5B4PA

Complex structure of human c5a and its binding repebody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
254
structure length
254
Chain Sequence
b'ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLFLDFNQLQLPNGVFDKLTNLKELYLSPNQLQSLPDGVFDKLTNLTILGLDMNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLSLSYNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVGGPDSAKCSGSGKPVRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords repebody
publication title Complex structure of human C5a and its binding repebody
rcsb
source organism Synthetic construct
molecule tags Signaling protein/membrane protein
total genus 55
structure length 254
sequence length 254
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5b4pA00
4L3AA 4LSXC 3W3GA 4XSQA 2P1QB 4CC4A 1M9LA 5IJDA 2Z81A 2WQUA 3CIGA 5IJCA 4BV4R 5FTTB 3PMHG 1XWDC 4V2EA 1O6VA 2OMVA 3CVRA 3E4GA 1DFJI 1FQVA 1IO0A 2ASTB 4PQ8A 2V70A 3DZEA 3WPHA 5CMNA 1OTOA 4P91A 4U06A 4B8CD 1XECA 3C6OB 5HZLB 4FDWA 1O6SA 4Z61C 5B0TA 4RCAB 4Z64C 2Z63A 2OMZA 5AWDA 2JE0A 4G8AA 4LSCA 4FS7A 2WQWA 5B4PA 3W3JA 2OMXA 2P1PB 3G3AA 3VQ2A 3ZYJA 4PSJA 1PGVA 5IYXC 4GT6A 2O6QA 3C6PB 4U08A 2P1MB 1W8AA 4R07A 4CNMA 3WPEA 3OJAB 4CILA 4L3FA 4KXFB 4J0MA 4Z94G 4MQWX 2Z62A 3CIYA 2WFHA 3FXIA 3UN9A 3C6NB 3ZYNA 1KOHA 3OGMB 1SQ0B 2Z65A 3ULVA 4WYKA 1Z7XW 3G3BA 5GQRK 1XEUA 1OOKG 3RFJA 4Q3IA 5GS0A 3KJ4A 2ELLA 4R09A 4CC4C 4CNCA 4R08A 4Z79A 1A4YA 2ID5A 4LI2A 3BZ5A 4R6AA 1DS9A 3WPGA 3W3LA 4RWTC 3OJAA 2Y5QA 1YRGA 3WPFA 1P8TA 4R6GA 3OGLB 2OMYA 4IM6A 2XOTA 2OMUA 2RR6A 3G39A 4H09A 4R0AA 4AY9X 4C2AB 2CA6A 5AWBA 2BEXA 4BSUA 4QXEA 3RW7A 1O6TA 2Z64A 2Z7XA 2FT3A 2A0ZA 3W3NA 3RFEA 3OGKB 3E3ZA 2XWTC 4U7LA 4BSRA 3A79B 3RIZA 4C2BB 3G04C 3W3MA 1OTNA 3ULAA 4CP6A 1WWLA 4Q3GA 4V2DA 3RFSA 5GS2B 4KNGA 4KT1A 4Q62A 1JL5A 4LXRA 5GMHA 4GLPA 4NKGA 2Q4GW 4QBZA 1XKUA 3ULUA 1GWBA 4ECNA 4NKHA 2V9SA 3UL8A 1XCDA 5GMFA 1U0ND 4R6FA 4U09A 1DCEA 1KOOA 5AWCA 1M10B 4M7EA 2UZYA 4Y61B 5A5CA 4FD0A 1M0ZA 5HDHA 2O6SA 4LXSA 1H6TA 2Z66A 4WP6A 2Z7XB 4BSSA 1ZIWA 3JB9j 4PKIG 4AW4A 4RCWA 4ARNA 3WN4A 4R58A 2BNHA 1QYYA 2UZXA 3E2JA 4QC0A 3RW6A 1H6UA 4V2CA 1LTXA 5D3IA 2OMWA 4Z8GA 4XGOA 4LSXA 3P72A 3UL7A 1FT8A 3G06A 2P1OB 5AZ5A 3TSRE 4HQ1A 5AWAA 1M9SA 1G9UA 2WQXA 4R6JA 4TZHA 3ZYIA 3WPCA 3REZA 3WPDA 2OMTA 3O53A 3E6JA 3M18A 4EZGA 2P1NB 3RGXA 5GMGA 2WQVA 4ECOA 1FS2A 4ARRA 4YEBB 2ASSB 4J4LA 4R5CA 4FMZA 1OGQA 4UFRA 5CMPA 1OTMA 3VQ1A 4R5DA 2JE1A 1P9AG 2V9TB 1FO1A 3WPBA 1OZNA 2O6RA 4PERA 3O6NA 3W3KA 3GOZA 1A9NA 4MN8B 4FHOA 5IJBA 4M7EC 5B0NA 3WPIA 5LFNA 4P8SA 1P8VA 3RJ0A 4PEQB 1D0BA 2Z82A 4I6JB 4FCGA 3RGZA 3ZYOA 2IFGA 4OQTA 1K5DC 4XOSA 1K5GC 4LI1A 4LSAA 3M19A 2JQDA 2RA8A 3UL9A 2R9UA 4K17A 3SB4A
chains in the Genus database with same CATH superfamily
4L3AA 4LSXC 3W3GA 4XSQA 2P1QB 4CC4A 1M9LA 5IJDA 2Z81A 2WQUA 3CIGA 5IJCA 4BV4R 5FTTB 3PMHG 1XWDC 4V2EA 1O6VA 2OMVA 3CVRA 3E4GA 1DFJI 1FQVA 1IO0A 2ASTB 4PQ8A 2V70A 3DZEA 3WPHA 5CMNA 1OTOA 4P91A 4U06A 4B8CD 1XECA 3C6OB 5HZLB 4FDWA 1O6SA 4Z61C 5B0TA 4RCAB 4Z64C 2Z63A 2OMZA 5AWDA 2JE0A 4G8AA 4LSCA 4FS7A 2WQWA 5B4PA 3W3JA 2OMXA 2P1PB 3G3AA 3VQ2A 3ZYJA 4PSJA 1PGVA 5IYXC 4GT6A 2O6QA 3C6PB 4U08A 2P1MB 1W8AA 4R07A 4CNMA 3WPEA 3OJAB 4CILA 4L3FA 4KXFB 4J0MA 4Z94G 4MQWX 2Z62A 3CIYA 2WFHA 3FXIA 3UN9A 3C6NB 3ZYNA 1KOHA 3OGMB 1SQ0B 2Z65A 3ULVA 4WYKA 1Z7XW 3G3BA 5GQRK 1XEUA 1OOKG 3RFJA 4Q3IA 5GS0A 3KJ4A 2ELLA 4R09A 4CC4C 4CNCA 4R08A 4Z79A 1A4YA 2ID5A 4LI2A 3BZ5A 4R6AA 1DS9A 3WPGA 3W3LA 4RWTC 3OJAA 2Y5QA 1YRGA 3WPFA 1P8TA 4R6GA 3OGLB 2OMYA 4IM6A 2XOTA 2OMUA 4NZTM 2RR6A 3G39A 4H09A 4R0AA 4AY9X 4C2AB 2CA6A 5AWBA 2BEXA 4BSUA 4QXEA 4NZRM 3RW7A 1O6TA 2Z64A 2Z7XA 2FT3A 2A0ZA 3W3NA 3RFEA 3OGKB 3E3ZA 2XWTC 4U7LA 4BSRA 3A79B 3RIZA 4C2BB 3G04C 3W3MA 1OTNA 3ULAA 4CP6A 1WWLA 4Q3GA 4V2DA 3RFSA 5GS2B 4KNGA 4KT1A 4Q62A 1JL5A 4LXRA 5GMHA 4GLPA 4NKGA 2Q4GW 4QBZA 1XKUA 3ULUA 1GWBA 4ECNA 4NKHA 2V9SA 3UL8A 1XCDA 5GMFA 1U0ND 4R6FA 4U09A 1DCEA 1KOOA 5AWCA 1M10B 4M7EA 2UZYA 4Y61B 5A5CA 4FD0A 1M0ZA 5HDHA 2O6SA 4LXSA 1H6TA 2Z66A 4WP6A 2Z7XB 4BSSA 1ZIWA 3JB9j 4PKIG 4AW4A 4RCWA 4ARNA 3WN4A 4R58A 2BNHA 1QYYA 2UZXA 3E2JA 4QC0A 3RW6A 1H6UA 4V2CA 1LTXA 5D3IA 2OMWA 4Z8GA 4XGOA 4LSXA 3P72A 3UL7A 1FT8A 3G06A 2P1OB 5AZ5A 3TSRE 4HQ1A 5AWAA 1M9SA 1G9UA 2WQXA 4R6JA 4TZHA 3ZYIA 3WPCA 3REZA 3WPDA 2OMTA 3O53A 3E6JA 3M18A 4EZGA 2P1NB 3RGXA 5GMGA 2WQVA 4ECOA 1FS2A 4ARRA 4YEBB 2ASSB 4J4LA 4R5CA 4FMZA 1OGQA 4UFRA 5CMPA 1OTMA 3VQ1A 4R5DA 2JE1A 1P9AG 2V9TB 1FO1A 3WPBA 1OZNA 2O6RA 4PERA 3O6NA 3W3KA 3GOZA 1A9NA 4MN8B 4FHOA 5IJBA 4M7EC 5B0NA 3WPIA 5LFNA 4P8SA 1P8VA 3RJ0A 4PEQB 1D0BA 2Z82A 4I6JB 4FCGA 3RGZA 3ZYOA 2IFGA 4OQTA 1K5DC 4XOSA 1K5GC 4LI1A 4LSAA 3M19A 2JQDA 2RA8A 3UL9A 2R9UA 4K17A 3SB4A
chains in the Genus database with same CATH topology
4L3AA 4LSXC 3W3GA 4XSQA 2P1QB 4CC4A 1M9LA 5IJDA 2Z81A 2WQUA 3CIGA 5IJCA 4BV4R 5FTTB 3PMHG 1XWDC 4V2EA 1O6VA 2OMVA 3CVRA 3E4GA 1DFJI 1FQVA 1IO0A 2ASTB 4PQ8A 2V70A 3DZEA 3WPHA 5CMNA 1OTOA 4P91A 4U06A 4B8CD 1XECA 3C6OB 5HZLB 4FDWA 1O6SA 4Z61C 5B0TA 4RCAB 4Z64C 2Z63A 2OMZA 5AWDA 2JE0A 4G8AA 4LSCA 4FS7A 2WQWA 5B4PA 3W3JA 2OMXA 2P1PB 3G3AA 3VQ2A 3ZYJA 4PSJA 1PGVA 5IYXC 4GT6A 2O6QA 3C6PB 4U08A 2P1MB 1W8AA 4R07A 4CNMA 3WPEA 3OJAB 4CILA 4L3FA 4KXFB 4J0MA 4Z94G 4MQWX 2Z62A 3CIYA 2WFHA 3FXIA 3UN9A 3C6NB 3ZYNA 1KOHA 3OGMB 1SQ0B 2Z65A 3ULVA 4WYKA 1Z7XW 3G3BA 5GQRK 1XEUA 1OOKG 3RFJA 4Q3IA 5GS0A 3KJ4A 2ELLA 4R09A 4CC4C 4CNCA 4R08A 4Z79A 1A4YA 2ID5A 4LI2A 3BZ5A 4R6AA 1DS9A 3WPGA 3W3LA 4RWTC 3OJAA 2Y5QA 1YRGA 3WPFA 1P8TA 4R6GA 3OGLB 2OMYA 4IM6A 2XOTA 2OMUA 2RR6A 3G39A 4H09A 4R0AA 4AY9X 4C2AB 2CA6A 5AWBA 2BEXA 4BSUA 4QXEA 3RW7A 1O6TA 2Z64A 2Z7XA 2FT3A 2A0ZA 3W3NA 3RFEA 3OGKB 3E3ZA 2XWTC 4U7LA 4BSRA 3A79B 3RIZA 4C2BB 3G04C 3W3MA 1OTNA 3ULAA 4CP6A 1WWLA 4Q3GA 4V2DA 3RFSA 5GS2B 4KNGA 4KT1A 4Q62A 1JL5A 4LXRA 5GMHA 4GLPA 4NKGA 2Q4GW 4QBZA 1XKUA 3ULUA 1GWBA 4ECNA 4NKHA 2V9SA 3UL8A 1XCDA 5GMFA 1U0ND 4R6FA 4U09A 1DCEA 1KOOA 5AWCA 1M10B 4M7EA 2UZYA 4Y61B 5A5CA 4FD0A 1M0ZA 5HDHA 2O6SA 4LXSA 1H6TA 2Z66A 4WP6A 2Z7XB 4BSSA 1ZIWA 3JB9j 4PKIG 4AW4A 4RCWA 4ARNA 3WN4A 4R58A 2BNHA 1QYYA 2UZXA 3E2JA 4QC0A 3RW6A 1H6UA 4V2CA 1LTXA 5D3IA 2OMWA 4Z8GA 4XGOA 4LSXA 3P72A 3UL7A 1FT8A 3G06A 2P1OB 5AZ5A 3TSRE 4HQ1A 5AWAA 1M9SA 1G9UA 2WQXA 4R6JA 4TZHA 3ZYIA 3WPCA 3REZA 3WPDA 2OMTA 3O53A 3E6JA 3M18A 4EZGA 2P1NB 3RGXA 5GMGA 2WQVA 4ECOA 1FS2A 4ARRA 4YEBB 2ASSB 4J4LA 4R5CA 4FMZA 1OGQA 4UFRA 5CMPA 1OTMA 3VQ1A 4R5DA 2JE1A 1P9AG 2V9TB 1FO1A 3WPBA 1OZNA 2O6RA 4PERA 3O6NA 3W3KA 3GOZA 1A9NA 4MN8B 4FHOA 5IJBA 4M7EC 5B0NA 3WPIA 5LFNA 4P8SA 1P8VA 3RJ0A 4PEQB 1D0BA 2Z82A 4I6JB 4FCGA 3RGZA 3ZYOA 2IFGA 4OQTA 1K5DC 4XOSA 1K5GC 4LI1A 4LSAA 3M19A 2JQDA 2RA8A 3UL9A 2R9UA 4K17A 3SB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3A A;  4LSX C;  3W3G A;  4XSQ A;  2P1Q B;  4CC4 A;  1M9L A;  5IJD A;  2Z81 A;  2WQU A;  3CIG A;  5IJC A;  4BV4 R;  5FTT B;  3PMH G;  1XWD C;  4V2E A;  1O6V A;  2OMV A;  3CVR A;  3E4G A;  1DFJ I;  1FQV A;  1IO0 A;  2AST B;  4PQ8 A;  2V70 A;  3DZE A;  3WPH A;  5CMN A;  1OTO A;  4P91 A;  4U06 A;  4B8C D;  1XEC A;  3C6O B;  5HZL B;  4FDW A;  1O6S A;  4Z61 C;  5B0T A;  4RCA B;  4Z64 C;  2Z63 A;  2OMZ A;  5AWD A;  2JE0 A;  4G8A A;  4LSC A;  4FS7 A;  2WQW A;  5B4P A;  3W3J A;  2OMX A;  2P1P B;  3G3A A;  3VQ2 A;  3ZYJ A;  4PSJ A;  1PGV A;  5IYX C;  4GT6 A;  2O6Q A;  3C6P B;  4U08 A;  2P1M B;  1W8A A;  4R07 A;  4CNM A;  3WPE A;  3OJA B;  4CIL A;  4L3F A;  4KXF B;  4J0M A;  4Z94 G;  4MQW X;  2Z62 A;  3CIY A;  2WFH A;  3FXI A;  3UN9 A;  3C6N B;  3ZYN A;  1KOH A;  3OGM B;  1SQ0 B;  2Z65 A;  3ULV A;  4WYK A;  1Z7X W;  3G3B A;  5GQR K;  1XEU A;  1OOK G;  3RFJ A;  4Q3I A;  5GS0 A;  3KJ4 A;  2ELL A;  4R09 A;  4CC4 C;  4CNC A;  4R08 A;  4Z79 A;  1A4Y A;  2ID5 A;  4LI2 A;  3BZ5 A;  4R6A A;  1DS9 A;  3WPG A;  3W3L A;  4RWT C;  3OJA A;  2Y5Q A;  1YRG A;  3WPF A;  1P8T A;  4R6G A;  3OGL B;  2OMY A;  4IM6 A;  2XOT A;  2OMU A;  2RR6 A;  3G39 A;  4H09 A;  4R0A A;  4AY9 X;  4C2A B;  2CA6 A;  5AWB A;  2BEX A;  4BSU A;  4QXE A;  3RW7 A;  1O6T A;  2Z64 A;  2Z7X A;  2FT3 A;  2A0Z A;  3W3N A;  3RFE A;  3OGK B;  3E3Z A;  2XWT C;  4U7L A;  4BSR A;  3A79 B;  3RIZ A;  4C2B B;  3G04 C;  3W3M A;  1OTN A;  3ULA A;  4CP6 A;  1WWL A;  4Q3G A;  4V2D A;  3RFS A;  5GS2 B;  4KNG A;  4KT1 A;  4Q62 A;  1JL5 A;  4LXR A;  5GMH A;  4GLP A;  4NKG A;  2Q4G W;  4QBZ A;  1XKU A;  3ULU A;  1GWB A;  4ECN A;  4NKH A;  2V9S A;  3UL8 A;  1XCD A;  5GMF A;  1U0N D;  4R6F A;  4U09 A;  1DCE A;  1KOO A;  5AWC A;  1M10 B;  4M7E A;  2UZY A;  4Y61 B;  5A5C A;  4FD0 A;  1M0Z A;  5HDH A;  2O6S A;  4LXS A;  1H6T A;  2Z66 A;  4WP6 A;  2Z7X B;  4BSS A;  1ZIW A;  3JB9 j;  4PKI G;  4AW4 A;  4RCW A;  4ARN A;  3WN4 A;  4R58 A;  2BNH A;  1QYY A;  2UZX A;  3E2J A;  4QC0 A;  3RW6 A;  1H6U A;  4V2C A;  1LTX A;  5D3I A;  2OMW A;  4Z8G A;  4XGO A;  4LSX A;  3P72 A;  3UL7 A;  1FT8 A;  3G06 A;  2P1O B;  5AZ5 A;  3TSR E;  4HQ1 A;  5AWA A;  1M9S A;  1G9U A;  2WQX A;  4R6J A;  4TZH A;  3ZYI A;  3WPC A;  3REZ A;  3WPD A;  2OMT A;  3O53 A;  3E6J A;  3M18 A;  4EZG A;  2P1N B;  3RGX A;  5GMG A;  2WQV A;  4ECO A;  1FS2 A;  4ARR A;  4YEB B;  2ASS B;  4J4L A;  4R5C A;  4FMZ A;  1OGQ A;  4UFR A;  5CMP A;  1OTM A;  3VQ1 A;  4R5D A;  2JE1 A;  1P9A G;  2V9T B;  1FO1 A;  3WPB A;  1OZN A;  2O6R A;  4PER A;  3O6N A;  3W3K A;  3GOZ A;  1A9N A;  4MN8 B;  4FHO A;  5IJB A;  4M7E C;  5B0N A;  3WPI A;  5LFN A;  4P8S A;  1P8V A;  3RJ0 A;  4PEQ B;  1D0B A;  2Z82 A;  4I6J B;  4FCG A;  3RGZ A;  3ZYO A;  2IFG A;  4OQT A;  1K5D C;  4XOS A;  1K5G C;  4LI1 A;  4LSA A;  3M19 A;  2JQD A;  2RA8 A;  3UL9 A;  2R9U A;  4K17 A;  3SB4 A; 
#chains in the Genus database with same CATH topology
 4L3A A;  4LSX C;  3W3G A;  4XSQ A;  2P1Q B;  4CC4 A;  1M9L A;  5IJD A;  2Z81 A;  2WQU A;  3CIG A;  5IJC A;  4BV4 R;  5FTT B;  3PMH G;  1XWD C;  4V2E A;  1O6V A;  2OMV A;  3CVR A;  3E4G A;  1DFJ I;  1FQV A;  1IO0 A;  2AST B;  4PQ8 A;  2V70 A;  3DZE A;  3WPH A;  5CMN A;  1OTO A;  4P91 A;  4U06 A;  4B8C D;  1XEC A;  3C6O B;  5HZL B;  4FDW A;  1O6S A;  4Z61 C;  5B0T A;  4RCA B;  4Z64 C;  2Z63 A;  2OMZ A;  5AWD A;  2JE0 A;  4G8A A;  4LSC A;  4FS7 A;  2WQW A;  5B4P A;  3W3J A;  2OMX A;  2P1P B;  3G3A A;  3VQ2 A;  3ZYJ A;  4PSJ A;  1PGV A;  5IYX C;  4GT6 A;  2O6Q A;  3C6P B;  4U08 A;  2P1M B;  1W8A A;  4R07 A;  4CNM A;  3WPE A;  3OJA B;  4CIL A;  4L3F A;  4KXF B;  4J0M A;  4Z94 G;  4MQW X;  2Z62 A;  3CIY A;  2WFH A;  3FXI A;  3UN9 A;  3C6N B;  3ZYN A;  1KOH A;  3OGM B;  1SQ0 B;  2Z65 A;  3ULV A;  4WYK A;  1Z7X W;  3G3B A;  5GQR K;  1XEU A;  1OOK G;  3RFJ A;  4Q3I A;  5GS0 A;  3KJ4 A;  2ELL A;  4R09 A;  4CC4 C;  4CNC A;  4R08 A;  4Z79 A;  1A4Y A;  2ID5 A;  4LI2 A;  3BZ5 A;  4R6A A;  1DS9 A;  3WPG A;  3W3L A;  4RWT C;  3OJA A;  2Y5Q A;  1YRG A;  3WPF A;  1P8T A;  4R6G A;  3OGL B;  2OMY A;  4IM6 A;  2XOT A;  2OMU A;  4NZT M;  2RR6 A;  3G39 A;  4H09 A;  4R0A A;  4AY9 X;  4C2A B;  2CA6 A;  5AWB A;  2BEX A;  4BSU A;  4QXE A;  4NZR M;  3RW7 A;  1O6T A;  2Z64 A;  2Z7X A;  2FT3 A;  2A0Z A;  3W3N A;  3RFE A;  3OGK B;  3E3Z A;  2XWT C;  4U7L A;  4BSR A;  3A79 B;  3RIZ A;  4C2B B;  3G04 C;  3W3M A;  1OTN A;  3ULA A;  4CP6 A;  1WWL A;  4Q3G A;  4V2D A;  3RFS A;  5GS2 B;  4KNG A;  4KT1 A;  4Q62 A;  1JL5 A;  4LXR A;  5GMH A;  4GLP A;  4NKG A;  2Q4G W;  4QBZ A;  1XKU A;  3ULU A;  1GWB A;  4ECN A;  4NKH A;  2V9S A;  3UL8 A;  1XCD A;  5GMF A;  1U0N D;  4R6F A;  4U09 A;  1DCE A;  1KOO A;  5AWC A;  1M10 B;  4M7E A;  2UZY A;  4Y61 B;  5A5C A;  4FD0 A;  1M0Z A;  5HDH A;  2O6S A;  4LXS A;  1H6T A;  2Z66 A;  4WP6 A;  2Z7X B;  4BSS A;  1ZIW A;  3JB9 j;  4PKI G;  4AW4 A;  4RCW A;  4ARN A;  3WN4 A;  4R58 A;  2BNH A;  1QYY A;  2UZX A;  3E2J A;  4QC0 A;  3RW6 A;  1H6U A;  4V2C A;  1LTX A;  5D3I A;  2OMW A;  4Z8G A;  4XGO A;  4LSX A;  3P72 A;  3UL7 A;  1FT8 A;  3G06 A;  2P1O B;  5AZ5 A;  3TSR E;  4HQ1 A;  5AWA A;  1M9S A;  1G9U A;  2WQX A;  4R6J A;  4TZH A;  3ZYI A;  3WPC A;  3REZ A;  3WPD A;  2OMT A;  3O53 A;  3E6J A;  3M18 A;  4EZG A;  2P1N B;  3RGX A;  5GMG A;  2WQV A;  4ECO A;  1FS2 A;  4ARR A;  4YEB B;  2ASS B;  4J4L A;  4R5C A;  4FMZ A;  1OGQ A;  4UFR A;  5CMP A;  1OTM A;  3VQ1 A;  4R5D A;  2JE1 A;  1P9A G;  2V9T B;  1FO1 A;  3WPB A;  1OZN A;  2O6R A;  4PER A;  3O6N A;  3W3K A;  3GOZ A;  1A9N A;  4MN8 B;  4FHO A;  5IJB A;  4M7E C;  5B0N A;  3WPI A;  5LFN A;  4P8S A;  1P8V A;  3RJ0 A;  4PEQ B;  1D0B A;  2Z82 A;  4I6J B;  4FCG A;  3RGZ A;  3ZYO A;  2IFG A;  4OQT A;  1K5D C;  4XOS A;  1K5G C;  4LI1 A;  4LSA A;  3M19 A;  2JQD A;  2RA8 A;  3UL9 A;  2R9U A;  4K17 A;  3SB4 A; 
#chains in the Genus database with same CATH homology
 4L3A A;  4LSX C;  3W3G A;  4XSQ A;  2P1Q B;  4CC4 A;  1M9L A;  5IJD A;  2Z81 A;  2WQU A;  3CIG A;  5IJC A;  4BV4 R;  5FTT B;  3PMH G;  1XWD C;  4V2E A;  1O6V A;  2OMV A;  3CVR A;  3E4G A;  1DFJ I;  1FQV A;  1IO0 A;  2AST B;  4PQ8 A;  2V70 A;  3DZE A;  3WPH A;  5CMN A;  1OTO A;  4P91 A;  4U06 A;  4B8C D;  1XEC A;  3C6O B;  5HZL B;  4FDW A;  1O6S A;  4Z61 C;  5B0T A;  4RCA B;  4Z64 C;  2Z63 A;  2OMZ A;  5AWD A;  2JE0 A;  4G8A A;  4LSC A;  4FS7 A;  2WQW A;  5B4P A;  3W3J A;  2OMX A;  2P1P B;  3G3A A;  3VQ2 A;  3ZYJ A;  4PSJ A;  1PGV A;  5IYX C;  4GT6 A;  2O6Q A;  3C6P B;  4U08 A;  2P1M B;  1W8A A;  4R07 A;  4CNM A;  3WPE A;  3OJA B;  4CIL A;  4L3F A;  4KXF B;  4J0M A;  4Z94 G;  4MQW X;  2Z62 A;  3CIY A;  2WFH A;  3FXI A;  3UN9 A;  3C6N B;  3ZYN A;  1KOH A;  3OGM B;  1SQ0 B;  2Z65 A;  3ULV A;  4WYK A;  1Z7X W;  3G3B A;  5GQR K;  1XEU A;  1OOK G;  3RFJ A;  4Q3I A;  5GS0 A;  3KJ4 A;  2ELL A;  4R09 A;  4CC4 C;  4CNC A;  4R08 A;  4Z79 A;  1A4Y A;  2ID5 A;  4LI2 A;  3BZ5 A;  4R6A A;  1DS9 A;  3WPG A;  3W3L A;  4RWT C;  3OJA A;  2Y5Q A;  1YRG A;  3WPF A;  1P8T A;  4R6G A;  3OGL B;  2OMY A;  4IM6 A;  2XOT A;  2OMU A;  2RR6 A;  3G39 A;  4H09 A;  4R0A A;  4AY9 X;  4C2A B;  2CA6 A;  5AWB A;  2BEX A;  4BSU A;  4QXE A;  3RW7 A;  1O6T A;  2Z64 A;  2Z7X A;  2FT3 A;  2A0Z A;  3W3N A;  3RFE A;  3OGK B;  3E3Z A;  2XWT C;  4U7L A;  4BSR A;  3A79 B;  3RIZ A;  4C2B B;  3G04 C;  3W3M A;  1OTN A;  3ULA A;  4CP6 A;  1WWL A;  4Q3G A;  4V2D A;  3RFS A;  5GS2 B;  4KNG A;  4KT1 A;  4Q62 A;  1JL5 A;  4LXR A;  5GMH A;  4GLP A;  4NKG A;  2Q4G W;  4QBZ A;  1XKU A;  3ULU A;  1GWB A;  4ECN A;  4NKH A;  2V9S A;  3UL8 A;  1XCD A;  5GMF A;  1U0N D;  4R6F A;  4U09 A;  1DCE A;  1KOO A;  5AWC A;  1M10 B;  4M7E A;  2UZY A;  4Y61 B;  5A5C A;  4FD0 A;  1M0Z A;  5HDH A;  2O6S A;  4LXS A;  1H6T A;  2Z66 A;  4WP6 A;  2Z7X B;  4BSS A;  1ZIW A;  3JB9 j;  4PKI G;  4AW4 A;  4RCW A;  4ARN A;  3WN4 A;  4R58 A;  2BNH A;  1QYY A;  2UZX A;  3E2J A;  4QC0 A;  3RW6 A;  1H6U A;  4V2C A;  1LTX A;  5D3I A;  2OMW A;  4Z8G A;  4XGO A;  4LSX A;  3P72 A;  3UL7 A;  1FT8 A;  3G06 A;  2P1O B;  5AZ5 A;  3TSR E;  4HQ1 A;  5AWA A;  1M9S A;  1G9U A;  2WQX A;  4R6J A;  4TZH A;  3ZYI A;  3WPC A;  3REZ A;  3WPD A;  2OMT A;  3O53 A;  3E6J A;  3M18 A;  4EZG A;  2P1N B;  3RGX A;  5GMG A;  2WQV A;  4ECO A;  1FS2 A;  4ARR A;  4YEB B;  2ASS B;  4J4L A;  4R5C A;  4FMZ A;  1OGQ A;  4UFR A;  5CMP A;  1OTM A;  3VQ1 A;  4R5D A;  2JE1 A;  1P9A G;  2V9T B;  1FO1 A;  3WPB A;  1OZN A;  2O6R A;  4PER A;  3O6N A;  3W3K A;  3GOZ A;  1A9N A;  4MN8 B;  4FHO A;  5IJB A;  4M7E C;  5B0N A;  3WPI A;  5LFN A;  4P8S A;  1P8V A;  3RJ0 A;  4PEQ B;  1D0B A;  2Z82 A;  4I6J B;  4FCG A;  3RGZ A;  3ZYO A;  2IFG A;  4OQT A;  1K5D C;  4XOS A;  1K5G C;  4LI1 A;  4LSA A;  3M19 A;  2JQD A;  2RA8 A;  3UL9 A;  2R9U A;  4K17 A;  3SB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...