3PMHG

Mechanism of sulfotyrosine-mediated glycoprotein ib interaction with two distinct alpha-thrombin sites
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
284
structure length
281
Chain Sequence
HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLDPEEDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood cloting, hydrolase/inhibitor
molecule keywords THROMBIN ALPHA-CHAIN
publication title Binding of alpha-thrombin to surface-anchored platelet glycoprotein Ib(alpha) sulfotyrosines through a two-site mechanism involving exosite I.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 281
sequence length 284
ec nomenclature
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01462 LRRNT Leucine rich repeat N-terminal domain
G PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3pmhG00
2ELLA 1M10B 3GOZA 4V2DA 4GLPA 5AWBA 5AWDA 3RFSA 4ECNA 1O6VA 3CVRA 1KOHA 4V2CA 4R6AA 3JB9j 4OQTA 2R9UA 4TZHA 4U09A 4LSAA 4R5DA 5AWCA 3W3NA 3UL8A 5IJDA 4YEBB 2Z7XB 2Z81A 2BNHA 3ULAA 4FDWA 4WYKA 4BSUA 4PSJA 2IFGA 2P1QB 3G3BA 4U06A 2ID5A 3E2JA 5GMGA 3C6OB 1G9UA 1OTNA 3G06A 3DZEA 1A4YA 2Z66A 1SQ0B 2OMVA 4ECOA 4M7EA 5HDHA 4L3FA 4IM6A 4AY9X 4FS7A 5B0TA 4EZGA 5GQRK 3WPIA 3OJAA 3G3AA 2P1MB 3RJ0A 4Q62A 1ZIWA 1K5GC 3W3KA 3WPFA 1DS9A 3WPGA 2UZXA 3VQ1A 4CC4C 4ARNA 3RW6A 1P8TA 1XEUA 1LTXA 4LI2A 4P8SA 3P72A 1D0BA 3M18A 5IJBA 4XGOA 4U7LA 4Z61C 1WWLA 2OMZA 2Z82A 5FTTB 4GT6A 4BSRA 1M9SA 4KNGA 3UL7A 4PQ8A 3C6PB 4FMZA 1P9AG 4B8CD 1GWBA 1DFJI 1FT8A 2Q4GW 2JE0A 1XWDC 2RR6A 4V2EA 4LI1A 3G04C 4MN8B 4R07A 4RCAB 4R09A 4Z64C 5B4PA 4PKIG 3O6NA 4R6JA 2OMXA 4Y61B 1OOKG 4J4LA 3ZYOA 4R6FA 2WQXA 4PEQB 2JE1A 4RCWA 3UL9A 1PGVA 3OGLB 3W3LA 1XCDA 3OJAB 4C2BB 3OGMB 3W3JA 2ASSB 2RA8A 5LFNA 4K17A 2P1NB 3ZYJA 3UN9A 2CA6A 3ULVA 1IO0A 5IJCA 4M7EC 5GMHA 3WPDA 1H6UA 1H6TA 1OGQA 3RFJA 1YRGA 5B0NA 2A0ZA 4BV4R 2Y5QA 5GMFA 2V9TB 1O6TA 4FCGA 4FD0A 5GS2B 3ZYNA 5HZLB 1DCEA 2WFHA 4MQWX 4I6JB 3REZA 3SB4A 4G8AA 4R6GA 3FXIA 4XOSA 3KJ4A 4QXEA 1XECA 2FT3A 4R08A 1M9LA 3A79B 2OMTA 4FHOA 3RGXA 5AWAA 2Z7XA 4P91A 1OTOA 4L3AA 4WP6A 5CMNA 1QYYA 1FQVA 4UFRA 4C2AB 1A9NA 4BSSA 3ULUA 2O6QA 4U08A 4R5CA 2P1OB 4CNCA 2OMUA 2WQUA 1OTMA 3VQ2A 4LXSA 4HQ1A 3E3ZA 4Q3GA 3WPHA 4CILA 3BZ5A 4Z8GA 4KXFB 4LSXA 3RW7A 3RIZA 1FS2A 1U0ND 3WPEA 1P8VA 3RGZA 2UZYA 4AW4A 2JQDA 4NKHA 2P1PB 5A5CA 2Z63A 3OGKB 2Z65A 3RFEA 4H09A 2XWTC 3E6JA 3W3MA 1O6SA 3WN4A 2WQVA 1M0ZA 4KT1A 5AZ5A 2O6RA 2WQWA 5GS0A 3W3GA 4CP6A 3PMHG 2Z64A 1FO1A 3M19A 3ZYIA 5IYXC 1Z7XW 1K5DC 4R58A 3C6NB 3E4GA 3WPBA 4Q3IA 4PERA 3WPCA 2XOTA 1KOOA 1XKUA 4J0MA 1JL5A 2OMYA 3CIGA 4Z79A 2V9SA 4LXRA 5D3IA 3TSRE 4R0AA 4ARRA 4NKGA 4RWTC 2V70A 2Z62A 4QC0A 4CC4A 3G39A 2BEXA 2O6SA 4Z94G 2OMWA 4QBZA 3O53A 1W8AA 5CMPA 1OZNA 4CNMA 3CIYA 4XSQA 4LSXC 2ASTB 4LSCA
chains in the Genus database with same CATH superfamily
2ELLA 1M10B 3GOZA 4V2DA 4GLPA 5AWBA 5AWDA 3RFSA 4ECNA 1O6VA 3CVRA 1KOHA 4V2CA 4R6AA 3JB9j 4OQTA 2R9UA 4TZHA 4U09A 4LSAA 4R5DA 5AWCA 3W3NA 3UL8A 5IJDA 4YEBB 2Z7XB 2Z81A 2BNHA 3ULAA 4FDWA 4WYKA 4BSUA 4PSJA 2IFGA 2P1QB 3G3BA 4U06A 2ID5A 3E2JA 5GMGA 3C6OB 1G9UA 1OTNA 3G06A 3DZEA 1A4YA 2Z66A 1SQ0B 2OMVA 4ECOA 4M7EA 5HDHA 4L3FA 4IM6A 4AY9X 4FS7A 5B0TA 4EZGA 5GQRK 3WPIA 3OJAA 3G3AA 2P1MB 3RJ0A 4Q62A 1ZIWA 1K5GC 3W3KA 3WPFA 1DS9A 3WPGA 2UZXA 3VQ1A 4CC4C 4ARNA 3RW6A 1P8TA 1XEUA 1LTXA 4LI2A 4P8SA 3P72A 1D0BA 3M18A 5IJBA 4XGOA 4U7LA 4Z61C 1WWLA 2OMZA 2Z82A 5FTTB 4GT6A 4BSRA 1M9SA 4KNGA 3UL7A 4PQ8A 3C6PB 4FMZA 1P9AG 4B8CD 1GWBA 1DFJI 1FT8A 2Q4GW 2JE0A 1XWDC 2RR6A 4V2EA 4LI1A 3G04C 4MN8B 4R07A 4RCAB 4R09A 4Z64C 5B4PA 4PKIG 3O6NA 4R6JA 2OMXA 4Y61B 1OOKG 4J4LA 3ZYOA 4R6FA 2WQXA 4PEQB 2JE1A 4RCWA 3UL9A 1PGVA 3OGLB 3W3LA 1XCDA 3OJAB 4NZTM 4C2BB 3OGMB 3W3JA 2ASSB 2RA8A 5LFNA 4K17A 2P1NB 3ZYJA 3UN9A 2CA6A 3ULVA 1IO0A 5IJCA 4M7EC 5GMHA 3WPDA 1H6UA 1H6TA 1OGQA 3RFJA 1YRGA 5B0NA 2A0ZA 4BV4R 2Y5QA 5GMFA 2V9TB 1O6TA 4FCGA 4FD0A 5GS2B 3ZYNA 5HZLB 1DCEA 2WFHA 4MQWX 4I6JB 3REZA 3SB4A 4G8AA 4R6GA 3FXIA 4XOSA 3KJ4A 4QXEA 1XECA 2FT3A 4R08A 1M9LA 3A79B 2OMTA 4FHOA 3RGXA 5AWAA 2Z7XA 4P91A 1OTOA 4L3AA 4WP6A 5CMNA 1QYYA 1FQVA 4UFRA 4C2AB 1A9NA 4BSSA 3ULUA 2O6QA 4U08A 4R5CA 2P1OB 4CNCA 2OMUA 2WQUA 1OTMA 3VQ2A 4LXSA 4HQ1A 3E3ZA 4Q3GA 3WPHA 4CILA 3BZ5A 4Z8GA 4KXFB 4LSXA 3RW7A 3RIZA 1FS2A 1U0ND 3WPEA 1P8VA 3RGZA 2UZYA 4AW4A 2JQDA 4NKHA 2P1PB 5A5CA 4NZRM 2Z63A 3OGKB 2Z65A 3RFEA 4H09A 2XWTC 3E6JA 3W3MA 1O6SA 3WN4A 2WQVA 1M0ZA 4KT1A 5AZ5A 2O6RA 2WQWA 5GS0A 3W3GA 4CP6A 3PMHG 2Z64A 1FO1A 3M19A 3ZYIA 5IYXC 1Z7XW 1K5DC 4R58A 3C6NB 3E4GA 3WPBA 4Q3IA 4PERA 3WPCA 2XOTA 1KOOA 1XKUA 4J0MA 1JL5A 2OMYA 3CIGA 4Z79A 2V9SA 4LXRA 5D3IA 3TSRE 4R0AA 4ARRA 4NKGA 4RWTC 2V70A 2Z62A 4QC0A 4CC4A 3G39A 2BEXA 2O6SA 4Z94G 2OMWA 4QBZA 3O53A 1W8AA 5CMPA 1OZNA 4CNMA 3CIYA 4XSQA 4LSXC 2ASTB 4LSCA
chains in the Genus database with same CATH topology
2ELLA 1M10B 3GOZA 4V2DA 4GLPA 5AWBA 5AWDA 3RFSA 4ECNA 1O6VA 3CVRA 1KOHA 4V2CA 4R6AA 3JB9j 4OQTA 2R9UA 4TZHA 4U09A 4LSAA 4R5DA 5AWCA 3W3NA 3UL8A 5IJDA 4YEBB 2Z7XB 2Z81A 2BNHA 3ULAA 4FDWA 4WYKA 4BSUA 4PSJA 2IFGA 2P1QB 3G3BA 4U06A 2ID5A 3E2JA 5GMGA 3C6OB 1G9UA 1OTNA 3G06A 3DZEA 1A4YA 2Z66A 1SQ0B 2OMVA 4ECOA 4M7EA 5HDHA 4L3FA 4IM6A 4AY9X 4FS7A 5B0TA 4EZGA 5GQRK 3WPIA 3OJAA 3G3AA 2P1MB 3RJ0A 4Q62A 1ZIWA 1K5GC 3W3KA 3WPFA 1DS9A 3WPGA 2UZXA 3VQ1A 4CC4C 4ARNA 3RW6A 1P8TA 1XEUA 1LTXA 4LI2A 4P8SA 3P72A 1D0BA 3M18A 5IJBA 4XGOA 4U7LA 4Z61C 1WWLA 2OMZA 2Z82A 5FTTB 4GT6A 4BSRA 1M9SA 4KNGA 3UL7A 4PQ8A 3C6PB 4FMZA 1P9AG 4B8CD 1GWBA 1DFJI 1FT8A 2Q4GW 2JE0A 1XWDC 2RR6A 4V2EA 4LI1A 3G04C 4MN8B 4R07A 4RCAB 4R09A 4Z64C 5B4PA 4PKIG 3O6NA 4R6JA 2OMXA 4Y61B 1OOKG 4J4LA 3ZYOA 4R6FA 2WQXA 4PEQB 2JE1A 4RCWA 3UL9A 1PGVA 3OGLB 3W3LA 1XCDA 3OJAB 4C2BB 3OGMB 3W3JA 2ASSB 2RA8A 5LFNA 4K17A 2P1NB 3ZYJA 3UN9A 2CA6A 3ULVA 1IO0A 5IJCA 4M7EC 5GMHA 3WPDA 1H6UA 1H6TA 1OGQA 3RFJA 1YRGA 5B0NA 2A0ZA 4BV4R 2Y5QA 5GMFA 2V9TB 1O6TA 4FCGA 4FD0A 5GS2B 3ZYNA 5HZLB 1DCEA 2WFHA 4MQWX 4I6JB 3REZA 3SB4A 4G8AA 4R6GA 3FXIA 4XOSA 3KJ4A 4QXEA 1XECA 2FT3A 4R08A 1M9LA 3A79B 2OMTA 4FHOA 3RGXA 5AWAA 2Z7XA 4P91A 1OTOA 4L3AA 4WP6A 5CMNA 1QYYA 1FQVA 4UFRA 4C2AB 1A9NA 4BSSA 3ULUA 2O6QA 4U08A 4R5CA 2P1OB 4CNCA 2OMUA 2WQUA 1OTMA 3VQ2A 4LXSA 4HQ1A 3E3ZA 4Q3GA 3WPHA 4CILA 3BZ5A 4Z8GA 4KXFB 4LSXA 3RW7A 3RIZA 1FS2A 1U0ND 3WPEA 1P8VA 3RGZA 2UZYA 4AW4A 2JQDA 4NKHA 2P1PB 5A5CA 2Z63A 3OGKB 2Z65A 3RFEA 4H09A 2XWTC 3E6JA 3W3MA 1O6SA 3WN4A 2WQVA 1M0ZA 4KT1A 5AZ5A 2O6RA 2WQWA 5GS0A 3W3GA 4CP6A 3PMHG 2Z64A 1FO1A 3M19A 3ZYIA 5IYXC 1Z7XW 1K5DC 4R58A 3C6NB 3E4GA 3WPBA 4Q3IA 4PERA 3WPCA 2XOTA 1KOOA 1XKUA 4J0MA 1JL5A 2OMYA 3CIGA 4Z79A 2V9SA 4LXRA 5D3IA 3TSRE 4R0AA 4ARRA 4NKGA 4RWTC 2V70A 2Z62A 4QC0A 4CC4A 3G39A 2BEXA 2O6SA 4Z94G 2OMWA 4QBZA 3O53A 1W8AA 5CMPA 1OZNA 4CNMA 3CIYA 4XSQA 4LSXC 2ASTB 4LSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELL A;  1M10 B;  3GOZ A;  4V2D A;  4GLP A;  5AWB A;  5AWD A;  3RFS A;  4ECN A;  1O6V A;  3CVR A;  1KOH A;  4V2C A;  4R6A A;  3JB9 j;  4OQT A;  2R9U A;  4TZH A;  4U09 A;  4LSA A;  4R5D A;  5AWC A;  3W3N A;  3UL8 A;  5IJD A;  4YEB B;  2Z7X B;  2Z81 A;  2BNH A;  3ULA A;  4FDW A;  4WYK A;  4BSU A;  4PSJ A;  2IFG A;  2P1Q B;  3G3B A;  4U06 A;  2ID5 A;  3E2J A;  5GMG A;  3C6O B;  1G9U A;  1OTN A;  3G06 A;  3DZE A;  1A4Y A;  2Z66 A;  1SQ0 B;  2OMV A;  4ECO A;  4M7E A;  5HDH A;  4L3F A;  4IM6 A;  4AY9 X;  4FS7 A;  5B0T A;  4EZG A;  5GQR K;  3WPI A;  3OJA A;  3G3A A;  2P1M B;  3RJ0 A;  4Q62 A;  1ZIW A;  1K5G C;  3W3K A;  3WPF A;  1DS9 A;  3WPG A;  2UZX A;  3VQ1 A;  4CC4 C;  4ARN A;  3RW6 A;  1P8T A;  1XEU A;  1LTX A;  4LI2 A;  4P8S A;  3P72 A;  1D0B A;  3M18 A;  5IJB A;  4XGO A;  4U7L A;  4Z61 C;  1WWL A;  2OMZ A;  2Z82 A;  5FTT B;  4GT6 A;  4BSR A;  1M9S A;  4KNG A;  3UL7 A;  4PQ8 A;  3C6P B;  4FMZ A;  1P9A G;  4B8C D;  1GWB A;  1DFJ I;  1FT8 A;  2Q4G W;  2JE0 A;  1XWD C;  2RR6 A;  4V2E A;  4LI1 A;  3G04 C;  4MN8 B;  4R07 A;  4RCA B;  4R09 A;  4Z64 C;  5B4P A;  4PKI G;  3O6N A;  4R6J A;  2OMX A;  4Y61 B;  1OOK G;  4J4L A;  3ZYO A;  4R6F A;  2WQX A;  4PEQ B;  2JE1 A;  4RCW A;  3UL9 A;  1PGV A;  3OGL B;  3W3L A;  1XCD A;  3OJA B;  4C2B B;  3OGM B;  3W3J A;  2ASS B;  2RA8 A;  5LFN A;  4K17 A;  2P1N B;  3ZYJ A;  3UN9 A;  2CA6 A;  3ULV A;  1IO0 A;  5IJC A;  4M7E C;  5GMH A;  3WPD A;  1H6U A;  1H6T A;  1OGQ A;  3RFJ A;  1YRG A;  5B0N A;  2A0Z A;  4BV4 R;  2Y5Q A;  5GMF A;  2V9T B;  1O6T A;  4FCG A;  4FD0 A;  5GS2 B;  3ZYN A;  5HZL B;  1DCE A;  2WFH A;  4MQW X;  4I6J B;  3REZ A;  3SB4 A;  4G8A A;  4R6G A;  3FXI A;  4XOS A;  3KJ4 A;  4QXE A;  1XEC A;  2FT3 A;  4R08 A;  1M9L A;  3A79 B;  2OMT A;  4FHO A;  3RGX A;  5AWA A;  2Z7X A;  4P91 A;  1OTO A;  4L3A A;  4WP6 A;  5CMN A;  1QYY A;  1FQV A;  4UFR A;  4C2A B;  1A9N A;  4BSS A;  3ULU A;  2O6Q A;  4U08 A;  4R5C A;  2P1O B;  4CNC A;  2OMU A;  2WQU A;  1OTM A;  3VQ2 A;  4LXS A;  4HQ1 A;  3E3Z A;  4Q3G A;  3WPH A;  4CIL A;  3BZ5 A;  4Z8G A;  4KXF B;  4LSX A;  3RW7 A;  3RIZ A;  1FS2 A;  1U0N D;  3WPE A;  1P8V A;  3RGZ A;  2UZY A;  4AW4 A;  2JQD A;  4NKH A;  2P1P B;  5A5C A;  2Z63 A;  3OGK B;  2Z65 A;  3RFE A;  4H09 A;  2XWT C;  3E6J A;  3W3M A;  1O6S A;  3WN4 A;  2WQV A;  1M0Z A;  4KT1 A;  5AZ5 A;  2O6R A;  2WQW A;  5GS0 A;  3W3G A;  4CP6 A;  3PMH G;  2Z64 A;  1FO1 A;  3M19 A;  3ZYI A;  5IYX C;  1Z7X W;  1K5D C;  4R58 A;  3C6N B;  3E4G A;  3WPB A;  4Q3I A;  4PER A;  3WPC A;  2XOT A;  1KOO A;  1XKU A;  4J0M A;  1JL5 A;  2OMY A;  3CIG A;  4Z79 A;  2V9S A;  4LXR A;  5D3I A;  3TSR E;  4R0A A;  4ARR A;  4NKG A;  4RWT C;  2V70 A;  2Z62 A;  4QC0 A;  4CC4 A;  3G39 A;  2BEX A;  2O6S A;  4Z94 G;  2OMW A;  4QBZ A;  3O53 A;  1W8A A;  5CMP A;  1OZN A;  4CNM A;  3CIY A;  4XSQ A;  4LSX C;  2AST B;  4LSC A; 
#chains in the Genus database with same CATH topology
 2ELL A;  1M10 B;  3GOZ A;  4V2D A;  4GLP A;  5AWB A;  5AWD A;  3RFS A;  4ECN A;  1O6V A;  3CVR A;  1KOH A;  4V2C A;  4R6A A;  3JB9 j;  4OQT A;  2R9U A;  4TZH A;  4U09 A;  4LSA A;  4R5D A;  5AWC A;  3W3N A;  3UL8 A;  5IJD A;  4YEB B;  2Z7X B;  2Z81 A;  2BNH A;  3ULA A;  4FDW A;  4WYK A;  4BSU A;  4PSJ A;  2IFG A;  2P1Q B;  3G3B A;  4U06 A;  2ID5 A;  3E2J A;  5GMG A;  3C6O B;  1G9U A;  1OTN A;  3G06 A;  3DZE A;  1A4Y A;  2Z66 A;  1SQ0 B;  2OMV A;  4ECO A;  4M7E A;  5HDH A;  4L3F A;  4IM6 A;  4AY9 X;  4FS7 A;  5B0T A;  4EZG A;  5GQR K;  3WPI A;  3OJA A;  3G3A A;  2P1M B;  3RJ0 A;  4Q62 A;  1ZIW A;  1K5G C;  3W3K A;  3WPF A;  1DS9 A;  3WPG A;  2UZX A;  3VQ1 A;  4CC4 C;  4ARN A;  3RW6 A;  1P8T A;  1XEU A;  1LTX A;  4LI2 A;  4P8S A;  3P72 A;  1D0B A;  3M18 A;  5IJB A;  4XGO A;  4U7L A;  4Z61 C;  1WWL A;  2OMZ A;  2Z82 A;  5FTT B;  4GT6 A;  4BSR A;  1M9S A;  4KNG A;  3UL7 A;  4PQ8 A;  3C6P B;  4FMZ A;  1P9A G;  4B8C D;  1GWB A;  1DFJ I;  1FT8 A;  2Q4G W;  2JE0 A;  1XWD C;  2RR6 A;  4V2E A;  4LI1 A;  3G04 C;  4MN8 B;  4R07 A;  4RCA B;  4R09 A;  4Z64 C;  5B4P A;  4PKI G;  3O6N A;  4R6J A;  2OMX A;  4Y61 B;  1OOK G;  4J4L A;  3ZYO A;  4R6F A;  2WQX A;  4PEQ B;  2JE1 A;  4RCW A;  3UL9 A;  1PGV A;  3OGL B;  3W3L A;  1XCD A;  3OJA B;  4NZT M;  4C2B B;  3OGM B;  3W3J A;  2ASS B;  2RA8 A;  5LFN A;  4K17 A;  2P1N B;  3ZYJ A;  3UN9 A;  2CA6 A;  3ULV A;  1IO0 A;  5IJC A;  4M7E C;  5GMH A;  3WPD A;  1H6U A;  1H6T A;  1OGQ A;  3RFJ A;  1YRG A;  5B0N A;  2A0Z A;  4BV4 R;  2Y5Q A;  5GMF A;  2V9T B;  1O6T A;  4FCG A;  4FD0 A;  5GS2 B;  3ZYN A;  5HZL B;  1DCE A;  2WFH A;  4MQW X;  4I6J B;  3REZ A;  3SB4 A;  4G8A A;  4R6G A;  3FXI A;  4XOS A;  3KJ4 A;  4QXE A;  1XEC A;  2FT3 A;  4R08 A;  1M9L A;  3A79 B;  2OMT A;  4FHO A;  3RGX A;  5AWA A;  2Z7X A;  4P91 A;  1OTO A;  4L3A A;  4WP6 A;  5CMN A;  1QYY A;  1FQV A;  4UFR A;  4C2A B;  1A9N A;  4BSS A;  3ULU A;  2O6Q A;  4U08 A;  4R5C A;  2P1O B;  4CNC A;  2OMU A;  2WQU A;  1OTM A;  3VQ2 A;  4LXS A;  4HQ1 A;  3E3Z A;  4Q3G A;  3WPH A;  4CIL A;  3BZ5 A;  4Z8G A;  4KXF B;  4LSX A;  3RW7 A;  3RIZ A;  1FS2 A;  1U0N D;  3WPE A;  1P8V A;  3RGZ A;  2UZY A;  4AW4 A;  2JQD A;  4NKH A;  2P1P B;  5A5C A;  4NZR M;  2Z63 A;  3OGK B;  2Z65 A;  3RFE A;  4H09 A;  2XWT C;  3E6J A;  3W3M A;  1O6S A;  3WN4 A;  2WQV A;  1M0Z A;  4KT1 A;  5AZ5 A;  2O6R A;  2WQW A;  5GS0 A;  3W3G A;  4CP6 A;  3PMH G;  2Z64 A;  1FO1 A;  3M19 A;  3ZYI A;  5IYX C;  1Z7X W;  1K5D C;  4R58 A;  3C6N B;  3E4G A;  3WPB A;  4Q3I A;  4PER A;  3WPC A;  2XOT A;  1KOO A;  1XKU A;  4J0M A;  1JL5 A;  2OMY A;  3CIG A;  4Z79 A;  2V9S A;  4LXR A;  5D3I A;  3TSR E;  4R0A A;  4ARR A;  4NKG A;  4RWT C;  2V70 A;  2Z62 A;  4QC0 A;  4CC4 A;  3G39 A;  2BEX A;  2O6S A;  4Z94 G;  2OMW A;  4QBZ A;  3O53 A;  1W8A A;  5CMP A;  1OZN A;  4CNM A;  3CIY A;  4XSQ A;  4LSX C;  2AST B;  4LSC A; 
#chains in the Genus database with same CATH homology
 2ELL A;  1M10 B;  3GOZ A;  4V2D A;  4GLP A;  5AWB A;  5AWD A;  3RFS A;  4ECN A;  1O6V A;  3CVR A;  1KOH A;  4V2C A;  4R6A A;  3JB9 j;  4OQT A;  2R9U A;  4TZH A;  4U09 A;  4LSA A;  4R5D A;  5AWC A;  3W3N A;  3UL8 A;  5IJD A;  4YEB B;  2Z7X B;  2Z81 A;  2BNH A;  3ULA A;  4FDW A;  4WYK A;  4BSU A;  4PSJ A;  2IFG A;  2P1Q B;  3G3B A;  4U06 A;  2ID5 A;  3E2J A;  5GMG A;  3C6O B;  1G9U A;  1OTN A;  3G06 A;  3DZE A;  1A4Y A;  2Z66 A;  1SQ0 B;  2OMV A;  4ECO A;  4M7E A;  5HDH A;  4L3F A;  4IM6 A;  4AY9 X;  4FS7 A;  5B0T A;  4EZG A;  5GQR K;  3WPI A;  3OJA A;  3G3A A;  2P1M B;  3RJ0 A;  4Q62 A;  1ZIW A;  1K5G C;  3W3K A;  3WPF A;  1DS9 A;  3WPG A;  2UZX A;  3VQ1 A;  4CC4 C;  4ARN A;  3RW6 A;  1P8T A;  1XEU A;  1LTX A;  4LI2 A;  4P8S A;  3P72 A;  1D0B A;  3M18 A;  5IJB A;  4XGO A;  4U7L A;  4Z61 C;  1WWL A;  2OMZ A;  2Z82 A;  5FTT B;  4GT6 A;  4BSR A;  1M9S A;  4KNG A;  3UL7 A;  4PQ8 A;  3C6P B;  4FMZ A;  1P9A G;  4B8C D;  1GWB A;  1DFJ I;  1FT8 A;  2Q4G W;  2JE0 A;  1XWD C;  2RR6 A;  4V2E A;  4LI1 A;  3G04 C;  4MN8 B;  4R07 A;  4RCA B;  4R09 A;  4Z64 C;  5B4P A;  4PKI G;  3O6N A;  4R6J A;  2OMX A;  4Y61 B;  1OOK G;  4J4L A;  3ZYO A;  4R6F A;  2WQX A;  4PEQ B;  2JE1 A;  4RCW A;  3UL9 A;  1PGV A;  3OGL B;  3W3L A;  1XCD A;  3OJA B;  4C2B B;  3OGM B;  3W3J A;  2ASS B;  2RA8 A;  5LFN A;  4K17 A;  2P1N B;  3ZYJ A;  3UN9 A;  2CA6 A;  3ULV A;  1IO0 A;  5IJC A;  4M7E C;  5GMH A;  3WPD A;  1H6U A;  1H6T A;  1OGQ A;  3RFJ A;  1YRG A;  5B0N A;  2A0Z A;  4BV4 R;  2Y5Q A;  5GMF A;  2V9T B;  1O6T A;  4FCG A;  4FD0 A;  5GS2 B;  3ZYN A;  5HZL B;  1DCE A;  2WFH A;  4MQW X;  4I6J B;  3REZ A;  3SB4 A;  4G8A A;  4R6G A;  3FXI A;  4XOS A;  3KJ4 A;  4QXE A;  1XEC A;  2FT3 A;  4R08 A;  1M9L A;  3A79 B;  2OMT A;  4FHO A;  3RGX A;  5AWA A;  2Z7X A;  4P91 A;  1OTO A;  4L3A A;  4WP6 A;  5CMN A;  1QYY A;  1FQV A;  4UFR A;  4C2A B;  1A9N A;  4BSS A;  3ULU A;  2O6Q A;  4U08 A;  4R5C A;  2P1O B;  4CNC A;  2OMU A;  2WQU A;  1OTM A;  3VQ2 A;  4LXS A;  4HQ1 A;  3E3Z A;  4Q3G A;  3WPH A;  4CIL A;  3BZ5 A;  4Z8G A;  4KXF B;  4LSX A;  3RW7 A;  3RIZ A;  1FS2 A;  1U0N D;  3WPE A;  1P8V A;  3RGZ A;  2UZY A;  4AW4 A;  2JQD A;  4NKH A;  2P1P B;  5A5C A;  2Z63 A;  3OGK B;  2Z65 A;  3RFE A;  4H09 A;  2XWT C;  3E6J A;  3W3M A;  1O6S A;  3WN4 A;  2WQV A;  1M0Z A;  4KT1 A;  5AZ5 A;  2O6R A;  2WQW A;  5GS0 A;  3W3G A;  4CP6 A;  3PMH G;  2Z64 A;  1FO1 A;  3M19 A;  3ZYI A;  5IYX C;  1Z7X W;  1K5D C;  4R58 A;  3C6N B;  3E4G A;  3WPB A;  4Q3I A;  4PER A;  3WPC A;  2XOT A;  1KOO A;  1XKU A;  4J0M A;  1JL5 A;  2OMY A;  3CIG A;  4Z79 A;  2V9S A;  4LXR A;  5D3I A;  3TSR E;  4R0A A;  4ARR A;  4NKG A;  4RWT C;  2V70 A;  2Z62 A;  4QC0 A;  4CC4 A;  3G39 A;  2BEX A;  2O6S A;  4Z94 G;  2OMW A;  4QBZ A;  3O53 A;  1W8A A;  5CMP A;  1OZN A;  4CNM A;  3CIY A;  4XSQ A;  4LSX C;  2AST B;  4LSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...