5A5CA

Structure of an engineered neuronal lrrtm2 adhesion molecule
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
330
Chain Sequence
MACPPKCRCEKLLFYCDSQGFHSVPNGLPSQLLGLSLRHNQLQSLPNGVFDKLTQLTWLHLDHNQLQSLPNGVFDKLTKLTELILSSNQLQSLPNGTFDKLTNLQNLDLSFNQLQSLPNGVFDKLTNLQTLHLRSNQLQSLPNGVFDKLTSLTFLDLSTNQLQSLPNGVFDKLTNLRELHLEHNQLQSLPNGVFDKLTSLTTLFLQWNQLQSLPNGVFDKLTNLEKLDLTGNQLQSLPNGVFDKLTNLKILLLDNNQLQSLPNGVFDKLKSLTTVGLSGNLWECSPRVCALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLCW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LRRTM
publication title Crystal Structure of an Engineered Lrrtm2 Synaptic Adhesion Molecule and a Model for Neurexin Binding.
pubmed doi rcsb
source organism Synthetic construct
total genus 102
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5a5cA00
3UL7A 5IJDA 4CNMA 4CC4A 3OJAB 1A4YA 4Z8GA 4U09A 4U7LA 1IO0A 2BNHA 2Z82A 4GT6A 2WQWA 3ULAA 4LSAA 3FXIA 2O6SA 4AW4A 4B8CD 4LXSA 1FO1A 2WQUA 4FHOA 5GMHA 3SB4A 4MN8B 4M7EC 4R09A 2Z64A 1OZNA 2A0ZA 4Z64C 4KT1A 4LSXC 3E6JA 5IYXC 5AWDA 3OGKB 1SQ0B 2ASSB 1LTXA 3RGXA 5FTTB 3M18A 3WPGA 4PQ8A 1O6SA 3TSRE 4CNCA 1DCEA 3UN9A 4BSSA 2Q4GW 2Z62A 3RJ0A 1XWDC 4Q62A 1H6TA 3ZYNA 4KNGA 4QBZA 2WQXA 4Y61B 3E4GA 4CP6A 2JE1A 1OTOA 2BEXA 1G9UA 4Z61C 2Y5QA 4RWTC 3RW6A 1XECA 3REZA 3M19A 3P72A 3WPBA 1GWBA 4OQTA 2UZYA 3ULVA 5HZLB 3OGLB 1D0BA 1FT8A 5GS0A 5GMGA 2P1OB 3WPFA 1QYYA 3RGZA 2ASTB 4R6JA 4R07A 4FMZA 4ARNA 3CIYA 1XEUA 4C2AB 3WPHA 2OMWA 1KOHA 4Q3IA 1P8TA 4XGOA 2Z66A 4L3AA 3E3ZA 1DFJI 3WN4A 4R6GA 4V2CA 5AZ5A 4BV4R 2V9TB 4LXRA 3WPDA 2JQDA 2R9UA 3G06A 1M10B 4K17A 1Z7XW 4P91A 5IJCA 2P1QB 5D3IA 3VQ2A 2P1NB 4LSXA 5B4PA 2RR6A 1M9SA 1ZIWA 4Z94G 1M0ZA 5AWCA 3UL9A 3OJAA 4PKIG 4QC0A 4MQWX 3BZ5A 4Z79A 3PMHG 1H6UA 1W8AA 2V9SA 5CMPA 2XOTA 2IFGA 2OMXA 5GQRK 4R6AA 4ECNA 2ID5A 5B0TA 2V70A 3W3JA 2Z7XB 4UFRA 1XCDA 4C2BB 5GS2B 4KXFB 1P8VA 4BSRA 1K5DC 3ULUA 4FDWA 3O53A 1U0ND 3VQ1A 3KJ4A 1YRGA 1FS2A 4LI1A 1DS9A 2O6QA 4H09A 3GOZA 1FQVA 3ZYIA 3WPIA 5LFNA 3C6NB 4XOSA 3ZYJA 3W3GA 4J4LA 3DZEA 1A9NA 4V2EA 4J0MA 2Z63A 3W3LA 1JL5A 4V2DA 4WYKA 2RA8A 3JB9j 3RFJA 4BSUA 2OMYA 4R6FA 5HDHA 4R0AA 3W3NA 4M7EA 3CVRA 3RIZA 3ZYOA 1OTMA 4IM6A 2FT3A 4NKGA 3WPEA 2JE0A 5A5CA 1XKUA 4PSJA 3UL8A 4LI2A 4PEQB 5B0NA 4EZGA 4LSCA 4CC4C 5IJBA 1P9AG 4ARRA 2OMVA 4R08A 4Q3GA 4TZHA 2OMTA 3G3AA 1OGQA 4G8AA 4FS7A 2ELLA 5AWBA 1KOOA 4GLPA 3RW7A 1PGVA 3E2JA 3A79B 4WP6A 3G39A 2Z65A 1K5GC 2WFHA 4PERA 4R5DA 4XSQA 1WWLA 4CILA 1M9LA 2UZXA 4I6JB 4HQ1A 4YEBB 4P8SA 2OMUA 4R5CA 2CA6A 2P1MB 4QXEA 2Z81A 5AWAA 3OGMB 2OMZA 1O6VA 4NKHA 3G04C 4AY9X 4L3FA 3G3BA 4RCAB 3WPCA 3RFSA 4U08A 3W3KA 2WQVA 1OTNA 2XWTC 5CMNA 4R58A 4RCWA 4U06A 4ECOA 4FCGA 3O6NA 2O6RA 2Z7XA 3C6PB 3C6OB 4FD0A 3CIGA 2P1PB 1O6TA 5GMFA 3RFEA 1OOKG 3W3MA
chains in the Genus database with same CATH superfamily
3UL7A 5IJDA 4CNMA 4CC4A 3OJAB 1A4YA 4Z8GA 4U09A 4U7LA 1IO0A 2BNHA 2Z82A 4GT6A 2WQWA 3ULAA 4LSAA 3FXIA 2O6SA 4AW4A 4B8CD 4LXSA 1FO1A 2WQUA 4FHOA 5GMHA 3SB4A 4MN8B 4M7EC 4R09A 2Z64A 1OZNA 2A0ZA 4Z64C 4KT1A 4LSXC 3E6JA 5IYXC 5AWDA 3OGKB 1SQ0B 4NZTM 2ASSB 1LTXA 3RGXA 5FTTB 3M18A 3WPGA 4PQ8A 1O6SA 3TSRE 4CNCA 1DCEA 3UN9A 4BSSA 2Q4GW 2Z62A 3RJ0A 1XWDC 4Q62A 1H6TA 3ZYNA 4KNGA 4QBZA 2WQXA 4Y61B 3E4GA 4CP6A 2JE1A 1OTOA 2BEXA 1G9UA 4Z61C 2Y5QA 4RWTC 3RW6A 1XECA 3REZA 3M19A 3P72A 4NZRM 3WPBA 1GWBA 4OQTA 2UZYA 3ULVA 5HZLB 3OGLB 1D0BA 1FT8A 5GS0A 5GMGA 2P1OB 3WPFA 1QYYA 3RGZA 2ASTB 4R6JA 4R07A 4FMZA 4ARNA 3CIYA 1XEUA 4C2AB 3WPHA 2OMWA 1KOHA 4Q3IA 1P8TA 4XGOA 2Z66A 4L3AA 3E3ZA 1DFJI 3WN4A 4R6GA 4V2CA 5AZ5A 4BV4R 2V9TB 4LXRA 3WPDA 2JQDA 2R9UA 3G06A 1M10B 4K17A 1Z7XW 4P91A 5IJCA 2P1QB 5D3IA 3VQ2A 2P1NB 4LSXA 5B4PA 2RR6A 1M9SA 1ZIWA 4Z94G 1M0ZA 5AWCA 3UL9A 3OJAA 4PKIG 4QC0A 4MQWX 3BZ5A 4Z79A 3PMHG 1H6UA 1W8AA 2V9SA 5CMPA 2XOTA 2IFGA 2OMXA 5GQRK 4R6AA 4ECNA 2ID5A 5B0TA 2V70A 3W3JA 2Z7XB 4UFRA 1XCDA 4C2BB 5GS2B 4KXFB 1P8VA 4BSRA 1K5DC 3ULUA 4FDWA 3O53A 1U0ND 3VQ1A 3KJ4A 1YRGA 1FS2A 4LI1A 1DS9A 2O6QA 4H09A 3GOZA 1FQVA 3ZYIA 3WPIA 5LFNA 3C6NB 4XOSA 3ZYJA 3W3GA 4J4LA 3DZEA 1A9NA 4V2EA 4J0MA 2Z63A 3W3LA 1JL5A 4V2DA 4WYKA 2RA8A 3JB9j 3RFJA 4BSUA 2OMYA 4R6FA 5HDHA 4R0AA 3W3NA 4M7EA 3CVRA 3RIZA 3ZYOA 1OTMA 4IM6A 2FT3A 4NKGA 3WPEA 2JE0A 5A5CA 1XKUA 4PSJA 3UL8A 4LI2A 4PEQB 5B0NA 4EZGA 4LSCA 4CC4C 5IJBA 1P9AG 4ARRA 2OMVA 4R08A 4Q3GA 4TZHA 2OMTA 3G3AA 1OGQA 4G8AA 4FS7A 2ELLA 5AWBA 1KOOA 4GLPA 3RW7A 1PGVA 3E2JA 3A79B 4WP6A 3G39A 2Z65A 1K5GC 2WFHA 4PERA 4R5DA 4XSQA 1WWLA 4CILA 1M9LA 2UZXA 4I6JB 4HQ1A 4YEBB 4P8SA 2OMUA 4R5CA 2CA6A 2P1MB 4QXEA 2Z81A 5AWAA 3OGMB 2OMZA 1O6VA 4NKHA 3G04C 4AY9X 4L3FA 3G3BA 4RCAB 3WPCA 3RFSA 4U08A 3W3KA 2WQVA 1OTNA 2XWTC 5CMNA 4R58A 4RCWA 4U06A 4ECOA 4FCGA 3O6NA 2O6RA 2Z7XA 3C6PB 3C6OB 4FD0A 3CIGA 2P1PB 1O6TA 5GMFA 3RFEA 1OOKG 3W3MA
chains in the Genus database with same CATH topology
3UL7A 5IJDA 4CNMA 4CC4A 3OJAB 1A4YA 4Z8GA 4U09A 4U7LA 1IO0A 2BNHA 2Z82A 4GT6A 2WQWA 3ULAA 4LSAA 3FXIA 2O6SA 4AW4A 4B8CD 4LXSA 1FO1A 2WQUA 4FHOA 5GMHA 3SB4A 4MN8B 4M7EC 4R09A 2Z64A 1OZNA 2A0ZA 4Z64C 4KT1A 4LSXC 3E6JA 5IYXC 5AWDA 3OGKB 1SQ0B 2ASSB 1LTXA 3RGXA 5FTTB 3M18A 3WPGA 4PQ8A 1O6SA 3TSRE 4CNCA 1DCEA 3UN9A 4BSSA 2Q4GW 2Z62A 3RJ0A 1XWDC 4Q62A 1H6TA 3ZYNA 4KNGA 4QBZA 2WQXA 4Y61B 3E4GA 4CP6A 2JE1A 1OTOA 2BEXA 1G9UA 4Z61C 2Y5QA 4RWTC 3RW6A 1XECA 3REZA 3M19A 3P72A 3WPBA 1GWBA 4OQTA 2UZYA 3ULVA 5HZLB 3OGLB 1D0BA 1FT8A 5GS0A 5GMGA 2P1OB 3WPFA 1QYYA 3RGZA 2ASTB 4R6JA 4R07A 4FMZA 4ARNA 3CIYA 1XEUA 4C2AB 3WPHA 2OMWA 1KOHA 4Q3IA 1P8TA 4XGOA 2Z66A 4L3AA 3E3ZA 1DFJI 3WN4A 4R6GA 4V2CA 5AZ5A 4BV4R 2V9TB 4LXRA 3WPDA 2JQDA 2R9UA 3G06A 1M10B 4K17A 1Z7XW 4P91A 5IJCA 2P1QB 5D3IA 3VQ2A 2P1NB 4LSXA 5B4PA 2RR6A 1M9SA 1ZIWA 4Z94G 1M0ZA 5AWCA 3UL9A 3OJAA 4PKIG 4QC0A 4MQWX 3BZ5A 4Z79A 3PMHG 1H6UA 1W8AA 2V9SA 5CMPA 2XOTA 2IFGA 2OMXA 5GQRK 4R6AA 4ECNA 2ID5A 5B0TA 2V70A 3W3JA 2Z7XB 4UFRA 1XCDA 4C2BB 5GS2B 4KXFB 1P8VA 4BSRA 1K5DC 3ULUA 4FDWA 3O53A 1U0ND 3VQ1A 3KJ4A 1YRGA 1FS2A 4LI1A 1DS9A 2O6QA 4H09A 3GOZA 1FQVA 3ZYIA 3WPIA 5LFNA 3C6NB 4XOSA 3ZYJA 3W3GA 4J4LA 3DZEA 1A9NA 4V2EA 4J0MA 2Z63A 3W3LA 1JL5A 4V2DA 4WYKA 2RA8A 3JB9j 3RFJA 4BSUA 2OMYA 4R6FA 5HDHA 4R0AA 3W3NA 4M7EA 3CVRA 3RIZA 3ZYOA 1OTMA 4IM6A 2FT3A 4NKGA 3WPEA 2JE0A 5A5CA 1XKUA 4PSJA 3UL8A 4LI2A 4PEQB 5B0NA 4EZGA 4LSCA 4CC4C 5IJBA 1P9AG 4ARRA 2OMVA 4R08A 4Q3GA 4TZHA 2OMTA 3G3AA 1OGQA 4G8AA 4FS7A 2ELLA 5AWBA 1KOOA 4GLPA 3RW7A 1PGVA 3E2JA 3A79B 4WP6A 3G39A 2Z65A 1K5GC 2WFHA 4PERA 4R5DA 4XSQA 1WWLA 4CILA 1M9LA 2UZXA 4I6JB 4HQ1A 4YEBB 4P8SA 2OMUA 4R5CA 2CA6A 2P1MB 4QXEA 2Z81A 5AWAA 3OGMB 2OMZA 1O6VA 4NKHA 3G04C 4AY9X 4L3FA 3G3BA 4RCAB 3WPCA 3RFSA 4U08A 3W3KA 2WQVA 1OTNA 2XWTC 5CMNA 4R58A 4RCWA 4U06A 4ECOA 4FCGA 3O6NA 2O6RA 2Z7XA 3C6PB 3C6OB 4FD0A 3CIGA 2P1PB 1O6TA 5GMFA 3RFEA 1OOKG 3W3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL7 A;  5IJD A;  4CNM A;  4CC4 A;  3OJA B;  1A4Y A;  4Z8G A;  4U09 A;  4U7L A;  1IO0 A;  2BNH A;  2Z82 A;  4GT6 A;  2WQW A;  3ULA A;  4LSA A;  3FXI A;  2O6S A;  4AW4 A;  4B8C D;  4LXS A;  1FO1 A;  2WQU A;  4FHO A;  5GMH A;  3SB4 A;  4MN8 B;  4M7E C;  4R09 A;  2Z64 A;  1OZN A;  2A0Z A;  4Z64 C;  4KT1 A;  4LSX C;  3E6J A;  5IYX C;  5AWD A;  3OGK B;  1SQ0 B;  2ASS B;  1LTX A;  3RGX A;  5FTT B;  3M18 A;  3WPG A;  4PQ8 A;  1O6S A;  3TSR E;  4CNC A;  1DCE A;  3UN9 A;  4BSS A;  2Q4G W;  2Z62 A;  3RJ0 A;  1XWD C;  4Q62 A;  1H6T A;  3ZYN A;  4KNG A;  4QBZ A;  2WQX A;  4Y61 B;  3E4G A;  4CP6 A;  2JE1 A;  1OTO A;  2BEX A;  1G9U A;  4Z61 C;  2Y5Q A;  4RWT C;  3RW6 A;  1XEC A;  3REZ A;  3M19 A;  3P72 A;  3WPB A;  1GWB A;  4OQT A;  2UZY A;  3ULV A;  5HZL B;  3OGL B;  1D0B A;  1FT8 A;  5GS0 A;  5GMG A;  2P1O B;  3WPF A;  1QYY A;  3RGZ A;  2AST B;  4R6J A;  4R07 A;  4FMZ A;  4ARN A;  3CIY A;  1XEU A;  4C2A B;  3WPH A;  2OMW A;  1KOH A;  4Q3I A;  1P8T A;  4XGO A;  2Z66 A;  4L3A A;  3E3Z A;  1DFJ I;  3WN4 A;  4R6G A;  4V2C A;  5AZ5 A;  4BV4 R;  2V9T B;  4LXR A;  3WPD A;  2JQD A;  2R9U A;  3G06 A;  1M10 B;  4K17 A;  1Z7X W;  4P91 A;  5IJC A;  2P1Q B;  5D3I A;  3VQ2 A;  2P1N B;  4LSX A;  5B4P A;  2RR6 A;  1M9S A;  1ZIW A;  4Z94 G;  1M0Z A;  5AWC A;  3UL9 A;  3OJA A;  4PKI G;  4QC0 A;  4MQW X;  3BZ5 A;  4Z79 A;  3PMH G;  1H6U A;  1W8A A;  2V9S A;  5CMP A;  2XOT A;  2IFG A;  2OMX A;  5GQR K;  4R6A A;  4ECN A;  2ID5 A;  5B0T A;  2V70 A;  3W3J A;  2Z7X B;  4UFR A;  1XCD A;  4C2B B;  5GS2 B;  4KXF B;  1P8V A;  4BSR A;  1K5D C;  3ULU A;  4FDW A;  3O53 A;  1U0N D;  3VQ1 A;  3KJ4 A;  1YRG A;  1FS2 A;  4LI1 A;  1DS9 A;  2O6Q A;  4H09 A;  3GOZ A;  1FQV A;  3ZYI A;  3WPI A;  5LFN A;  3C6N B;  4XOS A;  3ZYJ A;  3W3G A;  4J4L A;  3DZE A;  1A9N A;  4V2E A;  4J0M A;  2Z63 A;  3W3L A;  1JL5 A;  4V2D A;  4WYK A;  2RA8 A;  3JB9 j;  3RFJ A;  4BSU A;  2OMY A;  4R6F A;  5HDH A;  4R0A A;  3W3N A;  4M7E A;  3CVR A;  3RIZ A;  3ZYO A;  1OTM A;  4IM6 A;  2FT3 A;  4NKG A;  3WPE A;  2JE0 A;  5A5C A;  1XKU A;  4PSJ A;  3UL8 A;  4LI2 A;  4PEQ B;  5B0N A;  4EZG A;  4LSC A;  4CC4 C;  5IJB A;  1P9A G;  4ARR A;  2OMV A;  4R08 A;  4Q3G A;  4TZH A;  2OMT A;  3G3A A;  1OGQ A;  4G8A A;  4FS7 A;  2ELL A;  5AWB A;  1KOO A;  4GLP A;  3RW7 A;  1PGV A;  3E2J A;  3A79 B;  4WP6 A;  3G39 A;  2Z65 A;  1K5G C;  2WFH A;  4PER A;  4R5D A;  4XSQ A;  1WWL A;  4CIL A;  1M9L A;  2UZX A;  4I6J B;  4HQ1 A;  4YEB B;  4P8S A;  2OMU A;  4R5C A;  2CA6 A;  2P1M B;  4QXE A;  2Z81 A;  5AWA A;  3OGM B;  2OMZ A;  1O6V A;  4NKH A;  3G04 C;  4AY9 X;  4L3F A;  3G3B A;  4RCA B;  3WPC A;  3RFS A;  4U08 A;  3W3K A;  2WQV A;  1OTN A;  2XWT C;  5CMN A;  4R58 A;  4RCW A;  4U06 A;  4ECO A;  4FCG A;  3O6N A;  2O6R A;  2Z7X A;  3C6P B;  3C6O B;  4FD0 A;  3CIG A;  2P1P B;  1O6T A;  5GMF A;  3RFE A;  1OOK G;  3W3M A; 
#chains in the Genus database with same CATH topology
 3UL7 A;  5IJD A;  4CNM A;  4CC4 A;  3OJA B;  1A4Y A;  4Z8G A;  4U09 A;  4U7L A;  1IO0 A;  2BNH A;  2Z82 A;  4GT6 A;  2WQW A;  3ULA A;  4LSA A;  3FXI A;  2O6S A;  4AW4 A;  4B8C D;  4LXS A;  1FO1 A;  2WQU A;  4FHO A;  5GMH A;  3SB4 A;  4MN8 B;  4M7E C;  4R09 A;  2Z64 A;  1OZN A;  2A0Z A;  4Z64 C;  4KT1 A;  4LSX C;  3E6J A;  5IYX C;  5AWD A;  3OGK B;  1SQ0 B;  4NZT M;  2ASS B;  1LTX A;  3RGX A;  5FTT B;  3M18 A;  3WPG A;  4PQ8 A;  1O6S A;  3TSR E;  4CNC A;  1DCE A;  3UN9 A;  4BSS A;  2Q4G W;  2Z62 A;  3RJ0 A;  1XWD C;  4Q62 A;  1H6T A;  3ZYN A;  4KNG A;  4QBZ A;  2WQX A;  4Y61 B;  3E4G A;  4CP6 A;  2JE1 A;  1OTO A;  2BEX A;  1G9U A;  4Z61 C;  2Y5Q A;  4RWT C;  3RW6 A;  1XEC A;  3REZ A;  3M19 A;  3P72 A;  4NZR M;  3WPB A;  1GWB A;  4OQT A;  2UZY A;  3ULV A;  5HZL B;  3OGL B;  1D0B A;  1FT8 A;  5GS0 A;  5GMG A;  2P1O B;  3WPF A;  1QYY A;  3RGZ A;  2AST B;  4R6J A;  4R07 A;  4FMZ A;  4ARN A;  3CIY A;  1XEU A;  4C2A B;  3WPH A;  2OMW A;  1KOH A;  4Q3I A;  1P8T A;  4XGO A;  2Z66 A;  4L3A A;  3E3Z A;  1DFJ I;  3WN4 A;  4R6G A;  4V2C A;  5AZ5 A;  4BV4 R;  2V9T B;  4LXR A;  3WPD A;  2JQD A;  2R9U A;  3G06 A;  1M10 B;  4K17 A;  1Z7X W;  4P91 A;  5IJC A;  2P1Q B;  5D3I A;  3VQ2 A;  2P1N B;  4LSX A;  5B4P A;  2RR6 A;  1M9S A;  1ZIW A;  4Z94 G;  1M0Z A;  5AWC A;  3UL9 A;  3OJA A;  4PKI G;  4QC0 A;  4MQW X;  3BZ5 A;  4Z79 A;  3PMH G;  1H6U A;  1W8A A;  2V9S A;  5CMP A;  2XOT A;  2IFG A;  2OMX A;  5GQR K;  4R6A A;  4ECN A;  2ID5 A;  5B0T A;  2V70 A;  3W3J A;  2Z7X B;  4UFR A;  1XCD A;  4C2B B;  5GS2 B;  4KXF B;  1P8V A;  4BSR A;  1K5D C;  3ULU A;  4FDW A;  3O53 A;  1U0N D;  3VQ1 A;  3KJ4 A;  1YRG A;  1FS2 A;  4LI1 A;  1DS9 A;  2O6Q A;  4H09 A;  3GOZ A;  1FQV A;  3ZYI A;  3WPI A;  5LFN A;  3C6N B;  4XOS A;  3ZYJ A;  3W3G A;  4J4L A;  3DZE A;  1A9N A;  4V2E A;  4J0M A;  2Z63 A;  3W3L A;  1JL5 A;  4V2D A;  4WYK A;  2RA8 A;  3JB9 j;  3RFJ A;  4BSU A;  2OMY A;  4R6F A;  5HDH A;  4R0A A;  3W3N A;  4M7E A;  3CVR A;  3RIZ A;  3ZYO A;  1OTM A;  4IM6 A;  2FT3 A;  4NKG A;  3WPE A;  2JE0 A;  5A5C A;  1XKU A;  4PSJ A;  3UL8 A;  4LI2 A;  4PEQ B;  5B0N A;  4EZG A;  4LSC A;  4CC4 C;  5IJB A;  1P9A G;  4ARR A;  2OMV A;  4R08 A;  4Q3G A;  4TZH A;  2OMT A;  3G3A A;  1OGQ A;  4G8A A;  4FS7 A;  2ELL A;  5AWB A;  1KOO A;  4GLP A;  3RW7 A;  1PGV A;  3E2J A;  3A79 B;  4WP6 A;  3G39 A;  2Z65 A;  1K5G C;  2WFH A;  4PER A;  4R5D A;  4XSQ A;  1WWL A;  4CIL A;  1M9L A;  2UZX A;  4I6J B;  4HQ1 A;  4YEB B;  4P8S A;  2OMU A;  4R5C A;  2CA6 A;  2P1M B;  4QXE A;  2Z81 A;  5AWA A;  3OGM B;  2OMZ A;  1O6V A;  4NKH A;  3G04 C;  4AY9 X;  4L3F A;  3G3B A;  4RCA B;  3WPC A;  3RFS A;  4U08 A;  3W3K A;  2WQV A;  1OTN A;  2XWT C;  5CMN A;  4R58 A;  4RCW A;  4U06 A;  4ECO A;  4FCG A;  3O6N A;  2O6R A;  2Z7X A;  3C6P B;  3C6O B;  4FD0 A;  3CIG A;  2P1P B;  1O6T A;  5GMF A;  3RFE A;  1OOK G;  3W3M A; 
#chains in the Genus database with same CATH homology
 3UL7 A;  5IJD A;  4CNM A;  4CC4 A;  3OJA B;  1A4Y A;  4Z8G A;  4U09 A;  4U7L A;  1IO0 A;  2BNH A;  2Z82 A;  4GT6 A;  2WQW A;  3ULA A;  4LSA A;  3FXI A;  2O6S A;  4AW4 A;  4B8C D;  4LXS A;  1FO1 A;  2WQU A;  4FHO A;  5GMH A;  3SB4 A;  4MN8 B;  4M7E C;  4R09 A;  2Z64 A;  1OZN A;  2A0Z A;  4Z64 C;  4KT1 A;  4LSX C;  3E6J A;  5IYX C;  5AWD A;  3OGK B;  1SQ0 B;  2ASS B;  1LTX A;  3RGX A;  5FTT B;  3M18 A;  3WPG A;  4PQ8 A;  1O6S A;  3TSR E;  4CNC A;  1DCE A;  3UN9 A;  4BSS A;  2Q4G W;  2Z62 A;  3RJ0 A;  1XWD C;  4Q62 A;  1H6T A;  3ZYN A;  4KNG A;  4QBZ A;  2WQX A;  4Y61 B;  3E4G A;  4CP6 A;  2JE1 A;  1OTO A;  2BEX A;  1G9U A;  4Z61 C;  2Y5Q A;  4RWT C;  3RW6 A;  1XEC A;  3REZ A;  3M19 A;  3P72 A;  3WPB A;  1GWB A;  4OQT A;  2UZY A;  3ULV A;  5HZL B;  3OGL B;  1D0B A;  1FT8 A;  5GS0 A;  5GMG A;  2P1O B;  3WPF A;  1QYY A;  3RGZ A;  2AST B;  4R6J A;  4R07 A;  4FMZ A;  4ARN A;  3CIY A;  1XEU A;  4C2A B;  3WPH A;  2OMW A;  1KOH A;  4Q3I A;  1P8T A;  4XGO A;  2Z66 A;  4L3A A;  3E3Z A;  1DFJ I;  3WN4 A;  4R6G A;  4V2C A;  5AZ5 A;  4BV4 R;  2V9T B;  4LXR A;  3WPD A;  2JQD A;  2R9U A;  3G06 A;  1M10 B;  4K17 A;  1Z7X W;  4P91 A;  5IJC A;  2P1Q B;  5D3I A;  3VQ2 A;  2P1N B;  4LSX A;  5B4P A;  2RR6 A;  1M9S A;  1ZIW A;  4Z94 G;  1M0Z A;  5AWC A;  3UL9 A;  3OJA A;  4PKI G;  4QC0 A;  4MQW X;  3BZ5 A;  4Z79 A;  3PMH G;  1H6U A;  1W8A A;  2V9S A;  5CMP A;  2XOT A;  2IFG A;  2OMX A;  5GQR K;  4R6A A;  4ECN A;  2ID5 A;  5B0T A;  2V70 A;  3W3J A;  2Z7X B;  4UFR A;  1XCD A;  4C2B B;  5GS2 B;  4KXF B;  1P8V A;  4BSR A;  1K5D C;  3ULU A;  4FDW A;  3O53 A;  1U0N D;  3VQ1 A;  3KJ4 A;  1YRG A;  1FS2 A;  4LI1 A;  1DS9 A;  2O6Q A;  4H09 A;  3GOZ A;  1FQV A;  3ZYI A;  3WPI A;  5LFN A;  3C6N B;  4XOS A;  3ZYJ A;  3W3G A;  4J4L A;  3DZE A;  1A9N A;  4V2E A;  4J0M A;  2Z63 A;  3W3L A;  1JL5 A;  4V2D A;  4WYK A;  2RA8 A;  3JB9 j;  3RFJ A;  4BSU A;  2OMY A;  4R6F A;  5HDH A;  4R0A A;  3W3N A;  4M7E A;  3CVR A;  3RIZ A;  3ZYO A;  1OTM A;  4IM6 A;  2FT3 A;  4NKG A;  3WPE A;  2JE0 A;  5A5C A;  1XKU A;  4PSJ A;  3UL8 A;  4LI2 A;  4PEQ B;  5B0N A;  4EZG A;  4LSC A;  4CC4 C;  5IJB A;  1P9A G;  4ARR A;  2OMV A;  4R08 A;  4Q3G A;  4TZH A;  2OMT A;  3G3A A;  1OGQ A;  4G8A A;  4FS7 A;  2ELL A;  5AWB A;  1KOO A;  4GLP A;  3RW7 A;  1PGV A;  3E2J A;  3A79 B;  4WP6 A;  3G39 A;  2Z65 A;  1K5G C;  2WFH A;  4PER A;  4R5D A;  4XSQ A;  1WWL A;  4CIL A;  1M9L A;  2UZX A;  4I6J B;  4HQ1 A;  4YEB B;  4P8S A;  2OMU A;  4R5C A;  2CA6 A;  2P1M B;  4QXE A;  2Z81 A;  5AWA A;  3OGM B;  2OMZ A;  1O6V A;  4NKH A;  3G04 C;  4AY9 X;  4L3F A;  3G3B A;  4RCA B;  3WPC A;  3RFS A;  4U08 A;  3W3K A;  2WQV A;  1OTN A;  2XWT C;  5CMN A;  4R58 A;  4RCW A;  4U06 A;  4ECO A;  4FCG A;  3O6N A;  2O6R A;  2Z7X A;  3C6P B;  3C6O B;  4FD0 A;  3CIG A;  2P1P B;  1O6T A;  5GMF A;  3RFE A;  1OOK G;  3W3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...