5GQRK

Crystal structure of pxy-cle41-serk2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
185
structure length
185
Chain Sequence
NMEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSRPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Leucine-rich repeat receptor-like protein kinase TDR
publication title SERK Family Receptor-like Kinases Function as Co-receptors with PXY for Plant Vascular Development
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 52
structure length 185
sequence length 185
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gqrK00
2RR6A 5HZLB 2JQDA 1D0BA 1SQ0B 4R6FA 4LSXC 4BV4R 1IO0A 3WPEA 3ZYIA 1M0ZA 3G3AA 1XCDA 4Z79A 3BZ5A 3RFJA 4R09A 3E4GA 4NKHA 3KJ4A 2A0ZA 2BNHA 4V2CA 2UZXA 2XWTC 4NKGA 5LFNA 3C6NB 3UL8A 3E6JA 4CP6A 2O6RA 1OTOA 1O6SA 3A79B 4XSQA 4Q62A 2O6QA 3ZYNA 3UL9A 2V9TB 1K5GC 3GOZA 2RA8A 4LI2A 4R5CA 4Q3IA 5CMPA 4AW4A 4R6JA 5D3IA 4U09A 2Q4GW 5AWDA 2OMTA 4LSXA 4Z64C 1H6TA 5HDHA 5GMGA 2Z81A 4HQ1A 4V2DA 3VQ2A 3OJAA 3RFEA 2BEXA 4BSRA 4C2AB 1U0ND 2OMXA 3ULUA 2Z62A 1M9SA 1FT8A 4U7LA 2XOTA 4EZGA 3C6PB 2ID5A 3WPCA 2P1MB 4KT1A 3RJ0A 4RWTC 2WQVA 4FDWA 4ECOA 1KOHA 3G3BA 3E3ZA 4TZHA 4U08A 4P91A 3W3GA 4QXEA 3REZA 1XKUA 4XGOA 1FQVA 1OZNA 4J4LA 3WPDA 3CIGA 3CIYA 3UL7A 2Z63A 2CA6A 5IJBA 1XEUA 1G9UA 3E2JA 1DFJI 4R6AA 4L3FA 4RCAB 4R6GA 4P8SA 4ARRA 2Z7XB 5GS2B 3PMHG 3ZYJA 2Y5QA 1KOOA 2OMWA 2ASTB 5GMFA 5CMNA 2Z82A 4CILA 1LTXA 2R9UA 3FXIA 1XECA 4M7EC 4MQWX 1OTNA 4LSAA 2Z65A 4L3AA 1H6UA 1M9LA 4FCGA 4LXSA 1OTMA 2UZYA 3M19A 4PKIG 4YEBB 4BSUA 4PERA 5B4PA 3RW7A 4PEQB 2IFGA 3O6NA 2JE0A 4BSSA 4ECNA 1P9AG 5B0TA 4QBZA 4CC4C 3OJAB 2O6SA 3G39A 1OOKG 4M7EA 3OGMB 3SB4A 5IJDA 1M10B 4XOSA 4IM6A 3G04C 4GLPA 3G06A 4H09A 3TSRE 3RGXA 4J0MA 1GWBA 2JE1A 2WQUA 1A4YA 1YRGA 4G8AA 4OQTA 4FD0A 4GT6A 3OGLB 4WYKA 4WP6A 5FTTB 3RFSA 4RCWA 4R5DA 2P1PB 3UN9A 2OMZA 1XWDC 4K17A 3RIZA 4CC4A 4CNCA 4Z8GA 4KXFB 4LSCA 2P1OB 3ULVA 5IYXC 2OMYA 1FS2A 5GQRK 3WPBA 3DZEA 4B8CD 3RGZA 3M18A 3O53A 2OMVA 3ZYOA 3W3MA 2Z7XA 4R07A 5AWCA 2V9SA 3W3LA 2Z64A 3P72A 1P8TA 4Z94G 1QYYA 2WQWA 2WFHA 4R08A 2FT3A 4FS7A 4Z61C 3W3NA 2ASSB 4Y61B 3WPGA 4MN8B 4PQ8A 3ULAA 4QC0A 5GS0A 3W3KA 5IJCA 2WQXA 4R58A 1Z7XW 2ELLA 4AY9X 5B0NA 1P8VA 3C6OB 4FMZA 4UFRA 2OMUA 4PSJA 4U06A 4V2EA 1O6VA 4I6JB 5A5CA 5AWBA 4ARNA 1OGQA 2V70A 1A9NA 1FO1A 3WPIA 3VQ1A 4LI1A 4R0AA 1O6TA 3WPHA 1K5DC 5GMHA 1WWLA 1W8AA 1ZIWA 1DCEA 3CVRA 2P1NB 5AZ5A 4Q3GA 3OGKB 2Z66A 5AWAA 4KNGA 3JB9j 1PGVA 3RW6A 1JL5A 3W3JA 1DS9A 2P1QB 4C2BB 3WPFA 4LXRA 4FHOA 3WN4A 4CNMA
chains in the Genus database with same CATH superfamily
2RR6A 5HZLB 2JQDA 1D0BA 1SQ0B 4R6FA 4LSXC 4BV4R 1IO0A 3WPEA 3ZYIA 1M0ZA 3G3AA 1XCDA 4Z79A 3BZ5A 3RFJA 4R09A 3E4GA 4NKHA 3KJ4A 2A0ZA 2BNHA 4V2CA 2UZXA 2XWTC 4NKGA 5LFNA 3C6NB 3UL8A 3E6JA 4CP6A 2O6RA 1OTOA 1O6SA 3A79B 4XSQA 4NZRM 4Q62A 2O6QA 3ZYNA 3UL9A 2V9TB 1K5GC 3GOZA 2RA8A 4LI2A 4R5CA 4Q3IA 5CMPA 4AW4A 4R6JA 5D3IA 4U09A 2Q4GW 5AWDA 2OMTA 4LSXA 4Z64C 1H6TA 5HDHA 5GMGA 2Z81A 4HQ1A 4V2DA 3VQ2A 3OJAA 3RFEA 2BEXA 4BSRA 4C2AB 1U0ND 2OMXA 3ULUA 2Z62A 1M9SA 1FT8A 4U7LA 2XOTA 4EZGA 3C6PB 2ID5A 3WPCA 2P1MB 4KT1A 3RJ0A 4RWTC 2WQVA 4FDWA 4ECOA 1KOHA 3G3BA 3E3ZA 4TZHA 4U08A 4P91A 3W3GA 4QXEA 3REZA 1XKUA 4XGOA 1FQVA 1OZNA 4J4LA 3WPDA 3CIGA 3CIYA 3UL7A 2Z63A 2CA6A 5IJBA 1XEUA 1G9UA 3E2JA 1DFJI 4R6AA 4L3FA 4RCAB 4R6GA 4P8SA 4ARRA 2Z7XB 5GS2B 3PMHG 3ZYJA 2Y5QA 1KOOA 2OMWA 2ASTB 5GMFA 5CMNA 2Z82A 4CILA 1LTXA 2R9UA 3FXIA 1XECA 4M7EC 4MQWX 1OTNA 4LSAA 2Z65A 4L3AA 1H6UA 1M9LA 4FCGA 4LXSA 1OTMA 2UZYA 3M19A 4PKIG 4YEBB 4BSUA 4PERA 5B4PA 3RW7A 4PEQB 2IFGA 3O6NA 2JE0A 4BSSA 4ECNA 1P9AG 5B0TA 4QBZA 4CC4C 3OJAB 2O6SA 3G39A 1OOKG 4M7EA 3OGMB 3SB4A 5IJDA 1M10B 4XOSA 4IM6A 3G04C 4GLPA 3G06A 4H09A 3TSRE 3RGXA 4J0MA 1GWBA 2JE1A 2WQUA 1A4YA 1YRGA 4G8AA 4OQTA 4FD0A 4GT6A 3OGLB 4WYKA 4WP6A 5FTTB 3RFSA 4RCWA 4R5DA 2P1PB 3UN9A 2OMZA 1XWDC 4K17A 3RIZA 4CC4A 4CNCA 4Z8GA 4KXFB 4LSCA 2P1OB 3ULVA 5IYXC 2OMYA 1FS2A 5GQRK 3WPBA 3DZEA 4B8CD 3RGZA 3M18A 3O53A 2OMVA 3ZYOA 3W3MA 2Z7XA 4R07A 5AWCA 2V9SA 3W3LA 2Z64A 3P72A 1P8TA 4Z94G 1QYYA 2WQWA 2WFHA 4R08A 2FT3A 4FS7A 4Z61C 3W3NA 2ASSB 4Y61B 3WPGA 4MN8B 4PQ8A 3ULAA 4QC0A 5GS0A 3W3KA 5IJCA 2WQXA 4R58A 1Z7XW 2ELLA 4AY9X 5B0NA 1P8VA 3C6OB 4FMZA 4UFRA 2OMUA 4PSJA 4U06A 4V2EA 1O6VA 4I6JB 5A5CA 5AWBA 4ARNA 1OGQA 2V70A 1A9NA 1FO1A 3WPIA 3VQ1A 4LI1A 4R0AA 1O6TA 3WPHA 1K5DC 5GMHA 4NZTM 1WWLA 1W8AA 1ZIWA 1DCEA 3CVRA 2P1NB 5AZ5A 4Q3GA 3OGKB 2Z66A 5AWAA 4KNGA 3JB9j 1PGVA 3RW6A 1JL5A 3W3JA 1DS9A 2P1QB 4C2BB 3WPFA 4LXRA 4FHOA 3WN4A 4CNMA
chains in the Genus database with same CATH topology
2RR6A 5HZLB 2JQDA 1D0BA 1SQ0B 4R6FA 4LSXC 4BV4R 1IO0A 3WPEA 3ZYIA 1M0ZA 3G3AA 1XCDA 4Z79A 3BZ5A 3RFJA 4R09A 3E4GA 4NKHA 3KJ4A 2A0ZA 2BNHA 4V2CA 2UZXA 2XWTC 4NKGA 5LFNA 3C6NB 3UL8A 3E6JA 4CP6A 2O6RA 1OTOA 1O6SA 3A79B 4XSQA 4Q62A 2O6QA 3ZYNA 3UL9A 2V9TB 1K5GC 3GOZA 2RA8A 4LI2A 4R5CA 4Q3IA 5CMPA 4AW4A 4R6JA 5D3IA 4U09A 2Q4GW 5AWDA 2OMTA 4LSXA 4Z64C 1H6TA 5HDHA 5GMGA 2Z81A 4HQ1A 4V2DA 3VQ2A 3OJAA 3RFEA 2BEXA 4BSRA 4C2AB 1U0ND 2OMXA 3ULUA 2Z62A 1M9SA 1FT8A 4U7LA 2XOTA 4EZGA 3C6PB 2ID5A 3WPCA 2P1MB 4KT1A 3RJ0A 4RWTC 2WQVA 4FDWA 4ECOA 1KOHA 3G3BA 3E3ZA 4TZHA 4U08A 4P91A 3W3GA 4QXEA 3REZA 1XKUA 4XGOA 1FQVA 1OZNA 4J4LA 3WPDA 3CIGA 3CIYA 3UL7A 2Z63A 2CA6A 5IJBA 1XEUA 1G9UA 3E2JA 1DFJI 4R6AA 4L3FA 4RCAB 4R6GA 4P8SA 4ARRA 2Z7XB 5GS2B 3PMHG 3ZYJA 2Y5QA 1KOOA 2OMWA 2ASTB 5GMFA 5CMNA 2Z82A 4CILA 1LTXA 2R9UA 3FXIA 1XECA 4M7EC 4MQWX 1OTNA 4LSAA 2Z65A 4L3AA 1H6UA 1M9LA 4FCGA 4LXSA 1OTMA 2UZYA 3M19A 4PKIG 4YEBB 4BSUA 4PERA 5B4PA 3RW7A 4PEQB 2IFGA 3O6NA 2JE0A 4BSSA 4ECNA 1P9AG 5B0TA 4QBZA 4CC4C 3OJAB 2O6SA 3G39A 1OOKG 4M7EA 3OGMB 3SB4A 5IJDA 1M10B 4XOSA 4IM6A 3G04C 4GLPA 3G06A 4H09A 3TSRE 3RGXA 4J0MA 1GWBA 2JE1A 2WQUA 1A4YA 1YRGA 4G8AA 4OQTA 4FD0A 4GT6A 3OGLB 4WYKA 4WP6A 5FTTB 3RFSA 4RCWA 4R5DA 2P1PB 3UN9A 2OMZA 1XWDC 4K17A 3RIZA 4CC4A 4CNCA 4Z8GA 4KXFB 4LSCA 2P1OB 3ULVA 5IYXC 2OMYA 1FS2A 5GQRK 3WPBA 3DZEA 4B8CD 3RGZA 3M18A 3O53A 2OMVA 3ZYOA 3W3MA 2Z7XA 4R07A 5AWCA 2V9SA 3W3LA 2Z64A 3P72A 1P8TA 4Z94G 1QYYA 2WQWA 2WFHA 4R08A 2FT3A 4FS7A 4Z61C 3W3NA 2ASSB 4Y61B 3WPGA 4MN8B 4PQ8A 3ULAA 4QC0A 5GS0A 3W3KA 5IJCA 2WQXA 4R58A 1Z7XW 2ELLA 4AY9X 5B0NA 1P8VA 3C6OB 4FMZA 4UFRA 2OMUA 4PSJA 4U06A 4V2EA 1O6VA 4I6JB 5A5CA 5AWBA 4ARNA 1OGQA 2V70A 1A9NA 1FO1A 3WPIA 3VQ1A 4LI1A 4R0AA 1O6TA 3WPHA 1K5DC 5GMHA 1WWLA 1W8AA 1ZIWA 1DCEA 3CVRA 2P1NB 5AZ5A 4Q3GA 3OGKB 2Z66A 5AWAA 4KNGA 3JB9j 1PGVA 3RW6A 1JL5A 3W3JA 1DS9A 2P1QB 4C2BB 3WPFA 4LXRA 4FHOA 3WN4A 4CNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR6 A;  5HZL B;  2JQD A;  1D0B A;  1SQ0 B;  4R6F A;  4LSX C;  4BV4 R;  1IO0 A;  3WPE A;  3ZYI A;  1M0Z A;  3G3A A;  1XCD A;  4Z79 A;  3BZ5 A;  3RFJ A;  4R09 A;  3E4G A;  4NKH A;  3KJ4 A;  2A0Z A;  2BNH A;  4V2C A;  2UZX A;  2XWT C;  4NKG A;  5LFN A;  3C6N B;  3UL8 A;  3E6J A;  4CP6 A;  2O6R A;  1OTO A;  1O6S A;  3A79 B;  4XSQ A;  4Q62 A;  2O6Q A;  3ZYN A;  3UL9 A;  2V9T B;  1K5G C;  3GOZ A;  2RA8 A;  4LI2 A;  4R5C A;  4Q3I A;  5CMP A;  4AW4 A;  4R6J A;  5D3I A;  4U09 A;  2Q4G W;  5AWD A;  2OMT A;  4LSX A;  4Z64 C;  1H6T A;  5HDH A;  5GMG A;  2Z81 A;  4HQ1 A;  4V2D A;  3VQ2 A;  3OJA A;  3RFE A;  2BEX A;  4BSR A;  4C2A B;  1U0N D;  2OMX A;  3ULU A;  2Z62 A;  1M9S A;  1FT8 A;  4U7L A;  2XOT A;  4EZG A;  3C6P B;  2ID5 A;  3WPC A;  2P1M B;  4KT1 A;  3RJ0 A;  4RWT C;  2WQV A;  4FDW A;  4ECO A;  1KOH A;  3G3B A;  3E3Z A;  4TZH A;  4U08 A;  4P91 A;  3W3G A;  4QXE A;  3REZ A;  1XKU A;  4XGO A;  1FQV A;  1OZN A;  4J4L A;  3WPD A;  3CIG A;  3CIY A;  3UL7 A;  2Z63 A;  2CA6 A;  5IJB A;  1XEU A;  1G9U A;  3E2J A;  1DFJ I;  4R6A A;  4L3F A;  4RCA B;  4R6G A;  4P8S A;  4ARR A;  2Z7X B;  5GS2 B;  3PMH G;  3ZYJ A;  2Y5Q A;  1KOO A;  2OMW A;  2AST B;  5GMF A;  5CMN A;  2Z82 A;  4CIL A;  1LTX A;  2R9U A;  3FXI A;  1XEC A;  4M7E C;  4MQW X;  1OTN A;  4LSA A;  2Z65 A;  4L3A A;  1H6U A;  1M9L A;  4FCG A;  4LXS A;  1OTM A;  2UZY A;  3M19 A;  4PKI G;  4YEB B;  4BSU A;  4PER A;  5B4P A;  3RW7 A;  4PEQ B;  2IFG A;  3O6N A;  2JE0 A;  4BSS A;  4ECN A;  1P9A G;  5B0T A;  4QBZ A;  4CC4 C;  3OJA B;  2O6S A;  3G39 A;  1OOK G;  4M7E A;  3OGM B;  3SB4 A;  5IJD A;  1M10 B;  4XOS A;  4IM6 A;  3G04 C;  4GLP A;  3G06 A;  4H09 A;  3TSR E;  3RGX A;  4J0M A;  1GWB A;  2JE1 A;  2WQU A;  1A4Y A;  1YRG A;  4G8A A;  4OQT A;  4FD0 A;  4GT6 A;  3OGL B;  4WYK A;  4WP6 A;  5FTT B;  3RFS A;  4RCW A;  4R5D A;  2P1P B;  3UN9 A;  2OMZ A;  1XWD C;  4K17 A;  3RIZ A;  4CC4 A;  4CNC A;  4Z8G A;  4KXF B;  4LSC A;  2P1O B;  3ULV A;  5IYX C;  2OMY A;  1FS2 A;  5GQR K;  3WPB A;  3DZE A;  4B8C D;  3RGZ A;  3M18 A;  3O53 A;  2OMV A;  3ZYO A;  3W3M A;  2Z7X A;  4R07 A;  5AWC A;  2V9S A;  3W3L A;  2Z64 A;  3P72 A;  1P8T A;  4Z94 G;  1QYY A;  2WQW A;  2WFH A;  4R08 A;  2FT3 A;  4FS7 A;  4Z61 C;  3W3N A;  2ASS B;  4Y61 B;  3WPG A;  4MN8 B;  4PQ8 A;  3ULA A;  4QC0 A;  5GS0 A;  3W3K A;  5IJC A;  2WQX A;  4R58 A;  1Z7X W;  2ELL A;  4AY9 X;  5B0N A;  1P8V A;  3C6O B;  4FMZ A;  4UFR A;  2OMU A;  4PSJ A;  4U06 A;  4V2E A;  1O6V A;  4I6J B;  5A5C A;  5AWB A;  4ARN A;  1OGQ A;  2V70 A;  1A9N A;  1FO1 A;  3WPI A;  3VQ1 A;  4LI1 A;  4R0A A;  1O6T A;  3WPH A;  1K5D C;  5GMH A;  1WWL A;  1W8A A;  1ZIW A;  1DCE A;  3CVR A;  2P1N B;  5AZ5 A;  4Q3G A;  3OGK B;  2Z66 A;  5AWA A;  4KNG A;  3JB9 j;  1PGV A;  3RW6 A;  1JL5 A;  3W3J A;  1DS9 A;  2P1Q B;  4C2B B;  3WPF A;  4LXR A;  4FHO A;  3WN4 A;  4CNM A; 
#chains in the Genus database with same CATH topology
 2RR6 A;  5HZL B;  2JQD A;  1D0B A;  1SQ0 B;  4R6F A;  4LSX C;  4BV4 R;  1IO0 A;  3WPE A;  3ZYI A;  1M0Z A;  3G3A A;  1XCD A;  4Z79 A;  3BZ5 A;  3RFJ A;  4R09 A;  3E4G A;  4NKH A;  3KJ4 A;  2A0Z A;  2BNH A;  4V2C A;  2UZX A;  2XWT C;  4NKG A;  5LFN A;  3C6N B;  3UL8 A;  3E6J A;  4CP6 A;  2O6R A;  1OTO A;  1O6S A;  3A79 B;  4XSQ A;  4NZR M;  4Q62 A;  2O6Q A;  3ZYN A;  3UL9 A;  2V9T B;  1K5G C;  3GOZ A;  2RA8 A;  4LI2 A;  4R5C A;  4Q3I A;  5CMP A;  4AW4 A;  4R6J A;  5D3I A;  4U09 A;  2Q4G W;  5AWD A;  2OMT A;  4LSX A;  4Z64 C;  1H6T A;  5HDH A;  5GMG A;  2Z81 A;  4HQ1 A;  4V2D A;  3VQ2 A;  3OJA A;  3RFE A;  2BEX A;  4BSR A;  4C2A B;  1U0N D;  2OMX A;  3ULU A;  2Z62 A;  1M9S A;  1FT8 A;  4U7L A;  2XOT A;  4EZG A;  3C6P B;  2ID5 A;  3WPC A;  2P1M B;  4KT1 A;  3RJ0 A;  4RWT C;  2WQV A;  4FDW A;  4ECO A;  1KOH A;  3G3B A;  3E3Z A;  4TZH A;  4U08 A;  4P91 A;  3W3G A;  4QXE A;  3REZ A;  1XKU A;  4XGO A;  1FQV A;  1OZN A;  4J4L A;  3WPD A;  3CIG A;  3CIY A;  3UL7 A;  2Z63 A;  2CA6 A;  5IJB A;  1XEU A;  1G9U A;  3E2J A;  1DFJ I;  4R6A A;  4L3F A;  4RCA B;  4R6G A;  4P8S A;  4ARR A;  2Z7X B;  5GS2 B;  3PMH G;  3ZYJ A;  2Y5Q A;  1KOO A;  2OMW A;  2AST B;  5GMF A;  5CMN A;  2Z82 A;  4CIL A;  1LTX A;  2R9U A;  3FXI A;  1XEC A;  4M7E C;  4MQW X;  1OTN A;  4LSA A;  2Z65 A;  4L3A A;  1H6U A;  1M9L A;  4FCG A;  4LXS A;  1OTM A;  2UZY A;  3M19 A;  4PKI G;  4YEB B;  4BSU A;  4PER A;  5B4P A;  3RW7 A;  4PEQ B;  2IFG A;  3O6N A;  2JE0 A;  4BSS A;  4ECN A;  1P9A G;  5B0T A;  4QBZ A;  4CC4 C;  3OJA B;  2O6S A;  3G39 A;  1OOK G;  4M7E A;  3OGM B;  3SB4 A;  5IJD A;  1M10 B;  4XOS A;  4IM6 A;  3G04 C;  4GLP A;  3G06 A;  4H09 A;  3TSR E;  3RGX A;  4J0M A;  1GWB A;  2JE1 A;  2WQU A;  1A4Y A;  1YRG A;  4G8A A;  4OQT A;  4FD0 A;  4GT6 A;  3OGL B;  4WYK A;  4WP6 A;  5FTT B;  3RFS A;  4RCW A;  4R5D A;  2P1P B;  3UN9 A;  2OMZ A;  1XWD C;  4K17 A;  3RIZ A;  4CC4 A;  4CNC A;  4Z8G A;  4KXF B;  4LSC A;  2P1O B;  3ULV A;  5IYX C;  2OMY A;  1FS2 A;  5GQR K;  3WPB A;  3DZE A;  4B8C D;  3RGZ A;  3M18 A;  3O53 A;  2OMV A;  3ZYO A;  3W3M A;  2Z7X A;  4R07 A;  5AWC A;  2V9S A;  3W3L A;  2Z64 A;  3P72 A;  1P8T A;  4Z94 G;  1QYY A;  2WQW A;  2WFH A;  4R08 A;  2FT3 A;  4FS7 A;  4Z61 C;  3W3N A;  2ASS B;  4Y61 B;  3WPG A;  4MN8 B;  4PQ8 A;  3ULA A;  4QC0 A;  5GS0 A;  3W3K A;  5IJC A;  2WQX A;  4R58 A;  1Z7X W;  2ELL A;  4AY9 X;  5B0N A;  1P8V A;  3C6O B;  4FMZ A;  4UFR A;  2OMU A;  4PSJ A;  4U06 A;  4V2E A;  1O6V A;  4I6J B;  5A5C A;  5AWB A;  4ARN A;  1OGQ A;  2V70 A;  1A9N A;  1FO1 A;  3WPI A;  3VQ1 A;  4LI1 A;  4R0A A;  1O6T A;  3WPH A;  1K5D C;  5GMH A;  4NZT M;  1WWL A;  1W8A A;  1ZIW A;  1DCE A;  3CVR A;  2P1N B;  5AZ5 A;  4Q3G A;  3OGK B;  2Z66 A;  5AWA A;  4KNG A;  3JB9 j;  1PGV A;  3RW6 A;  1JL5 A;  3W3J A;  1DS9 A;  2P1Q B;  4C2B B;  3WPF A;  4LXR A;  4FHO A;  3WN4 A;  4CNM A; 
#chains in the Genus database with same CATH homology
 2RR6 A;  5HZL B;  2JQD A;  1D0B A;  1SQ0 B;  4R6F A;  4LSX C;  4BV4 R;  1IO0 A;  3WPE A;  3ZYI A;  1M0Z A;  3G3A A;  1XCD A;  4Z79 A;  3BZ5 A;  3RFJ A;  4R09 A;  3E4G A;  4NKH A;  3KJ4 A;  2A0Z A;  2BNH A;  4V2C A;  2UZX A;  2XWT C;  4NKG A;  5LFN A;  3C6N B;  3UL8 A;  3E6J A;  4CP6 A;  2O6R A;  1OTO A;  1O6S A;  3A79 B;  4XSQ A;  4Q62 A;  2O6Q A;  3ZYN A;  3UL9 A;  2V9T B;  1K5G C;  3GOZ A;  2RA8 A;  4LI2 A;  4R5C A;  4Q3I A;  5CMP A;  4AW4 A;  4R6J A;  5D3I A;  4U09 A;  2Q4G W;  5AWD A;  2OMT A;  4LSX A;  4Z64 C;  1H6T A;  5HDH A;  5GMG A;  2Z81 A;  4HQ1 A;  4V2D A;  3VQ2 A;  3OJA A;  3RFE A;  2BEX A;  4BSR A;  4C2A B;  1U0N D;  2OMX A;  3ULU A;  2Z62 A;  1M9S A;  1FT8 A;  4U7L A;  2XOT A;  4EZG A;  3C6P B;  2ID5 A;  3WPC A;  2P1M B;  4KT1 A;  3RJ0 A;  4RWT C;  2WQV A;  4FDW A;  4ECO A;  1KOH A;  3G3B A;  3E3Z A;  4TZH A;  4U08 A;  4P91 A;  3W3G A;  4QXE A;  3REZ A;  1XKU A;  4XGO A;  1FQV A;  1OZN A;  4J4L A;  3WPD A;  3CIG A;  3CIY A;  3UL7 A;  2Z63 A;  2CA6 A;  5IJB A;  1XEU A;  1G9U A;  3E2J A;  1DFJ I;  4R6A A;  4L3F A;  4RCA B;  4R6G A;  4P8S A;  4ARR A;  2Z7X B;  5GS2 B;  3PMH G;  3ZYJ A;  2Y5Q A;  1KOO A;  2OMW A;  2AST B;  5GMF A;  5CMN A;  2Z82 A;  4CIL A;  1LTX A;  2R9U A;  3FXI A;  1XEC A;  4M7E C;  4MQW X;  1OTN A;  4LSA A;  2Z65 A;  4L3A A;  1H6U A;  1M9L A;  4FCG A;  4LXS A;  1OTM A;  2UZY A;  3M19 A;  4PKI G;  4YEB B;  4BSU A;  4PER A;  5B4P A;  3RW7 A;  4PEQ B;  2IFG A;  3O6N A;  2JE0 A;  4BSS A;  4ECN A;  1P9A G;  5B0T A;  4QBZ A;  4CC4 C;  3OJA B;  2O6S A;  3G39 A;  1OOK G;  4M7E A;  3OGM B;  3SB4 A;  5IJD A;  1M10 B;  4XOS A;  4IM6 A;  3G04 C;  4GLP A;  3G06 A;  4H09 A;  3TSR E;  3RGX A;  4J0M A;  1GWB A;  2JE1 A;  2WQU A;  1A4Y A;  1YRG A;  4G8A A;  4OQT A;  4FD0 A;  4GT6 A;  3OGL B;  4WYK A;  4WP6 A;  5FTT B;  3RFS A;  4RCW A;  4R5D A;  2P1P B;  3UN9 A;  2OMZ A;  1XWD C;  4K17 A;  3RIZ A;  4CC4 A;  4CNC A;  4Z8G A;  4KXF B;  4LSC A;  2P1O B;  3ULV A;  5IYX C;  2OMY A;  1FS2 A;  5GQR K;  3WPB A;  3DZE A;  4B8C D;  3RGZ A;  3M18 A;  3O53 A;  2OMV A;  3ZYO A;  3W3M A;  2Z7X A;  4R07 A;  5AWC A;  2V9S A;  3W3L A;  2Z64 A;  3P72 A;  1P8T A;  4Z94 G;  1QYY A;  2WQW A;  2WFH A;  4R08 A;  2FT3 A;  4FS7 A;  4Z61 C;  3W3N A;  2ASS B;  4Y61 B;  3WPG A;  4MN8 B;  4PQ8 A;  3ULA A;  4QC0 A;  5GS0 A;  3W3K A;  5IJC A;  2WQX A;  4R58 A;  1Z7X W;  2ELL A;  4AY9 X;  5B0N A;  1P8V A;  3C6O B;  4FMZ A;  4UFR A;  2OMU A;  4PSJ A;  4U06 A;  4V2E A;  1O6V A;  4I6J B;  5A5C A;  5AWB A;  4ARN A;  1OGQ A;  2V70 A;  1A9N A;  1FO1 A;  3WPI A;  3VQ1 A;  4LI1 A;  4R0A A;  1O6T A;  3WPH A;  1K5D C;  5GMH A;  1WWL A;  1W8A A;  1ZIW A;  1DCE A;  3CVR A;  2P1N B;  5AZ5 A;  4Q3G A;  3OGK B;  2Z66 A;  5AWA A;  4KNG A;  3JB9 j;  1PGV A;  3RW6 A;  1JL5 A;  3W3J A;  1DS9 A;  2P1Q B;  4C2B B;  3WPF A;  4LXR A;  4FHO A;  3WN4 A;  4CNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...