5GQRK

Crystal structure of pxy-cle41-serk2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
185
structure length
185
Chain Sequence
NMEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSRPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine-rich repeat receptor-like protein kinase TDR
publication title SERK Family Receptor-like Kinases Function as Co-receptors with PXY for Plant Vascular Development
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 52
structure length 185
sequence length 185
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gqrK00
2ASTB 5CMPA 5HZLB 4R5CA 2JE1A 2Z7XB 3TSRE 3CIYA 4R6FA 2OMZA 4WP6A 4CC4A 5IJDA 2OMUA 2CA6A 2IFGA 5HDHA 5B4PA 5AWDA 2V70A 4LXSA 4XSQA 1OGQA 2JQDA 3VQ2A 3ZYNA 2RR6A 1DCEA 2Y5QA 3RW6A 4L3FA 1M0ZA 2O6RA 2P1QB 5IJCA 4LSAA 4RCAB 5D3IA 1M9SA 3DZEA 2Z81A 3E4GA 1FT8A 4G8AA 1QYYA 2BEXA 5GS0A 4B8CD 2WQXA 4FS7A 4QBZA 2P1OB 5AZ5A 4GT6A 4K17A 4BV4R 4AY9X 4R5DA 2ASSB 4QXEA 4TZHA 4CC4C 4V2DA 3BZ5A 1O6TA 4Q3GA 1XECA 4LI2A 5AWAA 4CNMA 1O6SA 1P8VA 1K5GC 2XWTC 3OJAA 4OQTA 3G3AA 4MN8B 4R6GA 2V9SA 4ECOA 1XWDC 1KOOA 1Z7XW 2UZYA 4L3AA 2O6SA 1ZIWA 4Z8GA 2WQVA 2P1MB 4KT1A 4Z79A 5A5CA 4LXRA 5B0TA 1H6TA 1K5DC 4ECNA 1LTXA 5CMNA 2Z64A 2XOTA 4RCWA 1M9LA 2Q4GW 3RFJA 1OZNA 1P9AG 1OTNA 2Z65A 2Z66A 2OMWA 1IO0A 4R6AA 3M18A 4J0MA 3M19A 4U09A 5IYXC 4BSRA 2Z62A 3VQ1A 3O53A 4PSJA 4KXFB 3WPEA 4BSUA 1JL5A 2JE0A 3WPDA 2FT3A 3ZYOA 3C6PB 4R0AA 4Z64C 4ARNA 4UFRA 1FS2A 1GWBA 3E6JA 3W3MA 3OJAB 3W3NA 1PGVA 2Z7XA 4R08A 4U08A 1O6VA 1OTMA 4R6JA 3OGKB 2OMVA 1WWLA 3ULUA 3RFSA 4FD0A 3CIGA 3E3ZA 5GMFA 3WPCA 2OMYA 3OGLB 4M7EA 3RGZA 3UL8A 3W3GA 4PERA 4LSXA 3WPFA 3C6NB 4NKHA 3ZYIA 3WPHA 2OMXA 3UL7A 4IM6A 4LI1A 3WPBA 4YEBB 3WN4A 1XKUA 3G06A 4P8SA 1FO1A 2R9UA 4XOSA 3ZYJA 1XEUA 4U7LA 3RW7A 4R09A 4C2AB 3RIZA 1A4YA 1M10B 1SQ0B 4CILA 1D0BA 3G39A 1U0ND 4M7EC 2P1PB 3FXIA 3W3LA 4CP6A 4NKGA 5LFNA 2ID5A 4PEQB 2V9TB 4V2CA 4H09A 5GS2B 4AW4A 4LSXC 2WQWA 4ARRA 4V2EA 3WPIA 3KJ4A 3UN9A 1FQVA 3E2JA 3A79B 1DS9A 3W3JA 3O6NA 4EZGA 4XGOA 4PQ8A 1P8TA 3W3KA 4FMZA 3G04C 3REZA 2OMTA 1XCDA 3PMHG 3ULAA 3OGMB 3CVRA 4FCGA 1DFJI 2Z63A 4PKIG 4U06A 4RWTC 2WFHA 2UZXA 4I6JB 4CNCA 4KNGA 3RJ0A 4Z61C 3RFEA 4HQ1A 4QC0A 4GLPA 4R07A 2Z82A 1G9UA 2ELLA 5FTTB 4Y61B 3C6OB 1OOKG 4WYKA 1OTOA 1H6UA 3RGXA 4MQWX 1W8AA 4BSSA 3GOZA 3P72A 4FHOA 2RA8A 3UL9A 5GMHA 4Q62A 4Z94G 4Q3IA 3JB9j 2WQUA 5IJBA 5B0NA 4C2BB 4R58A 5AWBA 1YRGA 4P91A 3WPGA 2A0ZA 1KOHA 5GMGA 2P1NB 3SB4A 4J4LA 1A9NA 5AWCA 3ULVA 4LSCA 5GQRK 2O6QA 4FDWA 2BNHA 3G3BA
chains in the Genus database with same CATH superfamily
2ASTB 5CMPA 5HZLB 4R5CA 2JE1A 2Z7XB 3TSRE 3CIYA 4R6FA 2OMZA 4WP6A 4CC4A 5IJDA 2OMUA 2CA6A 2IFGA 5HDHA 5B4PA 5AWDA 2V70A 4LXSA 4XSQA 1OGQA 2JQDA 3VQ2A 3ZYNA 2RR6A 1DCEA 2Y5QA 4L3FA 3RW6A 1M0ZA 2O6RA 2P1QB 5IJCA 4LSAA 4RCAB 5D3IA 1M9SA 3DZEA 2Z81A 3E4GA 1FT8A 4G8AA 1QYYA 2BEXA 5GS0A 4B8CD 2WQXA 4FS7A 4QBZA 2P1OB 5AZ5A 4GT6A 4K17A 4BV4R 4AY9X 4R5DA 2ASSB 4QXEA 4TZHA 4CC4C 4V2DA 3BZ5A 1O6TA 4Q3GA 1XECA 4LI2A 5AWAA 4CNMA 1O6SA 1P8VA 1K5GC 2XWTC 3OJAA 4OQTA 3G3AA 4MN8B 4R6GA 2V9SA 4ECOA 1XWDC 1KOOA 1Z7XW 2UZYA 4L3AA 2O6SA 1ZIWA 4Z8GA 2WQVA 2P1MB 4KT1A 4Z79A 5A5CA 4LXRA 5B0TA 1H6TA 1K5DC 4ECNA 1LTXA 5CMNA 2Z64A 2XOTA 4RCWA 1M9LA 2Q4GW 3RFJA 1OZNA 1P9AG 1OTNA 2Z65A 2Z66A 2OMWA 1IO0A 4R6AA 3M18A 4J0MA 3M19A 4U09A 5IYXC 4BSRA 2Z62A 3VQ1A 3O53A 4PSJA 4KXFB 3WPEA 4BSUA 1JL5A 2JE0A 3WPDA 2FT3A 3ZYOA 3C6PB 4R0AA 4Z64C 4ARNA 4UFRA 1FS2A 1GWBA 3E6JA 3W3MA 3OJAB 3W3NA 1PGVA 2Z7XA 4R08A 4U08A 1O6VA 1OTMA 4R6JA 3OGKB 2OMVA 1WWLA 3ULUA 3RFSA 4FD0A 3CIGA 3E3ZA 5GMFA 3WPCA 2OMYA 3OGLB 4M7EA 3RGZA 3UL8A 3W3GA 4PERA 4LSXA 3WPFA 3C6NB 4NKHA 3ZYIA 3WPHA 2OMXA 3UL7A 4IM6A 4LI1A 3WPBA 4YEBB 3WN4A 1XKUA 3G06A 4P8SA 1FO1A 2R9UA 4XOSA 3ZYJA 1XEUA 4U7LA 3RW7A 4R09A 4C2AB 3RIZA 1A4YA 1M10B 1SQ0B 4CILA 1D0BA 3G39A 1U0ND 4M7EC 2P1PB 3FXIA 3W3LA 4CP6A 4NKGA 5LFNA 2ID5A 4PEQB 2V9TB 4V2CA 4H09A 5GS2B 4AW4A 4LSXC 2WQWA 4ARRA 4V2EA 3WPIA 3KJ4A 4NZTM 3UN9A 1FQVA 3E2JA 3A79B 1DS9A 3W3JA 3O6NA 4EZGA 4XGOA 4PQ8A 1P8TA 3W3KA 4FMZA 3G04C 3REZA 2OMTA 1XCDA 3PMHG 3ULAA 3OGMB 3CVRA 4FCGA 1DFJI 2Z63A 4PKIG 4U06A 4RWTC 2WFHA 2UZXA 4I6JB 4CNCA 4KNGA 3RJ0A 4NZRM 4Z61C 3RFEA 4HQ1A 4QC0A 4GLPA 4R07A 2Z82A 1G9UA 2ELLA 5FTTB 4Y61B 3C6OB 1OOKG 4WYKA 1OTOA 1H6UA 3RGXA 4MQWX 1W8AA 4BSSA 3GOZA 3P72A 4FHOA 2RA8A 3UL9A 5GMHA 4Q62A 4Z94G 4Q3IA 3JB9j 2WQUA 5IJBA 5B0NA 4C2BB 4R58A 5AWBA 1YRGA 4P91A 3WPGA 2A0ZA 1KOHA 5GMGA 2P1NB 3SB4A 4J4LA 1A9NA 5AWCA 3ULVA 4LSCA 5GQRK 2O6QA 4FDWA 2BNHA 3G3BA
chains in the Genus database with same CATH topology
2ASTB 5CMPA 5HZLB 4R5CA 2JE1A 2Z7XB 3TSRE 3CIYA 4R6FA 2OMZA 4WP6A 4CC4A 5IJDA 2OMUA 2CA6A 2IFGA 5HDHA 5B4PA 5AWDA 2V70A 4LXSA 4XSQA 1OGQA 2JQDA 3VQ2A 3ZYNA 2RR6A 1DCEA 2Y5QA 3RW6A 4L3FA 1M0ZA 2O6RA 2P1QB 5IJCA 4LSAA 4RCAB 5D3IA 1M9SA 3DZEA 2Z81A 3E4GA 1FT8A 4G8AA 1QYYA 2BEXA 5GS0A 4B8CD 2WQXA 4FS7A 4QBZA 2P1OB 5AZ5A 4GT6A 4K17A 4BV4R 4AY9X 4R5DA 2ASSB 4QXEA 4TZHA 4CC4C 4V2DA 3BZ5A 1O6TA 4Q3GA 1XECA 4LI2A 5AWAA 4CNMA 1O6SA 1P8VA 1K5GC 2XWTC 3OJAA 4OQTA 3G3AA 4MN8B 4R6GA 2V9SA 4ECOA 1XWDC 1KOOA 1Z7XW 2UZYA 4L3AA 2O6SA 1ZIWA 4Z8GA 2WQVA 2P1MB 4KT1A 4Z79A 5A5CA 4LXRA 5B0TA 1H6TA 1K5DC 4ECNA 1LTXA 5CMNA 2Z64A 2XOTA 4RCWA 1M9LA 2Q4GW 3RFJA 1OZNA 1P9AG 1OTNA 2Z65A 2Z66A 2OMWA 1IO0A 4R6AA 3M18A 4J0MA 3M19A 4U09A 5IYXC 4BSRA 2Z62A 3VQ1A 3O53A 4PSJA 4KXFB 3WPEA 4BSUA 1JL5A 2JE0A 3WPDA 2FT3A 3ZYOA 3C6PB 4R0AA 4Z64C 4ARNA 4UFRA 1FS2A 1GWBA 3E6JA 3W3MA 3OJAB 3W3NA 1PGVA 2Z7XA 4R08A 4U08A 1O6VA 1OTMA 4R6JA 3OGKB 2OMVA 1WWLA 3ULUA 3RFSA 4FD0A 3CIGA 3E3ZA 5GMFA 3WPCA 2OMYA 3OGLB 4M7EA 3RGZA 3UL8A 3W3GA 4PERA 4LSXA 3WPFA 3C6NB 4NKHA 3ZYIA 3WPHA 2OMXA 3UL7A 4IM6A 4LI1A 3WPBA 4YEBB 3WN4A 1XKUA 3G06A 4P8SA 1FO1A 2R9UA 4XOSA 3ZYJA 1XEUA 4U7LA 3RW7A 4R09A 4C2AB 3RIZA 1A4YA 1M10B 1SQ0B 4CILA 1D0BA 3G39A 1U0ND 4M7EC 2P1PB 3FXIA 3W3LA 4CP6A 4NKGA 5LFNA 2ID5A 4PEQB 2V9TB 4V2CA 4H09A 5GS2B 4AW4A 4LSXC 2WQWA 4ARRA 4V2EA 3WPIA 3KJ4A 3UN9A 1FQVA 3E2JA 3A79B 1DS9A 3W3JA 3O6NA 4EZGA 4XGOA 4PQ8A 1P8TA 3W3KA 4FMZA 3G04C 3REZA 2OMTA 1XCDA 3PMHG 3ULAA 3OGMB 3CVRA 4FCGA 1DFJI 2Z63A 4PKIG 4U06A 4RWTC 2WFHA 2UZXA 4I6JB 4CNCA 4KNGA 3RJ0A 4Z61C 3RFEA 4HQ1A 4QC0A 4GLPA 4R07A 2Z82A 1G9UA 2ELLA 5FTTB 4Y61B 3C6OB 1OOKG 4WYKA 1OTOA 1H6UA 3RGXA 4MQWX 1W8AA 4BSSA 3GOZA 3P72A 4FHOA 2RA8A 3UL9A 5GMHA 4Q62A 4Z94G 4Q3IA 3JB9j 2WQUA 5IJBA 5B0NA 4C2BB 4R58A 5AWBA 1YRGA 4P91A 3WPGA 2A0ZA 1KOHA 5GMGA 2P1NB 3SB4A 4J4LA 1A9NA 5AWCA 3ULVA 4LSCA 5GQRK 2O6QA 4FDWA 2BNHA 3G3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AST B;  5CMP A;  5HZL B;  4R5C A;  2JE1 A;  2Z7X B;  3TSR E;  3CIY A;  4R6F A;  2OMZ A;  4WP6 A;  4CC4 A;  5IJD A;  2OMU A;  2CA6 A;  2IFG A;  5HDH A;  5B4P A;  5AWD A;  2V70 A;  4LXS A;  4XSQ A;  1OGQ A;  2JQD A;  3VQ2 A;  3ZYN A;  2RR6 A;  1DCE A;  2Y5Q A;  3RW6 A;  4L3F A;  1M0Z A;  2O6R A;  2P1Q B;  5IJC A;  4LSA A;  4RCA B;  5D3I A;  1M9S A;  3DZE A;  2Z81 A;  3E4G A;  1FT8 A;  4G8A A;  1QYY A;  2BEX A;  5GS0 A;  4B8C D;  2WQX A;  4FS7 A;  4QBZ A;  2P1O B;  5AZ5 A;  4GT6 A;  4K17 A;  4BV4 R;  4AY9 X;  4R5D A;  2ASS B;  4QXE A;  4TZH A;  4CC4 C;  4V2D A;  3BZ5 A;  1O6T A;  4Q3G A;  1XEC A;  4LI2 A;  5AWA A;  4CNM A;  1O6S A;  1P8V A;  1K5G C;  2XWT C;  3OJA A;  4OQT A;  3G3A A;  4MN8 B;  4R6G A;  2V9S A;  4ECO A;  1XWD C;  1KOO A;  1Z7X W;  2UZY A;  4L3A A;  2O6S A;  1ZIW A;  4Z8G A;  2WQV A;  2P1M B;  4KT1 A;  4Z79 A;  5A5C A;  4LXR A;  5B0T A;  1H6T A;  1K5D C;  4ECN A;  1LTX A;  5CMN A;  2Z64 A;  2XOT A;  4RCW A;  1M9L A;  2Q4G W;  3RFJ A;  1OZN A;  1P9A G;  1OTN A;  2Z65 A;  2Z66 A;  2OMW A;  1IO0 A;  4R6A A;  3M18 A;  4J0M A;  3M19 A;  4U09 A;  5IYX C;  4BSR A;  2Z62 A;  3VQ1 A;  3O53 A;  4PSJ A;  4KXF B;  3WPE A;  4BSU A;  1JL5 A;  2JE0 A;  3WPD A;  2FT3 A;  3ZYO A;  3C6P B;  4R0A A;  4Z64 C;  4ARN A;  4UFR A;  1FS2 A;  1GWB A;  3E6J A;  3W3M A;  3OJA B;  3W3N A;  1PGV A;  2Z7X A;  4R08 A;  4U08 A;  1O6V A;  1OTM A;  4R6J A;  3OGK B;  2OMV A;  1WWL A;  3ULU A;  3RFS A;  4FD0 A;  3CIG A;  3E3Z A;  5GMF A;  3WPC A;  2OMY A;  3OGL B;  4M7E A;  3RGZ A;  3UL8 A;  3W3G A;  4PER A;  4LSX A;  3WPF A;  3C6N B;  4NKH A;  3ZYI A;  3WPH A;  2OMX A;  3UL7 A;  4IM6 A;  4LI1 A;  3WPB A;  4YEB B;  3WN4 A;  1XKU A;  3G06 A;  4P8S A;  1FO1 A;  2R9U A;  4XOS A;  3ZYJ A;  1XEU A;  4U7L A;  3RW7 A;  4R09 A;  4C2A B;  3RIZ A;  1A4Y A;  1M10 B;  1SQ0 B;  4CIL A;  1D0B A;  3G39 A;  1U0N D;  4M7E C;  2P1P B;  3FXI A;  3W3L A;  4CP6 A;  4NKG A;  5LFN A;  2ID5 A;  4PEQ B;  2V9T B;  4V2C A;  4H09 A;  5GS2 B;  4AW4 A;  4LSX C;  2WQW A;  4ARR A;  4V2E A;  3WPI A;  3KJ4 A;  3UN9 A;  1FQV A;  3E2J A;  3A79 B;  1DS9 A;  3W3J A;  3O6N A;  4EZG A;  4XGO A;  4PQ8 A;  1P8T A;  3W3K A;  4FMZ A;  3G04 C;  3REZ A;  2OMT A;  1XCD A;  3PMH G;  3ULA A;  3OGM B;  3CVR A;  4FCG A;  1DFJ I;  2Z63 A;  4PKI G;  4U06 A;  4RWT C;  2WFH A;  2UZX A;  4I6J B;  4CNC A;  4KNG A;  3RJ0 A;  4Z61 C;  3RFE A;  4HQ1 A;  4QC0 A;  4GLP A;  4R07 A;  2Z82 A;  1G9U A;  2ELL A;  5FTT B;  4Y61 B;  3C6O B;  1OOK G;  4WYK A;  1OTO A;  1H6U A;  3RGX A;  4MQW X;  1W8A A;  4BSS A;  3GOZ A;  3P72 A;  4FHO A;  2RA8 A;  3UL9 A;  5GMH A;  4Q62 A;  4Z94 G;  4Q3I A;  3JB9 j;  2WQU A;  5IJB A;  5B0N A;  4C2B B;  4R58 A;  5AWB A;  1YRG A;  4P91 A;  3WPG A;  2A0Z A;  1KOH A;  5GMG A;  2P1N B;  3SB4 A;  4J4L A;  1A9N A;  5AWC A;  3ULV A;  4LSC A;  5GQR K;  2O6Q A;  4FDW A;  2BNH A;  3G3B A; 
#chains in the Genus database with same CATH topology
 2AST B;  5CMP A;  5HZL B;  4R5C A;  2JE1 A;  2Z7X B;  3TSR E;  3CIY A;  4R6F A;  2OMZ A;  4WP6 A;  4CC4 A;  5IJD A;  2OMU A;  2CA6 A;  2IFG A;  5HDH A;  5B4P A;  5AWD A;  2V70 A;  4LXS A;  4XSQ A;  1OGQ A;  2JQD A;  3VQ2 A;  3ZYN A;  2RR6 A;  1DCE A;  2Y5Q A;  4L3F A;  3RW6 A;  1M0Z A;  2O6R A;  2P1Q B;  5IJC A;  4LSA A;  4RCA B;  5D3I A;  1M9S A;  3DZE A;  2Z81 A;  3E4G A;  1FT8 A;  4G8A A;  1QYY A;  2BEX A;  5GS0 A;  4B8C D;  2WQX A;  4FS7 A;  4QBZ A;  2P1O B;  5AZ5 A;  4GT6 A;  4K17 A;  4BV4 R;  4AY9 X;  4R5D A;  2ASS B;  4QXE A;  4TZH A;  4CC4 C;  4V2D A;  3BZ5 A;  1O6T A;  4Q3G A;  1XEC A;  4LI2 A;  5AWA A;  4CNM A;  1O6S A;  1P8V A;  1K5G C;  2XWT C;  3OJA A;  4OQT A;  3G3A A;  4MN8 B;  4R6G A;  2V9S A;  4ECO A;  1XWD C;  1KOO A;  1Z7X W;  2UZY A;  4L3A A;  2O6S A;  1ZIW A;  4Z8G A;  2WQV A;  2P1M B;  4KT1 A;  4Z79 A;  5A5C A;  4LXR A;  5B0T A;  1H6T A;  1K5D C;  4ECN A;  1LTX A;  5CMN A;  2Z64 A;  2XOT A;  4RCW A;  1M9L A;  2Q4G W;  3RFJ A;  1OZN A;  1P9A G;  1OTN A;  2Z65 A;  2Z66 A;  2OMW A;  1IO0 A;  4R6A A;  3M18 A;  4J0M A;  3M19 A;  4U09 A;  5IYX C;  4BSR A;  2Z62 A;  3VQ1 A;  3O53 A;  4PSJ A;  4KXF B;  3WPE A;  4BSU A;  1JL5 A;  2JE0 A;  3WPD A;  2FT3 A;  3ZYO A;  3C6P B;  4R0A A;  4Z64 C;  4ARN A;  4UFR A;  1FS2 A;  1GWB A;  3E6J A;  3W3M A;  3OJA B;  3W3N A;  1PGV A;  2Z7X A;  4R08 A;  4U08 A;  1O6V A;  1OTM A;  4R6J A;  3OGK B;  2OMV A;  1WWL A;  3ULU A;  3RFS A;  4FD0 A;  3CIG A;  3E3Z A;  5GMF A;  3WPC A;  2OMY A;  3OGL B;  4M7E A;  3RGZ A;  3UL8 A;  3W3G A;  4PER A;  4LSX A;  3WPF A;  3C6N B;  4NKH A;  3ZYI A;  3WPH A;  2OMX A;  3UL7 A;  4IM6 A;  4LI1 A;  3WPB A;  4YEB B;  3WN4 A;  1XKU A;  3G06 A;  4P8S A;  1FO1 A;  2R9U A;  4XOS A;  3ZYJ A;  1XEU A;  4U7L A;  3RW7 A;  4R09 A;  4C2A B;  3RIZ A;  1A4Y A;  1M10 B;  1SQ0 B;  4CIL A;  1D0B A;  3G39 A;  1U0N D;  4M7E C;  2P1P B;  3FXI A;  3W3L A;  4CP6 A;  4NKG A;  5LFN A;  2ID5 A;  4PEQ B;  2V9T B;  4V2C A;  4H09 A;  5GS2 B;  4AW4 A;  4LSX C;  2WQW A;  4ARR A;  4V2E A;  3WPI A;  3KJ4 A;  4NZT M;  3UN9 A;  1FQV A;  3E2J A;  3A79 B;  1DS9 A;  3W3J A;  3O6N A;  4EZG A;  4XGO A;  4PQ8 A;  1P8T A;  3W3K A;  4FMZ A;  3G04 C;  3REZ A;  2OMT A;  1XCD A;  3PMH G;  3ULA A;  3OGM B;  3CVR A;  4FCG A;  1DFJ I;  2Z63 A;  4PKI G;  4U06 A;  4RWT C;  2WFH A;  2UZX A;  4I6J B;  4CNC A;  4KNG A;  3RJ0 A;  4NZR M;  4Z61 C;  3RFE A;  4HQ1 A;  4QC0 A;  4GLP A;  4R07 A;  2Z82 A;  1G9U A;  2ELL A;  5FTT B;  4Y61 B;  3C6O B;  1OOK G;  4WYK A;  1OTO A;  1H6U A;  3RGX A;  4MQW X;  1W8A A;  4BSS A;  3GOZ A;  3P72 A;  4FHO A;  2RA8 A;  3UL9 A;  5GMH A;  4Q62 A;  4Z94 G;  4Q3I A;  3JB9 j;  2WQU A;  5IJB A;  5B0N A;  4C2B B;  4R58 A;  5AWB A;  1YRG A;  4P91 A;  3WPG A;  2A0Z A;  1KOH A;  5GMG A;  2P1N B;  3SB4 A;  4J4L A;  1A9N A;  5AWC A;  3ULV A;  4LSC A;  5GQR K;  2O6Q A;  4FDW A;  2BNH A;  3G3B A; 
#chains in the Genus database with same CATH homology
 2AST B;  5CMP A;  5HZL B;  4R5C A;  2JE1 A;  2Z7X B;  3TSR E;  3CIY A;  4R6F A;  2OMZ A;  4WP6 A;  4CC4 A;  5IJD A;  2OMU A;  2CA6 A;  2IFG A;  5HDH A;  5B4P A;  5AWD A;  2V70 A;  4LXS A;  4XSQ A;  1OGQ A;  2JQD A;  3VQ2 A;  3ZYN A;  2RR6 A;  1DCE A;  2Y5Q A;  3RW6 A;  4L3F A;  1M0Z A;  2O6R A;  2P1Q B;  5IJC A;  4LSA A;  4RCA B;  5D3I A;  1M9S A;  3DZE A;  2Z81 A;  3E4G A;  1FT8 A;  4G8A A;  1QYY A;  2BEX A;  5GS0 A;  4B8C D;  2WQX A;  4FS7 A;  4QBZ A;  2P1O B;  5AZ5 A;  4GT6 A;  4K17 A;  4BV4 R;  4AY9 X;  4R5D A;  2ASS B;  4QXE A;  4TZH A;  4CC4 C;  4V2D A;  3BZ5 A;  1O6T A;  4Q3G A;  1XEC A;  4LI2 A;  5AWA A;  4CNM A;  1O6S A;  1P8V A;  1K5G C;  2XWT C;  3OJA A;  4OQT A;  3G3A A;  4MN8 B;  4R6G A;  2V9S A;  4ECO A;  1XWD C;  1KOO A;  1Z7X W;  2UZY A;  4L3A A;  2O6S A;  1ZIW A;  4Z8G A;  2WQV A;  2P1M B;  4KT1 A;  4Z79 A;  5A5C A;  4LXR A;  5B0T A;  1H6T A;  1K5D C;  4ECN A;  1LTX A;  5CMN A;  2Z64 A;  2XOT A;  4RCW A;  1M9L A;  2Q4G W;  3RFJ A;  1OZN A;  1P9A G;  1OTN A;  2Z65 A;  2Z66 A;  2OMW A;  1IO0 A;  4R6A A;  3M18 A;  4J0M A;  3M19 A;  4U09 A;  5IYX C;  4BSR A;  2Z62 A;  3VQ1 A;  3O53 A;  4PSJ A;  4KXF B;  3WPE A;  4BSU A;  1JL5 A;  2JE0 A;  3WPD A;  2FT3 A;  3ZYO A;  3C6P B;  4R0A A;  4Z64 C;  4ARN A;  4UFR A;  1FS2 A;  1GWB A;  3E6J A;  3W3M A;  3OJA B;  3W3N A;  1PGV A;  2Z7X A;  4R08 A;  4U08 A;  1O6V A;  1OTM A;  4R6J A;  3OGK B;  2OMV A;  1WWL A;  3ULU A;  3RFS A;  4FD0 A;  3CIG A;  3E3Z A;  5GMF A;  3WPC A;  2OMY A;  3OGL B;  4M7E A;  3RGZ A;  3UL8 A;  3W3G A;  4PER A;  4LSX A;  3WPF A;  3C6N B;  4NKH A;  3ZYI A;  3WPH A;  2OMX A;  3UL7 A;  4IM6 A;  4LI1 A;  3WPB A;  4YEB B;  3WN4 A;  1XKU A;  3G06 A;  4P8S A;  1FO1 A;  2R9U A;  4XOS A;  3ZYJ A;  1XEU A;  4U7L A;  3RW7 A;  4R09 A;  4C2A B;  3RIZ A;  1A4Y A;  1M10 B;  1SQ0 B;  4CIL A;  1D0B A;  3G39 A;  1U0N D;  4M7E C;  2P1P B;  3FXI A;  3W3L A;  4CP6 A;  4NKG A;  5LFN A;  2ID5 A;  4PEQ B;  2V9T B;  4V2C A;  4H09 A;  5GS2 B;  4AW4 A;  4LSX C;  2WQW A;  4ARR A;  4V2E A;  3WPI A;  3KJ4 A;  3UN9 A;  1FQV A;  3E2J A;  3A79 B;  1DS9 A;  3W3J A;  3O6N A;  4EZG A;  4XGO A;  4PQ8 A;  1P8T A;  3W3K A;  4FMZ A;  3G04 C;  3REZ A;  2OMT A;  1XCD A;  3PMH G;  3ULA A;  3OGM B;  3CVR A;  4FCG A;  1DFJ I;  2Z63 A;  4PKI G;  4U06 A;  4RWT C;  2WFH A;  2UZX A;  4I6J B;  4CNC A;  4KNG A;  3RJ0 A;  4Z61 C;  3RFE A;  4HQ1 A;  4QC0 A;  4GLP A;  4R07 A;  2Z82 A;  1G9U A;  2ELL A;  5FTT B;  4Y61 B;  3C6O B;  1OOK G;  4WYK A;  1OTO A;  1H6U A;  3RGX A;  4MQW X;  1W8A A;  4BSS A;  3GOZ A;  3P72 A;  4FHO A;  2RA8 A;  3UL9 A;  5GMH A;  4Q62 A;  4Z94 G;  4Q3I A;  3JB9 j;  2WQU A;  5IJB A;  5B0N A;  4C2B B;  4R58 A;  5AWB A;  1YRG A;  4P91 A;  3WPG A;  2A0Z A;  1KOH A;  5GMG A;  2P1N B;  3SB4 A;  4J4L A;  1A9N A;  5AWC A;  3ULV A;  4LSC A;  5GQR K;  2O6Q A;  4FDW A;  2BNH A;  3G3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...