5A5CA

Structure of an engineered neuronal lrrtm2 adhesion molecule
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
330
Chain Sequence
MACPPKCRCEKLLFYCDSQGFHSVPNGLPSQLLGLSLRHNQLQSLPNGVFDKLTQLTWLHLDHNQLQSLPNGVFDKLTKLTELILSSNQLQSLPNGTFDKLTNLQNLDLSFNQLQSLPNGVFDKLTNLQTLHLRSNQLQSLPNGVFDKLTSLTFLDLSTNQLQSLPNGVFDKLTNLRELHLEHNQLQSLPNGVFDKLTSLTTLFLQWNQLQSLPNGVFDKLTNLEKLDLTGNQLQSLPNGVFDKLTNLKILLLDNNQLQSLPNGVFDKLKSLTTVGLSGNLWECSPRVCALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLCW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LRRTM
publication title Crystal Structure of an Engineered Lrrtm2 Synaptic Adhesion Molecule and a Model for Neurexin Binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
total genus 102
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5a5cA00
1PGVA 3M19A 3OGKB 4CC4A 5HDHA 4U7LA 3G06A 4V2EA 2UZYA 3UL8A 4R0AA 4PKIG 2ASSB 2ELLA 1OOKG 4RCAB 2O6SA 1DS9A 4U09A 4BSSA 2O6RA 5AWCA 4CNMA 4GT6A 1FT8A 5GMHA 5B0NA 4LXSA 4NKGA 1ZIWA 5GMFA 4FHOA 4FD0A 1OZNA 4FCGA 3VQ2A 4KT1A 4LSAA 4CP6A 2R9UA 4Z61C 5GS0A 5HZLB 2Z7XA 1P8VA 2ASTB 2V70A 4IM6A 5IJBA 3RFEA 4YEBB 4BSRA 3WPEA 1A4YA 4ARRA 3WPDA 3A79B 2RA8A 2CA6A 4ECOA 2RR6A 4P91A 4C2AB 3RGXA 4OQTA 1K5GC 2Z82A 4PSJA 5FTTB 4QBZA 4J0MA 4LSCA 2P1QB 1WWLA 2Z66A 3VQ1A 2OMYA 3UL9A 4QXEA 1O6SA 4R5CA 2ID5A 1KOOA 3PMHG 1D0BA 2BNHA 3OJAB 4Z79A 1M9SA 4PERA 2P1NB 3E6JA 4Z8GA 4Q3IA 4PEQB 4XOSA 2WQUA 3BZ5A 2OMZA 1U0ND 1A9NA 2Z63A 3C6PB 3RFJA 3WN4A 3JB9j 4J4LA 3W3JA 4C2BB 1IO0A 4M7EA 1YRGA 1XCDA 3ZYOA 2IFGA 3CIYA 3KJ4A 4BV4R 4R6GA 3WPGA 3TSRE 3ZYNA 4RWTC 3RIZA 4U06A 4R6AA 4LSXA 4CC4C 3RW7A 2Z7XB 4R6JA 2A0ZA 1XECA 2WQXA 3E2JA 4UFRA 5IYXC 2P1MB 1KOHA 3WPIA 3ULVA 5IJCA 3E4GA 1H6UA 4MQWX 1O6TA 4FDWA 4V2DA 4KNGA 2JE1A 2OMXA 3G39A 1P9AG 1M0ZA 3RJ0A 5B0TA 5D3IA 3GOZA 3C6NB 4NKHA 2WFHA 3G3AA 2XWTC 1H6TA 4R09A 1OTMA 1OTOA 1LTXA 4G8AA 3SB4A 1XWDC 5AWAA 1G9UA 4XSQA 3FXIA 5GS2B 4ARNA 4WYKA 4R6FA 2UZXA 4V2CA 4B8CD 3REZA 4KXFB 4R08A 4CILA 3W3MA 4Z64C 4QC0A 4U08A 3RGZA 4RCWA 4I6JB 4MN8B 3G3BA 1OGQA 4AY9X 5CMNA 3P72A 4GLPA 4M7EC 2V9SA 1O6VA 2FT3A 4XGOA 2Z81A 2OMTA 1XKUA 4Y61B 4P8SA 3O6NA 3ULAA 3WPCA 2Z65A 3W3NA 1K5DC 3OGLB 2Z62A 5LFNA 2OMWA 2Z64A 5B4PA 4R58A 3M18A 1FO1A 4BSUA 1FQVA 4LSXC 5AWDA 4L3FA 3W3GA 2WQVA 2V9TB 1OTNA 1QYYA 4R07A 2XOTA 4L3AA 2P1OB 1W8AA 2O6QA 4LXRA 4LI2A 3O53A 4H09A 1JL5A 3ZYJA 5CMPA 4EZGA 2OMVA 4LI1A 2JQDA 3ZYIA 3OGMB 3W3KA 5IJDA 4AW4A 1Z7XW 3W3LA 4ECNA 3CIGA 3RW6A 4FMZA 2WQWA 5A5CA 5AWBA 4CNCA 4Q62A 3DZEA 4Q3GA 3ULUA 4HQ1A 2Q4GW 4FS7A 1GWBA 1XEUA 4WP6A 5GMGA 3WPFA 5AZ5A 4Z94G 3C6OB 1DCEA 2BEXA 1M10B 5GQRK 2P1PB 3WPHA 3CVRA 4TZHA 3WPBA 4PQ8A 3G04C 3E3ZA 1M9LA 3OJAA 1DFJI 1FS2A 3UN9A 4R5DA 2JE0A 3RFSA 4K17A 1P8TA 2Y5QA 2OMUA 1SQ0B 3UL7A
chains in the Genus database with same CATH superfamily
1PGVA 3M19A 3OGKB 4CC4A 5HDHA 4U7LA 3G06A 4V2EA 2UZYA 3UL8A 4R0AA 4PKIG 2ASSB 2ELLA 1OOKG 4RCAB 2O6SA 1DS9A 4U09A 4BSSA 2O6RA 5AWCA 4CNMA 4GT6A 1FT8A 5GMHA 5B0NA 4LXSA 4NKGA 1ZIWA 5GMFA 4FHOA 4FD0A 1OZNA 4FCGA 3VQ2A 4KT1A 4LSAA 4CP6A 2R9UA 4Z61C 5GS0A 5HZLB 2Z7XA 1P8VA 2ASTB 2V70A 4IM6A 5IJBA 3RFEA 4YEBB 4BSRA 3WPEA 1A4YA 4ARRA 3WPDA 3A79B 2RA8A 2CA6A 4ECOA 2RR6A 4P91A 4C2AB 3RGXA 4OQTA 1K5GC 2Z82A 4PSJA 5FTTB 4QBZA 4J0MA 4LSCA 2P1QB 1WWLA 2Z66A 3VQ1A 2OMYA 3UL9A 4QXEA 1O6SA 4R5CA 2ID5A 1KOOA 3PMHG 1D0BA 2BNHA 3OJAB 4Z79A 1M9SA 4PERA 2P1NB 3E6JA 4Z8GA 4Q3IA 4PEQB 4XOSA 2WQUA 3BZ5A 2OMZA 1U0ND 1A9NA 2Z63A 3C6PB 3RFJA 3WN4A 3JB9j 4J4LA 3W3JA 4C2BB 1IO0A 4M7EA 1YRGA 1XCDA 3ZYOA 2IFGA 3CIYA 3KJ4A 4BV4R 4R6GA 3WPGA 3TSRE 3ZYNA 4RWTC 3RIZA 4U06A 4R6AA 4LSXA 4CC4C 3RW7A 2Z7XB 4R6JA 2A0ZA 1XECA 2WQXA 3E2JA 4UFRA 5IYXC 2P1MB 1KOHA 3WPIA 3ULVA 5IJCA 3E4GA 1H6UA 4MQWX 1O6TA 4FDWA 4V2DA 4KNGA 2JE1A 2OMXA 3G39A 1P9AG 1M0ZA 3RJ0A 5B0TA 5D3IA 3GOZA 3C6NB 4NKHA 2WFHA 3G3AA 2XWTC 1H6TA 4R09A 1OTMA 1OTOA 1LTXA 4G8AA 3SB4A 1XWDC 5AWAA 1G9UA 4XSQA 3FXIA 5GS2B 4ARNA 4WYKA 4R6FA 2UZXA 4V2CA 4B8CD 3REZA 4KXFB 4R08A 4CILA 3W3MA 4Z64C 4QC0A 4U08A 3RGZA 4RCWA 4I6JB 4MN8B 3G3BA 1OGQA 4AY9X 5CMNA 3P72A 4GLPA 4M7EC 2V9SA 1O6VA 2FT3A 4XGOA 2Z81A 2OMTA 1XKUA 4Y61B 4P8SA 3O6NA 3ULAA 3WPCA 2Z65A 3W3NA 1K5DC 3OGLB 2Z62A 5LFNA 2OMWA 2Z64A 5B4PA 4R58A 3M18A 1FO1A 4BSUA 1FQVA 4LSXC 5AWDA 4L3FA 3W3GA 2WQVA 2V9TB 1OTNA 1QYYA 4R07A 2XOTA 4L3AA 2P1OB 1W8AA 2O6QA 4LXRA 4LI2A 3O53A 4H09A 1JL5A 3ZYJA 5CMPA 4EZGA 2OMVA 4LI1A 2JQDA 3ZYIA 3OGMB 3W3KA 5IJDA 4AW4A 1Z7XW 3W3LA 4ECNA 4NZRM 3CIGA 3RW6A 4FMZA 2WQWA 5A5CA 5AWBA 4CNCA 4Q62A 3DZEA 4Q3GA 3ULUA 4HQ1A 2Q4GW 4NZTM 4FS7A 1GWBA 1XEUA 4WP6A 5GMGA 3WPFA 5AZ5A 4Z94G 3C6OB 1DCEA 2BEXA 1M10B 5GQRK 2P1PB 3WPHA 3CVRA 4TZHA 3WPBA 4PQ8A 3G04C 3E3ZA 1M9LA 3OJAA 1DFJI 1FS2A 3UN9A 4R5DA 2JE0A 3RFSA 4K17A 1P8TA 2Y5QA 2OMUA 1SQ0B 3UL7A
chains in the Genus database with same CATH topology
1PGVA 3M19A 3OGKB 4CC4A 5HDHA 4U7LA 3G06A 4V2EA 2UZYA 3UL8A 4R0AA 4PKIG 2ASSB 2ELLA 1OOKG 4RCAB 2O6SA 1DS9A 4U09A 4BSSA 2O6RA 5AWCA 4CNMA 4GT6A 1FT8A 5GMHA 5B0NA 4LXSA 4NKGA 1ZIWA 5GMFA 4FHOA 4FD0A 1OZNA 4FCGA 3VQ2A 4KT1A 4LSAA 4CP6A 2R9UA 4Z61C 5GS0A 5HZLB 2Z7XA 1P8VA 2ASTB 2V70A 4IM6A 5IJBA 3RFEA 4YEBB 4BSRA 3WPEA 1A4YA 4ARRA 3WPDA 3A79B 2RA8A 2CA6A 4ECOA 2RR6A 4P91A 4C2AB 3RGXA 4OQTA 1K5GC 2Z82A 4PSJA 5FTTB 4QBZA 4J0MA 4LSCA 2P1QB 1WWLA 2Z66A 3VQ1A 2OMYA 3UL9A 4QXEA 1O6SA 4R5CA 2ID5A 1KOOA 3PMHG 1D0BA 2BNHA 3OJAB 4Z79A 1M9SA 4PERA 2P1NB 3E6JA 4Z8GA 4Q3IA 4PEQB 4XOSA 2WQUA 3BZ5A 2OMZA 1U0ND 1A9NA 2Z63A 3C6PB 3RFJA 3WN4A 3JB9j 4J4LA 3W3JA 4C2BB 1IO0A 4M7EA 1YRGA 1XCDA 3ZYOA 2IFGA 3CIYA 3KJ4A 4BV4R 4R6GA 3WPGA 3TSRE 3ZYNA 4RWTC 3RIZA 4U06A 4R6AA 4LSXA 4CC4C 3RW7A 2Z7XB 4R6JA 2A0ZA 1XECA 2WQXA 3E2JA 4UFRA 5IYXC 2P1MB 1KOHA 3WPIA 3ULVA 5IJCA 3E4GA 1H6UA 4MQWX 1O6TA 4FDWA 4V2DA 4KNGA 2JE1A 2OMXA 3G39A 1P9AG 1M0ZA 3RJ0A 5B0TA 5D3IA 3GOZA 3C6NB 4NKHA 2WFHA 3G3AA 2XWTC 1H6TA 4R09A 1OTMA 1OTOA 1LTXA 4G8AA 3SB4A 1XWDC 5AWAA 1G9UA 4XSQA 3FXIA 5GS2B 4ARNA 4WYKA 4R6FA 2UZXA 4V2CA 4B8CD 3REZA 4KXFB 4R08A 4CILA 3W3MA 4Z64C 4QC0A 4U08A 3RGZA 4RCWA 4I6JB 4MN8B 3G3BA 1OGQA 4AY9X 5CMNA 3P72A 4GLPA 4M7EC 2V9SA 1O6VA 2FT3A 4XGOA 2Z81A 2OMTA 1XKUA 4Y61B 4P8SA 3O6NA 3ULAA 3WPCA 2Z65A 3W3NA 1K5DC 3OGLB 2Z62A 5LFNA 2OMWA 2Z64A 5B4PA 4R58A 3M18A 1FO1A 4BSUA 1FQVA 4LSXC 5AWDA 4L3FA 3W3GA 2WQVA 2V9TB 1OTNA 1QYYA 4R07A 2XOTA 4L3AA 2P1OB 1W8AA 2O6QA 4LXRA 4LI2A 3O53A 4H09A 1JL5A 3ZYJA 5CMPA 4EZGA 2OMVA 4LI1A 2JQDA 3ZYIA 3OGMB 3W3KA 5IJDA 4AW4A 1Z7XW 3W3LA 4ECNA 3CIGA 3RW6A 4FMZA 2WQWA 5A5CA 5AWBA 4CNCA 4Q62A 3DZEA 4Q3GA 3ULUA 4HQ1A 2Q4GW 4FS7A 1GWBA 1XEUA 4WP6A 5GMGA 3WPFA 5AZ5A 4Z94G 3C6OB 1DCEA 2BEXA 1M10B 5GQRK 2P1PB 3WPHA 3CVRA 4TZHA 3WPBA 4PQ8A 3G04C 3E3ZA 1M9LA 3OJAA 1DFJI 1FS2A 3UN9A 4R5DA 2JE0A 3RFSA 4K17A 1P8TA 2Y5QA 2OMUA 1SQ0B 3UL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGV A;  3M19 A;  3OGK B;  4CC4 A;  5HDH A;  4U7L A;  3G06 A;  4V2E A;  2UZY A;  3UL8 A;  4R0A A;  4PKI G;  2ASS B;  2ELL A;  1OOK G;  4RCA B;  2O6S A;  1DS9 A;  4U09 A;  4BSS A;  2O6R A;  5AWC A;  4CNM A;  4GT6 A;  1FT8 A;  5GMH A;  5B0N A;  4LXS A;  4NKG A;  1ZIW A;  5GMF A;  4FHO A;  4FD0 A;  1OZN A;  4FCG A;  3VQ2 A;  4KT1 A;  4LSA A;  4CP6 A;  2R9U A;  4Z61 C;  5GS0 A;  5HZL B;  2Z7X A;  1P8V A;  2AST B;  2V70 A;  4IM6 A;  5IJB A;  3RFE A;  4YEB B;  4BSR A;  3WPE A;  1A4Y A;  4ARR A;  3WPD A;  3A79 B;  2RA8 A;  2CA6 A;  4ECO A;  2RR6 A;  4P91 A;  4C2A B;  3RGX A;  4OQT A;  1K5G C;  2Z82 A;  4PSJ A;  5FTT B;  4QBZ A;  4J0M A;  4LSC A;  2P1Q B;  1WWL A;  2Z66 A;  3VQ1 A;  2OMY A;  3UL9 A;  4QXE A;  1O6S A;  4R5C A;  2ID5 A;  1KOO A;  3PMH G;  1D0B A;  2BNH A;  3OJA B;  4Z79 A;  1M9S A;  4PER A;  2P1N B;  3E6J A;  4Z8G A;  4Q3I A;  4PEQ B;  4XOS A;  2WQU A;  3BZ5 A;  2OMZ A;  1U0N D;  1A9N A;  2Z63 A;  3C6P B;  3RFJ A;  3WN4 A;  3JB9 j;  4J4L A;  3W3J A;  4C2B B;  1IO0 A;  4M7E A;  1YRG A;  1XCD A;  3ZYO A;  2IFG A;  3CIY A;  3KJ4 A;  4BV4 R;  4R6G A;  3WPG A;  3TSR E;  3ZYN A;  4RWT C;  3RIZ A;  4U06 A;  4R6A A;  4LSX A;  4CC4 C;  3RW7 A;  2Z7X B;  4R6J A;  2A0Z A;  1XEC A;  2WQX A;  3E2J A;  4UFR A;  5IYX C;  2P1M B;  1KOH A;  3WPI A;  3ULV A;  5IJC A;  3E4G A;  1H6U A;  4MQW X;  1O6T A;  4FDW A;  4V2D A;  4KNG A;  2JE1 A;  2OMX A;  3G39 A;  1P9A G;  1M0Z A;  3RJ0 A;  5B0T A;  5D3I A;  3GOZ A;  3C6N B;  4NKH A;  2WFH A;  3G3A A;  2XWT C;  1H6T A;  4R09 A;  1OTM A;  1OTO A;  1LTX A;  4G8A A;  3SB4 A;  1XWD C;  5AWA A;  1G9U A;  4XSQ A;  3FXI A;  5GS2 B;  4ARN A;  4WYK A;  4R6F A;  2UZX A;  4V2C A;  4B8C D;  3REZ A;  4KXF B;  4R08 A;  4CIL A;  3W3M A;  4Z64 C;  4QC0 A;  4U08 A;  3RGZ A;  4RCW A;  4I6J B;  4MN8 B;  3G3B A;  1OGQ A;  4AY9 X;  5CMN A;  3P72 A;  4GLP A;  4M7E C;  2V9S A;  1O6V A;  2FT3 A;  4XGO A;  2Z81 A;  2OMT A;  1XKU A;  4Y61 B;  4P8S A;  3O6N A;  3ULA A;  3WPC A;  2Z65 A;  3W3N A;  1K5D C;  3OGL B;  2Z62 A;  5LFN A;  2OMW A;  2Z64 A;  5B4P A;  4R58 A;  3M18 A;  1FO1 A;  4BSU A;  1FQV A;  4LSX C;  5AWD A;  4L3F A;  3W3G A;  2WQV A;  2V9T B;  1OTN A;  1QYY A;  4R07 A;  2XOT A;  4L3A A;  2P1O B;  1W8A A;  2O6Q A;  4LXR A;  4LI2 A;  3O53 A;  4H09 A;  1JL5 A;  3ZYJ A;  5CMP A;  4EZG A;  2OMV A;  4LI1 A;  2JQD A;  3ZYI A;  3OGM B;  3W3K A;  5IJD A;  4AW4 A;  1Z7X W;  3W3L A;  4ECN A;  3CIG A;  3RW6 A;  4FMZ A;  2WQW A;  5A5C A;  5AWB A;  4CNC A;  4Q62 A;  3DZE A;  4Q3G A;  3ULU A;  4HQ1 A;  2Q4G W;  4FS7 A;  1GWB A;  1XEU A;  4WP6 A;  5GMG A;  3WPF A;  5AZ5 A;  4Z94 G;  3C6O B;  1DCE A;  2BEX A;  1M10 B;  5GQR K;  2P1P B;  3WPH A;  3CVR A;  4TZH A;  3WPB A;  4PQ8 A;  3G04 C;  3E3Z A;  1M9L A;  3OJA A;  1DFJ I;  1FS2 A;  3UN9 A;  4R5D A;  2JE0 A;  3RFS A;  4K17 A;  1P8T A;  2Y5Q A;  2OMU A;  1SQ0 B;  3UL7 A; 
#chains in the Genus database with same CATH topology
 1PGV A;  3M19 A;  3OGK B;  4CC4 A;  5HDH A;  4U7L A;  3G06 A;  4V2E A;  2UZY A;  3UL8 A;  4R0A A;  4PKI G;  2ASS B;  2ELL A;  1OOK G;  4RCA B;  2O6S A;  1DS9 A;  4U09 A;  4BSS A;  2O6R A;  5AWC A;  4CNM A;  4GT6 A;  1FT8 A;  5GMH A;  5B0N A;  4LXS A;  4NKG A;  1ZIW A;  5GMF A;  4FHO A;  4FD0 A;  1OZN A;  4FCG A;  3VQ2 A;  4KT1 A;  4LSA A;  4CP6 A;  2R9U A;  4Z61 C;  5GS0 A;  5HZL B;  2Z7X A;  1P8V A;  2AST B;  2V70 A;  4IM6 A;  5IJB A;  3RFE A;  4YEB B;  4BSR A;  3WPE A;  1A4Y A;  4ARR A;  3WPD A;  3A79 B;  2RA8 A;  2CA6 A;  4ECO A;  2RR6 A;  4P91 A;  4C2A B;  3RGX A;  4OQT A;  1K5G C;  2Z82 A;  4PSJ A;  5FTT B;  4QBZ A;  4J0M A;  4LSC A;  2P1Q B;  1WWL A;  2Z66 A;  3VQ1 A;  2OMY A;  3UL9 A;  4QXE A;  1O6S A;  4R5C A;  2ID5 A;  1KOO A;  3PMH G;  1D0B A;  2BNH A;  3OJA B;  4Z79 A;  1M9S A;  4PER A;  2P1N B;  3E6J A;  4Z8G A;  4Q3I A;  4PEQ B;  4XOS A;  2WQU A;  3BZ5 A;  2OMZ A;  1U0N D;  1A9N A;  2Z63 A;  3C6P B;  3RFJ A;  3WN4 A;  3JB9 j;  4J4L A;  3W3J A;  4C2B B;  1IO0 A;  4M7E A;  1YRG A;  1XCD A;  3ZYO A;  2IFG A;  3CIY A;  3KJ4 A;  4BV4 R;  4R6G A;  3WPG A;  3TSR E;  3ZYN A;  4RWT C;  3RIZ A;  4U06 A;  4R6A A;  4LSX A;  4CC4 C;  3RW7 A;  2Z7X B;  4R6J A;  2A0Z A;  1XEC A;  2WQX A;  3E2J A;  4UFR A;  5IYX C;  2P1M B;  1KOH A;  3WPI A;  3ULV A;  5IJC A;  3E4G A;  1H6U A;  4MQW X;  1O6T A;  4FDW A;  4V2D A;  4KNG A;  2JE1 A;  2OMX A;  3G39 A;  1P9A G;  1M0Z A;  3RJ0 A;  5B0T A;  5D3I A;  3GOZ A;  3C6N B;  4NKH A;  2WFH A;  3G3A A;  2XWT C;  1H6T A;  4R09 A;  1OTM A;  1OTO A;  1LTX A;  4G8A A;  3SB4 A;  1XWD C;  5AWA A;  1G9U A;  4XSQ A;  3FXI A;  5GS2 B;  4ARN A;  4WYK A;  4R6F A;  2UZX A;  4V2C A;  4B8C D;  3REZ A;  4KXF B;  4R08 A;  4CIL A;  3W3M A;  4Z64 C;  4QC0 A;  4U08 A;  3RGZ A;  4RCW A;  4I6J B;  4MN8 B;  3G3B A;  1OGQ A;  4AY9 X;  5CMN A;  3P72 A;  4GLP A;  4M7E C;  2V9S A;  1O6V A;  2FT3 A;  4XGO A;  2Z81 A;  2OMT A;  1XKU A;  4Y61 B;  4P8S A;  3O6N A;  3ULA A;  3WPC A;  2Z65 A;  3W3N A;  1K5D C;  3OGL B;  2Z62 A;  5LFN A;  2OMW A;  2Z64 A;  5B4P A;  4R58 A;  3M18 A;  1FO1 A;  4BSU A;  1FQV A;  4LSX C;  5AWD A;  4L3F A;  3W3G A;  2WQV A;  2V9T B;  1OTN A;  1QYY A;  4R07 A;  2XOT A;  4L3A A;  2P1O B;  1W8A A;  2O6Q A;  4LXR A;  4LI2 A;  3O53 A;  4H09 A;  1JL5 A;  3ZYJ A;  5CMP A;  4EZG A;  2OMV A;  4LI1 A;  2JQD A;  3ZYI A;  3OGM B;  3W3K A;  5IJD A;  4AW4 A;  1Z7X W;  3W3L A;  4ECN A;  4NZR M;  3CIG A;  3RW6 A;  4FMZ A;  2WQW A;  5A5C A;  5AWB A;  4CNC A;  4Q62 A;  3DZE A;  4Q3G A;  3ULU A;  4HQ1 A;  2Q4G W;  4NZT M;  4FS7 A;  1GWB A;  1XEU A;  4WP6 A;  5GMG A;  3WPF A;  5AZ5 A;  4Z94 G;  3C6O B;  1DCE A;  2BEX A;  1M10 B;  5GQR K;  2P1P B;  3WPH A;  3CVR A;  4TZH A;  3WPB A;  4PQ8 A;  3G04 C;  3E3Z A;  1M9L A;  3OJA A;  1DFJ I;  1FS2 A;  3UN9 A;  4R5D A;  2JE0 A;  3RFS A;  4K17 A;  1P8T A;  2Y5Q A;  2OMU A;  1SQ0 B;  3UL7 A; 
#chains in the Genus database with same CATH homology
 1PGV A;  3M19 A;  3OGK B;  4CC4 A;  5HDH A;  4U7L A;  3G06 A;  4V2E A;  2UZY A;  3UL8 A;  4R0A A;  4PKI G;  2ASS B;  2ELL A;  1OOK G;  4RCA B;  2O6S A;  1DS9 A;  4U09 A;  4BSS A;  2O6R A;  5AWC A;  4CNM A;  4GT6 A;  1FT8 A;  5GMH A;  5B0N A;  4LXS A;  4NKG A;  1ZIW A;  5GMF A;  4FHO A;  4FD0 A;  1OZN A;  4FCG A;  3VQ2 A;  4KT1 A;  4LSA A;  4CP6 A;  2R9U A;  4Z61 C;  5GS0 A;  5HZL B;  2Z7X A;  1P8V A;  2AST B;  2V70 A;  4IM6 A;  5IJB A;  3RFE A;  4YEB B;  4BSR A;  3WPE A;  1A4Y A;  4ARR A;  3WPD A;  3A79 B;  2RA8 A;  2CA6 A;  4ECO A;  2RR6 A;  4P91 A;  4C2A B;  3RGX A;  4OQT A;  1K5G C;  2Z82 A;  4PSJ A;  5FTT B;  4QBZ A;  4J0M A;  4LSC A;  2P1Q B;  1WWL A;  2Z66 A;  3VQ1 A;  2OMY A;  3UL9 A;  4QXE A;  1O6S A;  4R5C A;  2ID5 A;  1KOO A;  3PMH G;  1D0B A;  2BNH A;  3OJA B;  4Z79 A;  1M9S A;  4PER A;  2P1N B;  3E6J A;  4Z8G A;  4Q3I A;  4PEQ B;  4XOS A;  2WQU A;  3BZ5 A;  2OMZ A;  1U0N D;  1A9N A;  2Z63 A;  3C6P B;  3RFJ A;  3WN4 A;  3JB9 j;  4J4L A;  3W3J A;  4C2B B;  1IO0 A;  4M7E A;  1YRG A;  1XCD A;  3ZYO A;  2IFG A;  3CIY A;  3KJ4 A;  4BV4 R;  4R6G A;  3WPG A;  3TSR E;  3ZYN A;  4RWT C;  3RIZ A;  4U06 A;  4R6A A;  4LSX A;  4CC4 C;  3RW7 A;  2Z7X B;  4R6J A;  2A0Z A;  1XEC A;  2WQX A;  3E2J A;  4UFR A;  5IYX C;  2P1M B;  1KOH A;  3WPI A;  3ULV A;  5IJC A;  3E4G A;  1H6U A;  4MQW X;  1O6T A;  4FDW A;  4V2D A;  4KNG A;  2JE1 A;  2OMX A;  3G39 A;  1P9A G;  1M0Z A;  3RJ0 A;  5B0T A;  5D3I A;  3GOZ A;  3C6N B;  4NKH A;  2WFH A;  3G3A A;  2XWT C;  1H6T A;  4R09 A;  1OTM A;  1OTO A;  1LTX A;  4G8A A;  3SB4 A;  1XWD C;  5AWA A;  1G9U A;  4XSQ A;  3FXI A;  5GS2 B;  4ARN A;  4WYK A;  4R6F A;  2UZX A;  4V2C A;  4B8C D;  3REZ A;  4KXF B;  4R08 A;  4CIL A;  3W3M A;  4Z64 C;  4QC0 A;  4U08 A;  3RGZ A;  4RCW A;  4I6J B;  4MN8 B;  3G3B A;  1OGQ A;  4AY9 X;  5CMN A;  3P72 A;  4GLP A;  4M7E C;  2V9S A;  1O6V A;  2FT3 A;  4XGO A;  2Z81 A;  2OMT A;  1XKU A;  4Y61 B;  4P8S A;  3O6N A;  3ULA A;  3WPC A;  2Z65 A;  3W3N A;  1K5D C;  3OGL B;  2Z62 A;  5LFN A;  2OMW A;  2Z64 A;  5B4P A;  4R58 A;  3M18 A;  1FO1 A;  4BSU A;  1FQV A;  4LSX C;  5AWD A;  4L3F A;  3W3G A;  2WQV A;  2V9T B;  1OTN A;  1QYY A;  4R07 A;  2XOT A;  4L3A A;  2P1O B;  1W8A A;  2O6Q A;  4LXR A;  4LI2 A;  3O53 A;  4H09 A;  1JL5 A;  3ZYJ A;  5CMP A;  4EZG A;  2OMV A;  4LI1 A;  2JQD A;  3ZYI A;  3OGM B;  3W3K A;  5IJD A;  4AW4 A;  1Z7X W;  3W3L A;  4ECN A;  3CIG A;  3RW6 A;  4FMZ A;  2WQW A;  5A5C A;  5AWB A;  4CNC A;  4Q62 A;  3DZE A;  4Q3G A;  3ULU A;  4HQ1 A;  2Q4G W;  4FS7 A;  1GWB A;  1XEU A;  4WP6 A;  5GMG A;  3WPF A;  5AZ5 A;  4Z94 G;  3C6O B;  1DCE A;  2BEX A;  1M10 B;  5GQR K;  2P1P B;  3WPH A;  3CVR A;  4TZH A;  3WPB A;  4PQ8 A;  3G04 C;  3E3Z A;  1M9L A;  3OJA A;  1DFJ I;  1FS2 A;  3UN9 A;  4R5D A;  2JE0 A;  3RFS A;  4K17 A;  1P8T A;  2Y5Q A;  2OMU A;  1SQ0 B;  3UL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...