5B4PA

Complex structure of human c5a and its binding repebody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
254
structure length
254
Chain Sequence
ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLFLDFNQLQLPNGVFDKLTNLKELYLSPNQLQSLPDGVFDKLTNLTILGLDMNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLSLSYNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVGGPDSAKCSGSGKPVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/membrane protein
molecule keywords repebody
publication title Complex structure of human C5a and its binding repebody
rcsb
source organism Synthetic construct
total genus 55
structure length 254
sequence length 254
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5b4pA00
3C6NB 3C6OB 4KT1A 4R5DA 3RGZA 4FS7A 3RIZA 4U06A 4QXEA 5CMPA 1QYYA 3WPEA 1K5DC 2XWTC 1O6VA 4Q62A 1YRGA 3RFSA 4XSQA 3RW7A 4V2CA 3WPCA 1OTNA 1OTOA 4V2DA 3UL9A 3RGXA 4I6JB 4BV4R 4YEBB 2Z62A 2OMYA 3OGKB 4OQTA 4FCGA 3G3BA 4AY9X 4RCAB 1H6TA 3WPFA 4PSJA 4R0AA 2JE1A 2V9SA 2JE0A 2UZYA 3UN9A 5GS0A 1KOHA 4LSXA 2OMUA 3ZYNA 4MN8B 2Z64A 3ULVA 2ASTB 1M0ZA 3DZEA 3W3NA 5D3IA 4C2BB 1FO1A 2OMXA 2P1OB 4V2EA 4WP6A 4Z94G 4ECOA 4BSSA 4PKIG 3ZYIA 3ULUA 4G8AA 4NKGA 1M9SA 3E4GA 3G04C 1OOKG 4R6JA 2WQWA 1FQVA 1OZNA 5GS2B 3W3JA 4UFRA 2P1MB 1A4YA 1O6TA 2RR6A 2XOTA 4R6AA 1IO0A 4LI2A 2UZXA 4U7LA 3CVRA 3SB4A 3OJAA 2V9TB 1D0BA 3CIYA 3OJAB 1M10B 2Z66A 3WPDA 1H6UA 4L3FA 5IJCA 3W3KA 2IFGA 4CP6A 3CIGA 1XCDA 3WPBA 2ID5A 3WPIA 1P9AG 4LSCA 4BSRA 2OMWA 2ASSB 5AWDA 1GWBA 4C2AB 3P72A 4R09A 2ELLA 1DFJI 5IJBA 3G3AA 3WN4A 5GMGA 3WPHA 1WWLA 5AZ5A 2O6QA 3A79B 1P8VA 3VQ1A 2OMZA 2Z65A 2Z63A 4HQ1A 4PERA 4U08A 2Q4GW 4PEQB 1XKUA 3W3GA 3FXIA 4J4LA 4P91A 4RWTC 3UL8A 3PMHG 2P1PB 3JB9j 4M7EC 3GOZA 4TZHA 4Z79A 2O6RA 4MQWX 3UL7A 3ZYJA 4B8CD 5GMHA 2JQDA 4H09A 4CILA 1JL5A 4CNCA 4QBZA 5AWAA 4LXSA 4R6GA 5LFNA 2A0ZA 2BNHA 2P1QB 3TSRE 1FS2A 3BZ5A 4FDWA 5GMFA 2WQXA 5IYXC 4KXFB 5AWCA 3ULAA 1XWDC 4RCWA 1FT8A 5B4PA 4IM6A 4WYKA 3WPGA 2Y5QA 4Z64C 4R6FA 5HDHA 4FD0A 2OMTA 4U09A 4XGOA 1P8TA 3E6JA 1Z7XW 4Q3GA 4LI1A 2CA6A 3RFJA 4R08A 5CMNA 3RFEA 2Z81A 5FTTB 3RJ0A 4QC0A 3OGMB 4M7EA 3RW6A 3M18A 2V70A 4LXRA 5IJDA 2P1NB 4FHOA 3OGLB 2O6SA 1DS9A 2WQVA 4LSAA 4GLPA 1PGVA 3E2JA 2R9UA 5AWBA 3O53A 1SQ0B 5HZLB 4NKHA 2Z7XA 4R5CA 1W8AA 2Z7XB 3W3LA 1ZIWA 1U0ND 3REZA 3O6NA 4BSUA 4GT6A 4L3AA 4FMZA 2OMVA 4KNGA 2BEXA 1XECA 1LTXA 1KOOA 4P8SA 4Y61B 4Q3IA 4PQ8A 4K17A 3ZYOA 3E3ZA 4ARNA 3G39A 4CC4A 1M9LA 5B0NA 1DCEA 1G9UA 4Z8GA 1A9NA 2FT3A 1K5GC 4R07A 4CNMA 1XEUA 3VQ2A 2WQUA 2WFHA 5B0TA 2Z82A 3KJ4A 5A5CA 4J0MA 3G06A 1O6SA 1OTMA 4Z61C 5GQRK 4LSXC 3C6PB 2RA8A 3W3MA 4XOSA 4R58A 3M19A 4ECNA 4ARRA 1OGQA 4CC4C 4EZGA 4AW4A
chains in the Genus database with same CATH superfamily
3C6NB 3C6OB 4KT1A 4R5DA 3RGZA 4FS7A 3RIZA 4U06A 4QXEA 5CMPA 1QYYA 3WPEA 1K5DC 2XWTC 1O6VA 4Q62A 1YRGA 3RFSA 4XSQA 3RW7A 4V2CA 3WPCA 1OTNA 1OTOA 4V2DA 3UL9A 3RGXA 4I6JB 4BV4R 4YEBB 2Z62A 2OMYA 3OGKB 4OQTA 4FCGA 3G3BA 4AY9X 4RCAB 1H6TA 3WPFA 4PSJA 4R0AA 2JE1A 2V9SA 2JE0A 2UZYA 3UN9A 5GS0A 1KOHA 4LSXA 2OMUA 3ZYNA 4MN8B 2Z64A 3ULVA 2ASTB 1M0ZA 3DZEA 4NZTM 3W3NA 5D3IA 4C2BB 1FO1A 2OMXA 2P1OB 4V2EA 4WP6A 4Z94G 4ECOA 4BSSA 4PKIG 3ZYIA 3ULUA 4G8AA 4NKGA 1M9SA 3E4GA 3G04C 1OOKG 4R6JA 2WQWA 1FQVA 1OZNA 5GS2B 3W3JA 4UFRA 2P1MB 1A4YA 1O6TA 2RR6A 2XOTA 4R6AA 1IO0A 4LI2A 2UZXA 4U7LA 3CVRA 3SB4A 3OJAA 2V9TB 1D0BA 3CIYA 3OJAB 1M10B 2Z66A 3WPDA 1H6UA 4L3FA 5IJCA 3W3KA 2IFGA 4CP6A 3CIGA 1XCDA 3WPBA 2ID5A 3WPIA 1P9AG 4LSCA 4BSRA 2OMWA 2ASSB 5AWDA 1GWBA 4C2AB 3P72A 4R09A 2ELLA 1DFJI 5IJBA 3G3AA 3WN4A 5GMGA 3WPHA 1WWLA 5AZ5A 2O6QA 3A79B 1P8VA 3VQ1A 2OMZA 2Z65A 2Z63A 4HQ1A 4PERA 4U08A 2Q4GW 4PEQB 1XKUA 3W3GA 3FXIA 4J4LA 4P91A 4RWTC 3UL8A 3PMHG 2P1PB 3JB9j 4M7EC 3GOZA 4TZHA 4Z79A 2O6RA 4MQWX 3UL7A 3ZYJA 4B8CD 5GMHA 2JQDA 4H09A 4CILA 1JL5A 4CNCA 4QBZA 5AWAA 4LXSA 4R6GA 5LFNA 2A0ZA 2BNHA 2P1QB 3TSRE 1FS2A 3BZ5A 4FDWA 5GMFA 2WQXA 5IYXC 4KXFB 5AWCA 3ULAA 1XWDC 4RCWA 1FT8A 5B4PA 4IM6A 4WYKA 4NZRM 3WPGA 2Y5QA 4Z64C 4R6FA 5HDHA 4FD0A 2OMTA 4U09A 4XGOA 1P8TA 3E6JA 1Z7XW 4Q3GA 4LI1A 2CA6A 3RFJA 4R08A 5CMNA 3RFEA 2Z81A 5FTTB 3RJ0A 4QC0A 3OGMB 4M7EA 3RW6A 3M18A 2V70A 4LXRA 5IJDA 2P1NB 4FHOA 3OGLB 2O6SA 1DS9A 2WQVA 4LSAA 4GLPA 1PGVA 3E2JA 2R9UA 5AWBA 3O53A 1SQ0B 5HZLB 4NKHA 2Z7XA 4R5CA 1W8AA 2Z7XB 3W3LA 1ZIWA 1U0ND 3REZA 3O6NA 4BSUA 4GT6A 4L3AA 4FMZA 2OMVA 4KNGA 2BEXA 1XECA 1LTXA 1KOOA 4P8SA 4Y61B 4Q3IA 4PQ8A 4K17A 3ZYOA 3E3ZA 4ARNA 3G39A 4CC4A 1M9LA 5B0NA 1DCEA 1G9UA 4Z8GA 1A9NA 2FT3A 1K5GC 4R07A 4CNMA 1XEUA 3VQ2A 2WQUA 2WFHA 5B0TA 2Z82A 3KJ4A 5A5CA 4J0MA 3G06A 1O6SA 1OTMA 4Z61C 5GQRK 4LSXC 3C6PB 2RA8A 3W3MA 4XOSA 4R58A 3M19A 4ECNA 4ARRA 1OGQA 4CC4C 4EZGA 4AW4A
chains in the Genus database with same CATH topology
3C6NB 3C6OB 4KT1A 4R5DA 3RGZA 4FS7A 3RIZA 4U06A 4QXEA 5CMPA 1QYYA 3WPEA 1K5DC 2XWTC 1O6VA 4Q62A 1YRGA 3RFSA 4XSQA 3RW7A 4V2CA 3WPCA 1OTNA 1OTOA 4V2DA 3UL9A 3RGXA 4I6JB 4BV4R 4YEBB 2Z62A 2OMYA 3OGKB 4OQTA 4FCGA 3G3BA 4AY9X 4RCAB 1H6TA 3WPFA 4PSJA 4R0AA 2JE1A 2V9SA 2JE0A 2UZYA 3UN9A 5GS0A 1KOHA 4LSXA 2OMUA 3ZYNA 4MN8B 2Z64A 3ULVA 2ASTB 1M0ZA 3DZEA 3W3NA 5D3IA 4C2BB 1FO1A 2OMXA 2P1OB 4V2EA 4WP6A 4Z94G 4ECOA 4BSSA 4PKIG 3ZYIA 3ULUA 4G8AA 4NKGA 1M9SA 3E4GA 3G04C 1OOKG 4R6JA 2WQWA 1FQVA 1OZNA 5GS2B 3W3JA 4UFRA 2P1MB 1A4YA 1O6TA 2RR6A 2XOTA 4R6AA 1IO0A 4LI2A 2UZXA 4U7LA 3CVRA 3SB4A 3OJAA 2V9TB 1D0BA 3CIYA 3OJAB 1M10B 2Z66A 3WPDA 1H6UA 4L3FA 5IJCA 3W3KA 2IFGA 4CP6A 3CIGA 1XCDA 3WPBA 2ID5A 3WPIA 1P9AG 4LSCA 4BSRA 2OMWA 2ASSB 5AWDA 1GWBA 4C2AB 3P72A 4R09A 2ELLA 1DFJI 5IJBA 3G3AA 3WN4A 5GMGA 3WPHA 1WWLA 5AZ5A 2O6QA 3A79B 1P8VA 3VQ1A 2OMZA 2Z65A 2Z63A 4HQ1A 4PERA 4U08A 2Q4GW 4PEQB 1XKUA 3W3GA 3FXIA 4J4LA 4P91A 4RWTC 3UL8A 3PMHG 2P1PB 3JB9j 4M7EC 3GOZA 4TZHA 4Z79A 2O6RA 4MQWX 3UL7A 3ZYJA 4B8CD 5GMHA 2JQDA 4H09A 4CILA 1JL5A 4CNCA 4QBZA 5AWAA 4LXSA 4R6GA 5LFNA 2A0ZA 2BNHA 2P1QB 3TSRE 1FS2A 3BZ5A 4FDWA 5GMFA 2WQXA 5IYXC 4KXFB 5AWCA 3ULAA 1XWDC 4RCWA 1FT8A 5B4PA 4IM6A 4WYKA 3WPGA 2Y5QA 4Z64C 4R6FA 5HDHA 4FD0A 2OMTA 4U09A 4XGOA 1P8TA 3E6JA 1Z7XW 4Q3GA 4LI1A 2CA6A 3RFJA 4R08A 5CMNA 3RFEA 2Z81A 5FTTB 3RJ0A 4QC0A 3OGMB 4M7EA 3RW6A 3M18A 2V70A 4LXRA 5IJDA 2P1NB 4FHOA 3OGLB 2O6SA 1DS9A 2WQVA 4LSAA 4GLPA 1PGVA 3E2JA 2R9UA 5AWBA 3O53A 1SQ0B 5HZLB 4NKHA 2Z7XA 4R5CA 1W8AA 2Z7XB 3W3LA 1ZIWA 1U0ND 3REZA 3O6NA 4BSUA 4GT6A 4L3AA 4FMZA 2OMVA 4KNGA 2BEXA 1XECA 1LTXA 1KOOA 4P8SA 4Y61B 4Q3IA 4PQ8A 4K17A 3ZYOA 3E3ZA 4ARNA 3G39A 4CC4A 1M9LA 5B0NA 1DCEA 1G9UA 4Z8GA 1A9NA 2FT3A 1K5GC 4R07A 4CNMA 1XEUA 3VQ2A 2WQUA 2WFHA 5B0TA 2Z82A 3KJ4A 5A5CA 4J0MA 3G06A 1O6SA 1OTMA 4Z61C 5GQRK 4LSXC 3C6PB 2RA8A 3W3MA 4XOSA 4R58A 3M19A 4ECNA 4ARRA 1OGQA 4CC4C 4EZGA 4AW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6N B;  3C6O B;  4KT1 A;  4R5D A;  3RGZ A;  4FS7 A;  3RIZ A;  4U06 A;  4QXE A;  5CMP A;  1QYY A;  3WPE A;  1K5D C;  2XWT C;  1O6V A;  4Q62 A;  1YRG A;  3RFS A;  4XSQ A;  3RW7 A;  4V2C A;  3WPC A;  1OTN A;  1OTO A;  4V2D A;  3UL9 A;  3RGX A;  4I6J B;  4BV4 R;  4YEB B;  2Z62 A;  2OMY A;  3OGK B;  4OQT A;  4FCG A;  3G3B A;  4AY9 X;  4RCA B;  1H6T A;  3WPF A;  4PSJ A;  4R0A A;  2JE1 A;  2V9S A;  2JE0 A;  2UZY A;  3UN9 A;  5GS0 A;  1KOH A;  4LSX A;  2OMU A;  3ZYN A;  4MN8 B;  2Z64 A;  3ULV A;  2AST B;  1M0Z A;  3DZE A;  3W3N A;  5D3I A;  4C2B B;  1FO1 A;  2OMX A;  2P1O B;  4V2E A;  4WP6 A;  4Z94 G;  4ECO A;  4BSS A;  4PKI G;  3ZYI A;  3ULU A;  4G8A A;  4NKG A;  1M9S A;  3E4G A;  3G04 C;  1OOK G;  4R6J A;  2WQW A;  1FQV A;  1OZN A;  5GS2 B;  3W3J A;  4UFR A;  2P1M B;  1A4Y A;  1O6T A;  2RR6 A;  2XOT A;  4R6A A;  1IO0 A;  4LI2 A;  2UZX A;  4U7L A;  3CVR A;  3SB4 A;  3OJA A;  2V9T B;  1D0B A;  3CIY A;  3OJA B;  1M10 B;  2Z66 A;  3WPD A;  1H6U A;  4L3F A;  5IJC A;  3W3K A;  2IFG A;  4CP6 A;  3CIG A;  1XCD A;  3WPB A;  2ID5 A;  3WPI A;  1P9A G;  4LSC A;  4BSR A;  2OMW A;  2ASS B;  5AWD A;  1GWB A;  4C2A B;  3P72 A;  4R09 A;  2ELL A;  1DFJ I;  5IJB A;  3G3A A;  3WN4 A;  5GMG A;  3WPH A;  1WWL A;  5AZ5 A;  2O6Q A;  3A79 B;  1P8V A;  3VQ1 A;  2OMZ A;  2Z65 A;  2Z63 A;  4HQ1 A;  4PER A;  4U08 A;  2Q4G W;  4PEQ B;  1XKU A;  3W3G A;  3FXI A;  4J4L A;  4P91 A;  4RWT C;  3UL8 A;  3PMH G;  2P1P B;  3JB9 j;  4M7E C;  3GOZ A;  4TZH A;  4Z79 A;  2O6R A;  4MQW X;  3UL7 A;  3ZYJ A;  4B8C D;  5GMH A;  2JQD A;  4H09 A;  4CIL A;  1JL5 A;  4CNC A;  4QBZ A;  5AWA A;  4LXS A;  4R6G A;  5LFN A;  2A0Z A;  2BNH A;  2P1Q B;  3TSR E;  1FS2 A;  3BZ5 A;  4FDW A;  5GMF A;  2WQX A;  5IYX C;  4KXF B;  5AWC A;  3ULA A;  1XWD C;  4RCW A;  1FT8 A;  5B4P A;  4IM6 A;  4WYK A;  3WPG A;  2Y5Q A;  4Z64 C;  4R6F A;  5HDH A;  4FD0 A;  2OMT A;  4U09 A;  4XGO A;  1P8T A;  3E6J A;  1Z7X W;  4Q3G A;  4LI1 A;  2CA6 A;  3RFJ A;  4R08 A;  5CMN A;  3RFE A;  2Z81 A;  5FTT B;  3RJ0 A;  4QC0 A;  3OGM B;  4M7E A;  3RW6 A;  3M18 A;  2V70 A;  4LXR A;  5IJD A;  2P1N B;  4FHO A;  3OGL B;  2O6S A;  1DS9 A;  2WQV A;  4LSA A;  4GLP A;  1PGV A;  3E2J A;  2R9U A;  5AWB A;  3O53 A;  1SQ0 B;  5HZL B;  4NKH A;  2Z7X A;  4R5C A;  1W8A A;  2Z7X B;  3W3L A;  1ZIW A;  1U0N D;  3REZ A;  3O6N A;  4BSU A;  4GT6 A;  4L3A A;  4FMZ A;  2OMV A;  4KNG A;  2BEX A;  1XEC A;  1LTX A;  1KOO A;  4P8S A;  4Y61 B;  4Q3I A;  4PQ8 A;  4K17 A;  3ZYO A;  3E3Z A;  4ARN A;  3G39 A;  4CC4 A;  1M9L A;  5B0N A;  1DCE A;  1G9U A;  4Z8G A;  1A9N A;  2FT3 A;  1K5G C;  4R07 A;  4CNM A;  1XEU A;  3VQ2 A;  2WQU A;  2WFH A;  5B0T A;  2Z82 A;  3KJ4 A;  5A5C A;  4J0M A;  3G06 A;  1O6S A;  1OTM A;  4Z61 C;  5GQR K;  4LSX C;  3C6P B;  2RA8 A;  3W3M A;  4XOS A;  4R58 A;  3M19 A;  4ECN A;  4ARR A;  1OGQ A;  4CC4 C;  4EZG A;  4AW4 A; 
#chains in the Genus database with same CATH topology
 3C6N B;  3C6O B;  4KT1 A;  4R5D A;  3RGZ A;  4FS7 A;  3RIZ A;  4U06 A;  4QXE A;  5CMP A;  1QYY A;  3WPE A;  1K5D C;  2XWT C;  1O6V A;  4Q62 A;  1YRG A;  3RFS A;  4XSQ A;  3RW7 A;  4V2C A;  3WPC A;  1OTN A;  1OTO A;  4V2D A;  3UL9 A;  3RGX A;  4I6J B;  4BV4 R;  4YEB B;  2Z62 A;  2OMY A;  3OGK B;  4OQT A;  4FCG A;  3G3B A;  4AY9 X;  4RCA B;  1H6T A;  3WPF A;  4PSJ A;  4R0A A;  2JE1 A;  2V9S A;  2JE0 A;  2UZY A;  3UN9 A;  5GS0 A;  1KOH A;  4LSX A;  2OMU A;  3ZYN A;  4MN8 B;  2Z64 A;  3ULV A;  2AST B;  1M0Z A;  3DZE A;  4NZT M;  3W3N A;  5D3I A;  4C2B B;  1FO1 A;  2OMX A;  2P1O B;  4V2E A;  4WP6 A;  4Z94 G;  4ECO A;  4BSS A;  4PKI G;  3ZYI A;  3ULU A;  4G8A A;  4NKG A;  1M9S A;  3E4G A;  3G04 C;  1OOK G;  4R6J A;  2WQW A;  1FQV A;  1OZN A;  5GS2 B;  3W3J A;  4UFR A;  2P1M B;  1A4Y A;  1O6T A;  2RR6 A;  2XOT A;  4R6A A;  1IO0 A;  4LI2 A;  2UZX A;  4U7L A;  3CVR A;  3SB4 A;  3OJA A;  2V9T B;  1D0B A;  3CIY A;  3OJA B;  1M10 B;  2Z66 A;  3WPD A;  1H6U A;  4L3F A;  5IJC A;  3W3K A;  2IFG A;  4CP6 A;  3CIG A;  1XCD A;  3WPB A;  2ID5 A;  3WPI A;  1P9A G;  4LSC A;  4BSR A;  2OMW A;  2ASS B;  5AWD A;  1GWB A;  4C2A B;  3P72 A;  4R09 A;  2ELL A;  1DFJ I;  5IJB A;  3G3A A;  3WN4 A;  5GMG A;  3WPH A;  1WWL A;  5AZ5 A;  2O6Q A;  3A79 B;  1P8V A;  3VQ1 A;  2OMZ A;  2Z65 A;  2Z63 A;  4HQ1 A;  4PER A;  4U08 A;  2Q4G W;  4PEQ B;  1XKU A;  3W3G A;  3FXI A;  4J4L A;  4P91 A;  4RWT C;  3UL8 A;  3PMH G;  2P1P B;  3JB9 j;  4M7E C;  3GOZ A;  4TZH A;  4Z79 A;  2O6R A;  4MQW X;  3UL7 A;  3ZYJ A;  4B8C D;  5GMH A;  2JQD A;  4H09 A;  4CIL A;  1JL5 A;  4CNC A;  4QBZ A;  5AWA A;  4LXS A;  4R6G A;  5LFN A;  2A0Z A;  2BNH A;  2P1Q B;  3TSR E;  1FS2 A;  3BZ5 A;  4FDW A;  5GMF A;  2WQX A;  5IYX C;  4KXF B;  5AWC A;  3ULA A;  1XWD C;  4RCW A;  1FT8 A;  5B4P A;  4IM6 A;  4WYK A;  4NZR M;  3WPG A;  2Y5Q A;  4Z64 C;  4R6F A;  5HDH A;  4FD0 A;  2OMT A;  4U09 A;  4XGO A;  1P8T A;  3E6J A;  1Z7X W;  4Q3G A;  4LI1 A;  2CA6 A;  3RFJ A;  4R08 A;  5CMN A;  3RFE A;  2Z81 A;  5FTT B;  3RJ0 A;  4QC0 A;  3OGM B;  4M7E A;  3RW6 A;  3M18 A;  2V70 A;  4LXR A;  5IJD A;  2P1N B;  4FHO A;  3OGL B;  2O6S A;  1DS9 A;  2WQV A;  4LSA A;  4GLP A;  1PGV A;  3E2J A;  2R9U A;  5AWB A;  3O53 A;  1SQ0 B;  5HZL B;  4NKH A;  2Z7X A;  4R5C A;  1W8A A;  2Z7X B;  3W3L A;  1ZIW A;  1U0N D;  3REZ A;  3O6N A;  4BSU A;  4GT6 A;  4L3A A;  4FMZ A;  2OMV A;  4KNG A;  2BEX A;  1XEC A;  1LTX A;  1KOO A;  4P8S A;  4Y61 B;  4Q3I A;  4PQ8 A;  4K17 A;  3ZYO A;  3E3Z A;  4ARN A;  3G39 A;  4CC4 A;  1M9L A;  5B0N A;  1DCE A;  1G9U A;  4Z8G A;  1A9N A;  2FT3 A;  1K5G C;  4R07 A;  4CNM A;  1XEU A;  3VQ2 A;  2WQU A;  2WFH A;  5B0T A;  2Z82 A;  3KJ4 A;  5A5C A;  4J0M A;  3G06 A;  1O6S A;  1OTM A;  4Z61 C;  5GQR K;  4LSX C;  3C6P B;  2RA8 A;  3W3M A;  4XOS A;  4R58 A;  3M19 A;  4ECN A;  4ARR A;  1OGQ A;  4CC4 C;  4EZG A;  4AW4 A; 
#chains in the Genus database with same CATH homology
 3C6N B;  3C6O B;  4KT1 A;  4R5D A;  3RGZ A;  4FS7 A;  3RIZ A;  4U06 A;  4QXE A;  5CMP A;  1QYY A;  3WPE A;  1K5D C;  2XWT C;  1O6V A;  4Q62 A;  1YRG A;  3RFS A;  4XSQ A;  3RW7 A;  4V2C A;  3WPC A;  1OTN A;  1OTO A;  4V2D A;  3UL9 A;  3RGX A;  4I6J B;  4BV4 R;  4YEB B;  2Z62 A;  2OMY A;  3OGK B;  4OQT A;  4FCG A;  3G3B A;  4AY9 X;  4RCA B;  1H6T A;  3WPF A;  4PSJ A;  4R0A A;  2JE1 A;  2V9S A;  2JE0 A;  2UZY A;  3UN9 A;  5GS0 A;  1KOH A;  4LSX A;  2OMU A;  3ZYN A;  4MN8 B;  2Z64 A;  3ULV A;  2AST B;  1M0Z A;  3DZE A;  3W3N A;  5D3I A;  4C2B B;  1FO1 A;  2OMX A;  2P1O B;  4V2E A;  4WP6 A;  4Z94 G;  4ECO A;  4BSS A;  4PKI G;  3ZYI A;  3ULU A;  4G8A A;  4NKG A;  1M9S A;  3E4G A;  3G04 C;  1OOK G;  4R6J A;  2WQW A;  1FQV A;  1OZN A;  5GS2 B;  3W3J A;  4UFR A;  2P1M B;  1A4Y A;  1O6T A;  2RR6 A;  2XOT A;  4R6A A;  1IO0 A;  4LI2 A;  2UZX A;  4U7L A;  3CVR A;  3SB4 A;  3OJA A;  2V9T B;  1D0B A;  3CIY A;  3OJA B;  1M10 B;  2Z66 A;  3WPD A;  1H6U A;  4L3F A;  5IJC A;  3W3K A;  2IFG A;  4CP6 A;  3CIG A;  1XCD A;  3WPB A;  2ID5 A;  3WPI A;  1P9A G;  4LSC A;  4BSR A;  2OMW A;  2ASS B;  5AWD A;  1GWB A;  4C2A B;  3P72 A;  4R09 A;  2ELL A;  1DFJ I;  5IJB A;  3G3A A;  3WN4 A;  5GMG A;  3WPH A;  1WWL A;  5AZ5 A;  2O6Q A;  3A79 B;  1P8V A;  3VQ1 A;  2OMZ A;  2Z65 A;  2Z63 A;  4HQ1 A;  4PER A;  4U08 A;  2Q4G W;  4PEQ B;  1XKU A;  3W3G A;  3FXI A;  4J4L A;  4P91 A;  4RWT C;  3UL8 A;  3PMH G;  2P1P B;  3JB9 j;  4M7E C;  3GOZ A;  4TZH A;  4Z79 A;  2O6R A;  4MQW X;  3UL7 A;  3ZYJ A;  4B8C D;  5GMH A;  2JQD A;  4H09 A;  4CIL A;  1JL5 A;  4CNC A;  4QBZ A;  5AWA A;  4LXS A;  4R6G A;  5LFN A;  2A0Z A;  2BNH A;  2P1Q B;  3TSR E;  1FS2 A;  3BZ5 A;  4FDW A;  5GMF A;  2WQX A;  5IYX C;  4KXF B;  5AWC A;  3ULA A;  1XWD C;  4RCW A;  1FT8 A;  5B4P A;  4IM6 A;  4WYK A;  3WPG A;  2Y5Q A;  4Z64 C;  4R6F A;  5HDH A;  4FD0 A;  2OMT A;  4U09 A;  4XGO A;  1P8T A;  3E6J A;  1Z7X W;  4Q3G A;  4LI1 A;  2CA6 A;  3RFJ A;  4R08 A;  5CMN A;  3RFE A;  2Z81 A;  5FTT B;  3RJ0 A;  4QC0 A;  3OGM B;  4M7E A;  3RW6 A;  3M18 A;  2V70 A;  4LXR A;  5IJD A;  2P1N B;  4FHO A;  3OGL B;  2O6S A;  1DS9 A;  2WQV A;  4LSA A;  4GLP A;  1PGV A;  3E2J A;  2R9U A;  5AWB A;  3O53 A;  1SQ0 B;  5HZL B;  4NKH A;  2Z7X A;  4R5C A;  1W8A A;  2Z7X B;  3W3L A;  1ZIW A;  1U0N D;  3REZ A;  3O6N A;  4BSU A;  4GT6 A;  4L3A A;  4FMZ A;  2OMV A;  4KNG A;  2BEX A;  1XEC A;  1LTX A;  1KOO A;  4P8S A;  4Y61 B;  4Q3I A;  4PQ8 A;  4K17 A;  3ZYO A;  3E3Z A;  4ARN A;  3G39 A;  4CC4 A;  1M9L A;  5B0N A;  1DCE A;  1G9U A;  4Z8G A;  1A9N A;  2FT3 A;  1K5G C;  4R07 A;  4CNM A;  1XEU A;  3VQ2 A;  2WQU A;  2WFH A;  5B0T A;  2Z82 A;  3KJ4 A;  5A5C A;  4J0M A;  3G06 A;  1O6S A;  1OTM A;  4Z61 C;  5GQR K;  4LSX C;  3C6P B;  2RA8 A;  3W3M A;  4XOS A;  4R58 A;  3M19 A;  4ECN A;  4ARR A;  1OGQ A;  4CC4 C;  4EZG A;  4AW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...