4V2E A;  4RWT C;  4R6G A;  1XEC A;  3A79 B;  4I6J B;  3OJA A;  1JL5 A;  3O6N A;  4Z94 G;  1O6V A;  4FS7 A;  1SQ0 B;  2JE1 A;  4FMZ A;  5CMP A;  1A9N A;  1LTX A;  5FTT B;  3BZ5 A;  4R0A A;  4LI2 A;  4B8C D;  1H6T A;  4NKH A;  4M7E C;  2V70 A;  5AWB A;  5GS2 B;  3WPG A;  2Z62 A;  4G8A A;  4PSJ A;  4RCA B;  4LXR A;  3C6N B;  4FDW A;  5GMH A;  5D3I A;  1XKU A;  4CNM A;  4L3F A;  4R09 A;  1K5D C;  3E6J A;  4EZG A;  4Z79 A;  4V2D A;  3RFS A;  4J4L A;  3E3Z A;  4V2C A;  4AY9 X;  1OTO A;  4CNC A;  4C2B B;  3WPB A;  2O6S A;  2P1O B;  2Z82 A;  2XOT A;  5HDH A;  4U09 A;  2BEX A;  1IO0 A;  4OQT A;  2O6Q A;  2OMW A;  3W3J A;  4R6F A;  3RW7 A;  4LSA A;  1XCD A;  1XEU A;  4LSC A;  1OOK G;  3M18 A;  2WQV A;  4BV4 R;  4ARR A;  1QYY A;  1G9U A;  2P1P B;  4ECO A;  1D0B A;  1M0Z A;  3W3K A;  2IFG A;  5AWD A;  4Z64 C;  3W3G A;  1O6T A;  2Z66 A;  5AWA A;  4XGO A;  2R9U A;  5IYX C;  3RFE A;  2P1M B;  4P91 A;  1K5G C;  2BNH A;  1XWD C;  2JQD A;  3E4G A;  4MN8 B;  4ECN A;  3KJ4 A;  4R58 A;  3FXI A;  4P8S A;  2WQU A;  2AST B;  3E2J A;  1ZIW A;  2Z63 A;  5CMN A;  3WPH A;  4PQ8 A;  4C2A B;  5GMF A;  1P8V A;  2Z7X B;  3G3B A;  4WP6 A;  4Z8G A;  1O6S A;  2UZX A;  4IM6 A;  3WPE A;  3M19 A;  2RR6 A;  1P8T A;  5GMG A;  1M9L A;  4LI1 A;  2OMZ A;  1FQV A;  3RGX A;  2OMY A;  4BSR A;  4XOS A;  4Y61 B;  1A4Y A;  4WYK A;  4Q3I A;  2V9T B;  5IJC A;  4LXS A;  4PKI G;  4Q3G A;  3RGZ A;  2FT3 A;  3RIZ A;  2A0Z A;  1M10 B;  4NKG A;  5A5C A;  4U08 A;  4R6A A;  1FS2 A;  4FD0 A;  3C6P B;  4QBZ A;  1M9S A;  3C6O B;  4QC0 A;  1Z7X W;  1DS9 A;  1OTM A;  3WPD A;  4GT6 A;  3P72 A;  5GS0 A;  4Q62 A;  3RFJ A;  1YRG A;  2Z64 A;  4LSX A;  3O53 A;  1OTN A;  4H09 A;  2CA6 A;  3VQ1 A;  3OGL B;  3UN9 A;  2OMU A;  3JB9 j;  4KNG A;  3WPI A;  5IJD A;  3UL9 A;  2OMX A;  2ID5 A;  2OMV A;  2OMT A;  4RCW A;  3ZYJ A;  4TZH A;  4PER A;  1PGV A;  4HQ1 A;  4Z61 C;  4BSS A;  3GOZ A;  4KXF B;  2Z7X A;  5AZ5 A;  1OGQ A;  2Z65 A;  3W3M A;  4R08 A;  5LFN A;  1P9A G;  2ASS B;  4CC4 A;  4PEQ B;  5GQR K;  5HZL B;  3ULU A;  3ZYO A;  1GWB A;  3WPF A;  4R6J A;  2P1Q B;  3G3A A;  3OJA B;  3PMH G;  4R5D A;  2Z81 A;  3DZE A;  4XSQ A;  3CIG A;  3ULV A;  2P1N B;  2XWT C;  3SB4 A;  2UZY A;  3VQ2 A;  3W3N A;  3ZYI A;  2V9S A;  5AWC A;  4UFR A;  3WPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...