3SB4A

Crystal structure of a leucine-rich repeat protein (bt_1240) from bacteroides thetaiotaomicron vpi-5482 at 1.99 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
328
Chain Sequence
GQVSKTYYVSKPGTLISMMTEEEANSITHLTLTGKLNAEDFRHLRDEFPSLKVLDISNAEIKMYSGKAGTYPNGKFYIYMANFVPAYAFSNVVNGVTKGKQTLEKILSEKIKNIEDAAFKGCDNLKICQIRKKTAPNLLPEALADSVTAIFIPLGSSDAYRFKNRWEHFAFIEGEPLETTIQVGAMGKLEDEIMKAGLQPRDINFLTIEGKLDNADFKLIRDYMPNLVSLDISKTNATTIPDFTFAQKKYLLKIKLPHNLKTIGQRVFSNCGRLAGTLELPASVTAIEFGAFMGCDNLRYVLATGDKITTLGDELFGNGVPSKLIYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Hypothetical leucine rich repeat protein
publication title Crystal structure of a Hypothetical leucine rich repeat protein (BT_1240) from Bacteroides thetaiotaomicron VPI-5482 at 1.99 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 102
structure length 328
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3sb4A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3sb4A02
1M9SA 2IFGA 1OGQA 2OMTA 2Z7XA 4EZGA 4UFRA 3E2JA 1H6TA 3WPFA 4GT6A 3P72A 3RFEA 3WPCA 3G39A 3OJAA 3E3ZA 4BSRA 5B0NA 2WQVA 1Z7XW 3GOZA 4MN8B 5AWCA 1U0ND 5FTTB 4M7EC 2R9UA 4Z94G 4ARRA 3W3KA 5AWAA 2ID5A 5A5CA 2O6RA 4RWTC 4Z8GA 3W3MA 4U06A 4BSUA 5GMGA 3WPHA 4V2DA 4J4LA 1P8VA 2Z7XB 2Z81A 3O6NA 4QC0A 5HZLB 4H09A 1GWBA 4PQ8A 3WN4A 1FT8A 4BV4R 5CMPA 3WPDA 2JE0A 3OJAB 3C6OB 1KOOA 4XGOA 3ZYIA 4FHOA 2XWTC 2P1PB 4FDWA 1FS2A 1A4YA 3CIYA 2OMYA 3BZ5A 4PERA 2P1QB 3WPBA 5GMFA 3UL7A 3REZA 2ASSB 3M18A 2Z62A 1DCEA 4CNCA 4PSJA 4NKGA 3G3AA 1OTOA 1K5DC 3G3BA 5IJBA 2V70A 2V9SA 1OTMA 4R58A 3C6PB 4K17A 5D3IA 4R5CA 4XSQA 3E6JA 4GLPA 4CC4A 1A9NA 2P1NB 5LFNA 2UZXA 4RCWA 3CIGA 5B0TA 3G06A 2XOTA 3WPEA 4U08A 1OZNA 1G9UA 3M19A 4Z64C 3C6NB 4R07A 2WQUA 4P8SA 4LSAA 1OTNA 4U09A 2RR6A 3RGZA 2RA8A 4IM6A 1XEUA 4B8CD 1XCDA 4KXFB 3RFSA 4U7LA 4R6GA 4MQWX 4M7EA 3RW6A 4L3AA 4FD0A 3E4GA 4R5DA 4XOSA 4PEQB 2OMVA 4QXEA 3DZEA 5GQRK 4J0MA 5GS2B 1ZIWA 4CILA 2WFHA 4Q3GA 4WYKA 4P91A 3ZYNA 2P1MB 1JL5A 4V2CA 5CMNA 4Q3IA 4OQTA 4R0AA 3UL9A 4R08A 2V9TB 2CA6A 1M10B 4Q62A 5IJDA 1H6UA 4V2EA 3UL8A 4R6AA 1O6TA 3W3JA 4I6JB 2OMWA 3SB4A 3VQ1A 5IYXC 3O53A 2Y5QA 3OGKB 1OOKG 4ARNA 3TSRE 1M0ZA 4FS7A 4R6FA 1D0BA 2JQDA 4LI1A 2WQWA 1FQVA 3A79B 1XKUA 2ELLA 2Z82A 3KJ4A 1DS9A 4G8AA 1XECA 2BEXA 5IJCA 4LSCA 4KNGA 5HDHA 3VQ2A 4YEBB 3W3LA 4LXRA 4TZHA 4QBZA 4Z61C 4ECOA 4PKIG 2O6QA 1M9LA 5B4PA 4C2AB 2Z65A 3FXIA 3RFJA 1O6VA 1LTXA 5GMHA 3WPIA 3RJ0A 4C2BB 3PMHG 4FMZA 3RW7A 5GS0A 1FO1A 3RIZA 1O6SA 2Z63A 3OGLB 2ASTB 3JB9j 1XWDC 2Q4GW 1P8TA 3ZYOA 2OMUA 4L3FA 1PGVA 4AW4A 3ULUA 4BSSA 2Z66A 2Z64A 4HQ1A 3RGXA 5AWDA 4FCGA 2O6SA 5AWBA 1SQ0B 4RCAB 3ULVA 4ECNA 3G04C 1K5GC 1WWLA 4LI2A 2OMZA 4AY9X 4CP6A 2A0ZA 4WP6A 1QYYA 4KT1A 3UN9A 2BNHA 3W3NA 2OMXA 4Z79A 3ZYJA 4R6JA 1YRGA 4R09A 2UZYA 2P1OB 4LSXC 1KOHA 3W3GA 3ULAA 4NKHA 4LXSA 4LSXA 2WQXA 1P9AG 4CNMA 3OGMB 1DFJI 2JE1A 3WPGA 1IO0A 2FT3A 3CVRA 5AZ5A 4Y61B 1W8AA 4CC4C
chains in the Genus database with same CATH superfamily
1M9SA 2IFGA 1OGQA 2OMTA 2Z7XA 4EZGA 4UFRA 3E2JA 1H6TA 3WPFA 4GT6A 3P72A 3RFEA 3WPCA 3G39A 3OJAA 3E3ZA 4BSRA 5B0NA 2WQVA 1Z7XW 3GOZA 4MN8B 5AWCA 1U0ND 5FTTB 4M7EC 2R9UA 4Z94G 4ARRA 3W3KA 5AWAA 2ID5A 5A5CA 2O6RA 4RWTC 4Z8GA 4NZRM 3W3MA 4U06A 4BSUA 5GMGA 3WPHA 4V2DA 4J4LA 1P8VA 2Z7XB 2Z81A 3O6NA 4QC0A 5HZLB 4H09A 1GWBA 4PQ8A 3WN4A 1FT8A 4BV4R 5CMPA 3WPDA 2JE0A 3OJAB 3C6OB 1KOOA 4XGOA 3ZYIA 4FHOA 2XWTC 2P1PB 4FDWA 1FS2A 1A4YA 3CIYA 2OMYA 3BZ5A 4PERA 2P1QB 3WPBA 5GMFA 3UL7A 3REZA 2ASSB 3M18A 2Z62A 1DCEA 4CNCA 4PSJA 4NKGA 3G3AA 1OTOA 1K5DC 3G3BA 5IJBA 2V70A 2V9SA 1OTMA 4R58A 3C6PB 4K17A 5D3IA 4R5CA 4XSQA 3E6JA 4GLPA 4CC4A 1A9NA 2P1NB 5LFNA 2UZXA 4RCWA 3CIGA 5B0TA 3G06A 2XOTA 3WPEA 4U08A 1OZNA 1G9UA 3M19A 4Z64C 3C6NB 4R07A 2WQUA 4P8SA 4LSAA 1OTNA 4U09A 2RR6A 3RGZA 2RA8A 4NZTM 4IM6A 1XEUA 4B8CD 1XCDA 4KXFB 3RFSA 4U7LA 4R6GA 4MQWX 4M7EA 3RW6A 4L3AA 4FD0A 3E4GA 4R5DA 4XOSA 4PEQB 2OMVA 4QXEA 3DZEA 5GQRK 4J0MA 5GS2B 1ZIWA 4CILA 2WFHA 4Q3GA 4WYKA 4P91A 3ZYNA 2P1MB 1JL5A 4V2CA 5CMNA 4Q3IA 4OQTA 4R0AA 3UL9A 4R08A 2V9TB 2CA6A 1M10B 4Q62A 5IJDA 1H6UA 4V2EA 3UL8A 4R6AA 1O6TA 3W3JA 4I6JB 2OMWA 3SB4A 3VQ1A 5IYXC 3O53A 2Y5QA 3OGKB 1OOKG 4ARNA 3TSRE 1M0ZA 4FS7A 4R6FA 1D0BA 2JQDA 4LI1A 2WQWA 1FQVA 3A79B 1XKUA 2ELLA 2Z82A 3KJ4A 1DS9A 4G8AA 1XECA 2BEXA 5IJCA 4LSCA 4KNGA 5HDHA 3VQ2A 4YEBB 3W3LA 4LXRA 4TZHA 4QBZA 4Z61C 4ECOA 4PKIG 2O6QA 1M9LA 5B4PA 4C2AB 2Z65A 3FXIA 3RFJA 1O6VA 1LTXA 5GMHA 3WPIA 3RJ0A 4C2BB 3PMHG 4FMZA 3RW7A 5GS0A 1FO1A 3RIZA 1O6SA 2Z63A 3OGLB 2ASTB 3JB9j 1XWDC 2Q4GW 1P8TA 3ZYOA 2OMUA 4L3FA 1PGVA 4AW4A 3ULUA 4BSSA 2Z66A 2Z64A 4HQ1A 3RGXA 5AWDA 4FCGA 2O6SA 5AWBA 1SQ0B 4RCAB 3ULVA 4ECNA 3G04C 1K5GC 1WWLA 4LI2A 2OMZA 4AY9X 4CP6A 2A0ZA 4WP6A 1QYYA 4KT1A 3UN9A 2BNHA 3W3NA 2OMXA 4Z79A 3ZYJA 4R6JA 1YRGA 4R09A 2UZYA 2P1OB 4LSXC 1KOHA 3W3GA 3ULAA 4NKHA 4LXSA 4LSXA 2WQXA 1P9AG 4CNMA 3OGMB 1DFJI 2JE1A 3WPGA 1IO0A 2FT3A 3CVRA 5AZ5A 4Y61B 1W8AA 4CC4C
chains in the Genus database with same CATH topology
1M9SA 2IFGA 1OGQA 2OMTA 2Z7XA 4EZGA 4UFRA 3E2JA 1H6TA 3WPFA 4GT6A 3P72A 3RFEA 3WPCA 3G39A 3OJAA 3E3ZA 4BSRA 5B0NA 2WQVA 1Z7XW 3GOZA 4MN8B 5AWCA 1U0ND 5FTTB 4M7EC 2R9UA 4Z94G 4ARRA 3W3KA 5AWAA 2ID5A 5A5CA 2O6RA 4RWTC 4Z8GA 3W3MA 4U06A 4BSUA 5GMGA 3WPHA 4V2DA 4J4LA 1P8VA 2Z7XB 2Z81A 3O6NA 4QC0A 5HZLB 4H09A 1GWBA 4PQ8A 3WN4A 1FT8A 4BV4R 5CMPA 3WPDA 2JE0A 3OJAB 3C6OB 1KOOA 4XGOA 3ZYIA 4FHOA 2XWTC 2P1PB 4FDWA 1FS2A 1A4YA 3CIYA 2OMYA 3BZ5A 4PERA 2P1QB 3WPBA 5GMFA 3UL7A 3REZA 2ASSB 3M18A 2Z62A 1DCEA 4CNCA 4PSJA 4NKGA 3G3AA 1OTOA 1K5DC 3G3BA 5IJBA 2V70A 2V9SA 1OTMA 4R58A 3C6PB 4K17A 5D3IA 4R5CA 4XSQA 3E6JA 4GLPA 4CC4A 1A9NA 2P1NB 5LFNA 2UZXA 4RCWA 3CIGA 5B0TA 3G06A 2XOTA 3WPEA 4U08A 1OZNA 1G9UA 3M19A 4Z64C 3C6NB 4R07A 2WQUA 4P8SA 4LSAA 1OTNA 4U09A 2RR6A 3RGZA 2RA8A 4IM6A 1XEUA 4B8CD 1XCDA 4KXFB 3RFSA 4U7LA 4R6GA 4MQWX 4M7EA 3RW6A 4L3AA 4FD0A 3E4GA 4R5DA 4XOSA 4PEQB 2OMVA 4QXEA 3DZEA 5GQRK 4J0MA 5GS2B 1ZIWA 4CILA 2WFHA 4Q3GA 4WYKA 4P91A 3ZYNA 2P1MB 1JL5A 4V2CA 5CMNA 4Q3IA 4OQTA 4R0AA 3UL9A 4R08A 2V9TB 2CA6A 1M10B 4Q62A 5IJDA 1H6UA 4V2EA 3UL8A 4R6AA 1O6TA 3W3JA 4I6JB 2OMWA 3SB4A 3VQ1A 5IYXC 3O53A 2Y5QA 3OGKB 1OOKG 4ARNA 3TSRE 1M0ZA 4FS7A 4R6FA 1D0BA 2JQDA 4LI1A 2WQWA 1FQVA 3A79B 1XKUA 2ELLA 2Z82A 3KJ4A 1DS9A 4G8AA 1XECA 2BEXA 5IJCA 4LSCA 4KNGA 5HDHA 3VQ2A 4YEBB 3W3LA 4LXRA 4TZHA 4QBZA 4Z61C 4ECOA 4PKIG 2O6QA 1M9LA 5B4PA 4C2AB 2Z65A 3FXIA 3RFJA 1O6VA 1LTXA 5GMHA 3WPIA 3RJ0A 4C2BB 3PMHG 4FMZA 3RW7A 5GS0A 1FO1A 3RIZA 1O6SA 2Z63A 3OGLB 2ASTB 3JB9j 1XWDC 2Q4GW 1P8TA 3ZYOA 2OMUA 4L3FA 1PGVA 4AW4A 3ULUA 4BSSA 2Z66A 2Z64A 4HQ1A 3RGXA 5AWDA 4FCGA 2O6SA 5AWBA 1SQ0B 4RCAB 3ULVA 4ECNA 3G04C 1K5GC 1WWLA 4LI2A 2OMZA 4AY9X 4CP6A 2A0ZA 4WP6A 1QYYA 4KT1A 3UN9A 2BNHA 3W3NA 2OMXA 4Z79A 3ZYJA 4R6JA 1YRGA 4R09A 2UZYA 2P1OB 4LSXC 1KOHA 3W3GA 3ULAA 4NKHA 4LXSA 4LSXA 2WQXA 1P9AG 4CNMA 3OGMB 1DFJI 2JE1A 3WPGA 1IO0A 2FT3A 3CVRA 5AZ5A 4Y61B 1W8AA 4CC4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9S A;  2IFG A;  1OGQ A;  2OMT A;  2Z7X A;  4EZG A;  4UFR A;  3E2J A;  1H6T A;  3WPF A;  4GT6 A;  3P72 A;  3RFE A;  3WPC A;  3G39 A;  3OJA A;  3E3Z A;  4BSR A;  5B0N A;  2WQV A;  1Z7X W;  3GOZ A;  4MN8 B;  5AWC A;  1U0N D;  5FTT B;  4M7E C;  2R9U A;  4Z94 G;  4ARR A;  3W3K A;  5AWA A;  2ID5 A;  5A5C A;  2O6R A;  4RWT C;  4Z8G A;  3W3M A;  4U06 A;  4BSU A;  5GMG A;  3WPH A;  4V2D A;  4J4L A;  1P8V A;  2Z7X B;  2Z81 A;  3O6N A;  4QC0 A;  5HZL B;  4H09 A;  1GWB A;  4PQ8 A;  3WN4 A;  1FT8 A;  4BV4 R;  5CMP A;  3WPD A;  2JE0 A;  3OJA B;  3C6O B;  1KOO A;  4XGO A;  3ZYI A;  4FHO A;  2XWT C;  2P1P B;  4FDW A;  1FS2 A;  1A4Y A;  3CIY A;  2OMY A;  3BZ5 A;  4PER A;  2P1Q B;  3WPB A;  5GMF A;  3UL7 A;  3REZ A;  2ASS B;  3M18 A;  2Z62 A;  1DCE A;  4CNC A;  4PSJ A;  4NKG A;  3G3A A;  1OTO A;  1K5D C;  3G3B A;  5IJB A;  2V70 A;  2V9S A;  1OTM A;  4R58 A;  3C6P B;  4K17 A;  5D3I A;  4R5C A;  4XSQ A;  3E6J A;  4GLP A;  4CC4 A;  1A9N A;  2P1N B;  5LFN A;  2UZX A;  4RCW A;  3CIG A;  5B0T A;  3G06 A;  2XOT A;  3WPE A;  4U08 A;  1OZN A;  1G9U A;  3M19 A;  4Z64 C;  3C6N B;  4R07 A;  2WQU A;  4P8S A;  4LSA A;  1OTN A;  4U09 A;  2RR6 A;  3RGZ A;  2RA8 A;  4IM6 A;  1XEU A;  4B8C D;  1XCD A;  4KXF B;  3RFS A;  4U7L A;  4R6G A;  4MQW X;  4M7E A;  3RW6 A;  4L3A A;  4FD0 A;  3E4G A;  4R5D A;  4XOS A;  4PEQ B;  2OMV A;  4QXE A;  3DZE A;  5GQR K;  4J0M A;  5GS2 B;  1ZIW A;  4CIL A;  2WFH A;  4Q3G A;  4WYK A;  4P91 A;  3ZYN A;  2P1M B;  1JL5 A;  4V2C A;  5CMN A;  4Q3I A;  4OQT A;  4R0A A;  3UL9 A;  4R08 A;  2V9T B;  2CA6 A;  1M10 B;  4Q62 A;  5IJD A;  1H6U A;  4V2E A;  3UL8 A;  4R6A A;  1O6T A;  3W3J A;  4I6J B;  2OMW A;  3SB4 A;  3VQ1 A;  5IYX C;  3O53 A;  2Y5Q A;  3OGK B;  1OOK G;  4ARN A;  3TSR E;  1M0Z A;  4FS7 A;  4R6F A;  1D0B A;  2JQD A;  4LI1 A;  2WQW A;  1FQV A;  3A79 B;  1XKU A;  2ELL A;  2Z82 A;  3KJ4 A;  1DS9 A;  4G8A A;  1XEC A;  2BEX A;  5IJC A;  4LSC A;  4KNG A;  5HDH A;  3VQ2 A;  4YEB B;  3W3L A;  4LXR A;  4TZH A;  4QBZ A;  4Z61 C;  4ECO A;  4PKI G;  2O6Q A;  1M9L A;  5B4P A;  4C2A B;  2Z65 A;  3FXI A;  3RFJ A;  1O6V A;  1LTX A;  5GMH A;  3WPI A;  3RJ0 A;  4C2B B;  3PMH G;  4FMZ A;  3RW7 A;  5GS0 A;  1FO1 A;  3RIZ A;  1O6S A;  2Z63 A;  3OGL B;  2AST B;  3JB9 j;  1XWD C;  2Q4G W;  1P8T A;  3ZYO A;  2OMU A;  4L3F A;  1PGV A;  4AW4 A;  3ULU A;  4BSS A;  2Z66 A;  2Z64 A;  4HQ1 A;  3RGX A;  5AWD A;  4FCG A;  2O6S A;  5AWB A;  1SQ0 B;  4RCA B;  3ULV A;  4ECN A;  3G04 C;  1K5G C;  1WWL A;  4LI2 A;  2OMZ A;  4AY9 X;  4CP6 A;  2A0Z A;  4WP6 A;  1QYY A;  4KT1 A;  3UN9 A;  2BNH A;  3W3N A;  2OMX A;  4Z79 A;  3ZYJ A;  4R6J A;  1YRG A;  4R09 A;  2UZY A;  2P1O B;  4LSX C;  1KOH A;  3W3G A;  3ULA A;  4NKH A;  4LXS A;  4LSX A;  2WQX A;  1P9A G;  4CNM A;  3OGM B;  1DFJ I;  2JE1 A;  3WPG A;  1IO0 A;  2FT3 A;  3CVR A;  5AZ5 A;  4Y61 B;  1W8A A;  4CC4 C; 
#chains in the Genus database with same CATH topology
 1M9S A;  2IFG A;  1OGQ A;  2OMT A;  2Z7X A;  4EZG A;  4UFR A;  3E2J A;  1H6T A;  3WPF A;  4GT6 A;  3P72 A;  3RFE A;  3WPC A;  3G39 A;  3OJA A;  3E3Z A;  4BSR A;  5B0N A;  2WQV A;  1Z7X W;  3GOZ A;  4MN8 B;  5AWC A;  1U0N D;  5FTT B;  4M7E C;  2R9U A;  4Z94 G;  4ARR A;  3W3K A;  5AWA A;  2ID5 A;  5A5C A;  2O6R A;  4RWT C;  4Z8G A;  4NZR M;  3W3M A;  4U06 A;  4BSU A;  5GMG A;  3WPH A;  4V2D A;  4J4L A;  1P8V A;  2Z7X B;  2Z81 A;  3O6N A;  4QC0 A;  5HZL B;  4H09 A;  1GWB A;  4PQ8 A;  3WN4 A;  1FT8 A;  4BV4 R;  5CMP A;  3WPD A;  2JE0 A;  3OJA B;  3C6O B;  1KOO A;  4XGO A;  3ZYI A;  4FHO A;  2XWT C;  2P1P B;  4FDW A;  1FS2 A;  1A4Y A;  3CIY A;  2OMY A;  3BZ5 A;  4PER A;  2P1Q B;  3WPB A;  5GMF A;  3UL7 A;  3REZ A;  2ASS B;  3M18 A;  2Z62 A;  1DCE A;  4CNC A;  4PSJ A;  4NKG A;  3G3A A;  1OTO A;  1K5D C;  3G3B A;  5IJB A;  2V70 A;  2V9S A;  1OTM A;  4R58 A;  3C6P B;  4K17 A;  5D3I A;  4R5C A;  4XSQ A;  3E6J A;  4GLP A;  4CC4 A;  1A9N A;  2P1N B;  5LFN A;  2UZX A;  4RCW A;  3CIG A;  5B0T A;  3G06 A;  2XOT A;  3WPE A;  4U08 A;  1OZN A;  1G9U A;  3M19 A;  4Z64 C;  3C6N B;  4R07 A;  2WQU A;  4P8S A;  4LSA A;  1OTN A;  4U09 A;  2RR6 A;  3RGZ A;  2RA8 A;  4NZT M;  4IM6 A;  1XEU A;  4B8C D;  1XCD A;  4KXF B;  3RFS A;  4U7L A;  4R6G A;  4MQW X;  4M7E A;  3RW6 A;  4L3A A;  4FD0 A;  3E4G A;  4R5D A;  4XOS A;  4PEQ B;  2OMV A;  4QXE A;  3DZE A;  5GQR K;  4J0M A;  5GS2 B;  1ZIW A;  4CIL A;  2WFH A;  4Q3G A;  4WYK A;  4P91 A;  3ZYN A;  2P1M B;  1JL5 A;  4V2C A;  5CMN A;  4Q3I A;  4OQT A;  4R0A A;  3UL9 A;  4R08 A;  2V9T B;  2CA6 A;  1M10 B;  4Q62 A;  5IJD A;  1H6U A;  4V2E A;  3UL8 A;  4R6A A;  1O6T A;  3W3J A;  4I6J B;  2OMW A;  3SB4 A;  3VQ1 A;  5IYX C;  3O53 A;  2Y5Q A;  3OGK B;  1OOK G;  4ARN A;  3TSR E;  1M0Z A;  4FS7 A;  4R6F A;  1D0B A;  2JQD A;  4LI1 A;  2WQW A;  1FQV A;  3A79 B;  1XKU A;  2ELL A;  2Z82 A;  3KJ4 A;  1DS9 A;  4G8A A;  1XEC A;  2BEX A;  5IJC A;  4LSC A;  4KNG A;  5HDH A;  3VQ2 A;  4YEB B;  3W3L A;  4LXR A;  4TZH A;  4QBZ A;  4Z61 C;  4ECO A;  4PKI G;  2O6Q A;  1M9L A;  5B4P A;  4C2A B;  2Z65 A;  3FXI A;  3RFJ A;  1O6V A;  1LTX A;  5GMH A;  3WPI A;  3RJ0 A;  4C2B B;  3PMH G;  4FMZ A;  3RW7 A;  5GS0 A;  1FO1 A;  3RIZ A;  1O6S A;  2Z63 A;  3OGL B;  2AST B;  3JB9 j;  1XWD C;  2Q4G W;  1P8T A;  3ZYO A;  2OMU A;  4L3F A;  1PGV A;  4AW4 A;  3ULU A;  4BSS A;  2Z66 A;  2Z64 A;  4HQ1 A;  3RGX A;  5AWD A;  4FCG A;  2O6S A;  5AWB A;  1SQ0 B;  4RCA B;  3ULV A;  4ECN A;  3G04 C;  1K5G C;  1WWL A;  4LI2 A;  2OMZ A;  4AY9 X;  4CP6 A;  2A0Z A;  4WP6 A;  1QYY A;  4KT1 A;  3UN9 A;  2BNH A;  3W3N A;  2OMX A;  4Z79 A;  3ZYJ A;  4R6J A;  1YRG A;  4R09 A;  2UZY A;  2P1O B;  4LSX C;  1KOH A;  3W3G A;  3ULA A;  4NKH A;  4LXS A;  4LSX A;  2WQX A;  1P9A G;  4CNM A;  3OGM B;  1DFJ I;  2JE1 A;  3WPG A;  1IO0 A;  2FT3 A;  3CVR A;  5AZ5 A;  4Y61 B;  1W8A A;  4CC4 C; 
#chains in the Genus database with same CATH homology
 1M9S A;  2IFG A;  1OGQ A;  2OMT A;  2Z7X A;  4EZG A;  4UFR A;  3E2J A;  1H6T A;  3WPF A;  4GT6 A;  3P72 A;  3RFE A;  3WPC A;  3G39 A;  3OJA A;  3E3Z A;  4BSR A;  5B0N A;  2WQV A;  1Z7X W;  3GOZ A;  4MN8 B;  5AWC A;  1U0N D;  5FTT B;  4M7E C;  2R9U A;  4Z94 G;  4ARR A;  3W3K A;  5AWA A;  2ID5 A;  5A5C A;  2O6R A;  4RWT C;  4Z8G A;  3W3M A;  4U06 A;  4BSU A;  5GMG A;  3WPH A;  4V2D A;  4J4L A;  1P8V A;  2Z7X B;  2Z81 A;  3O6N A;  4QC0 A;  5HZL B;  4H09 A;  1GWB A;  4PQ8 A;  3WN4 A;  1FT8 A;  4BV4 R;  5CMP A;  3WPD A;  2JE0 A;  3OJA B;  3C6O B;  1KOO A;  4XGO A;  3ZYI A;  4FHO A;  2XWT C;  2P1P B;  4FDW A;  1FS2 A;  1A4Y A;  3CIY A;  2OMY A;  3BZ5 A;  4PER A;  2P1Q B;  3WPB A;  5GMF A;  3UL7 A;  3REZ A;  2ASS B;  3M18 A;  2Z62 A;  1DCE A;  4CNC A;  4PSJ A;  4NKG A;  3G3A A;  1OTO A;  1K5D C;  3G3B A;  5IJB A;  2V70 A;  2V9S A;  1OTM A;  4R58 A;  3C6P B;  4K17 A;  5D3I A;  4R5C A;  4XSQ A;  3E6J A;  4GLP A;  4CC4 A;  1A9N A;  2P1N B;  5LFN A;  2UZX A;  4RCW A;  3CIG A;  5B0T A;  3G06 A;  2XOT A;  3WPE A;  4U08 A;  1OZN A;  1G9U A;  3M19 A;  4Z64 C;  3C6N B;  4R07 A;  2WQU A;  4P8S A;  4LSA A;  1OTN A;  4U09 A;  2RR6 A;  3RGZ A;  2RA8 A;  4IM6 A;  1XEU A;  4B8C D;  1XCD A;  4KXF B;  3RFS A;  4U7L A;  4R6G A;  4MQW X;  4M7E A;  3RW6 A;  4L3A A;  4FD0 A;  3E4G A;  4R5D A;  4XOS A;  4PEQ B;  2OMV A;  4QXE A;  3DZE A;  5GQR K;  4J0M A;  5GS2 B;  1ZIW A;  4CIL A;  2WFH A;  4Q3G A;  4WYK A;  4P91 A;  3ZYN A;  2P1M B;  1JL5 A;  4V2C A;  5CMN A;  4Q3I A;  4OQT A;  4R0A A;  3UL9 A;  4R08 A;  2V9T B;  2CA6 A;  1M10 B;  4Q62 A;  5IJD A;  1H6U A;  4V2E A;  3UL8 A;  4R6A A;  1O6T A;  3W3J A;  4I6J B;  2OMW A;  3SB4 A;  3VQ1 A;  5IYX C;  3O53 A;  2Y5Q A;  3OGK B;  1OOK G;  4ARN A;  3TSR E;  1M0Z A;  4FS7 A;  4R6F A;  1D0B A;  2JQD A;  4LI1 A;  2WQW A;  1FQV A;  3A79 B;  1XKU A;  2ELL A;  2Z82 A;  3KJ4 A;  1DS9 A;  4G8A A;  1XEC A;  2BEX A;  5IJC A;  4LSC A;  4KNG A;  5HDH A;  3VQ2 A;  4YEB B;  3W3L A;  4LXR A;  4TZH A;  4QBZ A;  4Z61 C;  4ECO A;  4PKI G;  2O6Q A;  1M9L A;  5B4P A;  4C2A B;  2Z65 A;  3FXI A;  3RFJ A;  1O6V A;  1LTX A;  5GMH A;  3WPI A;  3RJ0 A;  4C2B B;  3PMH G;  4FMZ A;  3RW7 A;  5GS0 A;  1FO1 A;  3RIZ A;  1O6S A;  2Z63 A;  3OGL B;  2AST B;  3JB9 j;  1XWD C;  2Q4G W;  1P8T A;  3ZYO A;  2OMU A;  4L3F A;  1PGV A;  4AW4 A;  3ULU A;  4BSS A;  2Z66 A;  2Z64 A;  4HQ1 A;  3RGX A;  5AWD A;  4FCG A;  2O6S A;  5AWB A;  1SQ0 B;  4RCA B;  3ULV A;  4ECN A;  3G04 C;  1K5G C;  1WWL A;  4LI2 A;  2OMZ A;  4AY9 X;  4CP6 A;  2A0Z A;  4WP6 A;  1QYY A;  4KT1 A;  3UN9 A;  2BNH A;  3W3N A;  2OMX A;  4Z79 A;  3ZYJ A;  4R6J A;  1YRG A;  4R09 A;  2UZY A;  2P1O B;  4LSX C;  1KOH A;  3W3G A;  3ULA A;  4NKH A;  4LXS A;  4LSX A;  2WQX A;  1P9A G;  4CNM A;  3OGM B;  1DFJ I;  2JE1 A;  3WPG A;  1IO0 A;  2FT3 A;  3CVR A;  5AZ5 A;  4Y61 B;  1W8A A;  4CC4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...