5A5CA

Structure of an engineered neuronal lrrtm2 adhesion molecule
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
330
Chain Sequence
b'MACPPKCRCEKLLFYCDSQGFHSVPNGLPSQLLGLSLRHNQLQSLPNGVFDKLTQLTWLHLDHNQLQSLPNGVFDKLTKLTELILSSNQLQSLPNGTFDKLTNLQNLDLSFNQLQSLPNGVFDKLTNLQTLHLRSNQLQSLPNGVFDKLTSLTFLDLSTNQLQSLPNGVFDKLTNLRELHLEHNQLQSLPNGVFDKLTSLTTLFLQWNQLQSLPNGVFDKLTNLEKLDLTGNQLQSLPNGVFDKLTNLKILLLDNNQLQSLPNGVFDKLKSLTTVGLSGNLWECSPRVCALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLCW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LRRTM
publication title Crystal Structure of an Engineered Lrrtm2 Synaptic Adhesion Molecule and a Model for Neurexin Binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
total genus 102
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5a5cA00
4R58A 4RCAB 4QBZA 2OMWA 5AWAA 4R6FA 4LSCA 4LI1A 4U06A 4FS7A 4R6GA 5D3IA 1P8VA 3UL9A 4FD0A 4BSSA 4Z79A 4YEBB 3G04C 1JL5A 4Q3IA 4FDWA 3CIGA 2Z64A 5HDHA 3CVRA 4KXFB 2JQDA 3RGXA 2R9UA 4BSUA 1D0BA 5IJBA 3VQ2A 2BEXA 4CNCA 5GMGA 1DS9A 3JB9j 3E6JA 4FCGA 1P9AG 1M10B 3W3NA 4ARNA 3RW6A 1OGQA 2V9SA 3GOZA 5A5CA 4B8CD 4R5DA 4P8SA 4R6JA 3REZA 4LSXA 5HZLB 1LTXA 1OTOA 5AZ5A 1G9UA 4C2AB 4Z94G 2JE0A 4ECNA 5IJCA 5GQRK 1XKUA 3O6NA 5AWCA 4TZHA 4Z61C 4XOSA 4MN8B 3W3GA 4HQ1A 4GT6A 4ARRA 2FT3A 4CC4C 1ZIWA 3OGLB 4U08A 2ID5A 3W3MA 3UL7A 1A9NA 4PKIG 2RR6A 2P1OB 4P91A 4V2CA 2WQUA 2ELLA 1PGVA 4G8AA 3M19A 4PEQB 3RFJA 2Z62A 2XWTC 3WPCA 1W8AA 2A0ZA 3WPEA 1SQ0B 1H6TA 3OJAA 2XOTA 4AW4A 4M7EA 1OZNA 2CA6A 2Z81A 2RA8A 1K5GC 2IFGA 2UZXA 3ZYNA 1DFJI 4KT1A 1O6TA 3W3KA 3WPFA 3WPGA 1XECA 3WPIA 4R08A 3C6PB 4Y61B 2Z7XB 2P1QB 3E3ZA 3P72A 4WP6A 3ULVA 4LSAA 4R5CA 5B0NA 1M0ZA 3ZYOA 2O6RA 1IO0A 4H09A 4L3FA 4PERA 4LSXC 4L3AA 4R07A 1FQVA 5B0TA 3FXIA 4Q62A 2WFHA 1M9SA 3WPDA 4MQWX 4J4LA 1QYYA 1O6VA 1XCDA 4CNMA 4R0AA 1XWDC 5GMFA 5GS2B 2JE1A 4IM6A 2P1NB 4K17A 3W3LA 1KOOA 3BZ5A 3RGZA 4AY9X 1DCEA 2ASTB 4RWTC 1FT8A 3VQ1A 3OGMB 3E4GA 4Z64C 3RW7A 5AWDA 3RJ0A 5IYXC 2Z82A 4OQTA 3PMHG 2O6SA 3C6NB 2OMVA 4QC0A 4XSQA 3SB4A 4R09A 3E2JA 4QXEA 3OJAB 4GLPA 4CP6A 1OTNA 4M7EC 4J0MA 5CMPA 2V70A 3KJ4A 2P1MB 1FS2A 2P1PB 4LXSA 3WPBA 1Z7XW 2V9TB 3G3BA 4U09A 1WWLA 1K5DC 3W3JA 4WYKA 1XEUA 3OGKB 4C2BB 4BSRA 4Q3GA 4ECOA 2WQVA 4V2DA 1YRGA 4LI2A 4XGOA 3A79B 2Y5QA 3G3AA 1OTMA 2BNHA 3RFEA 1KOHA 4FMZA 4RCWA 3DZEA 5LFNA 4Z8GA 4EZGA 3ZYIA 4FHOA 1GWBA 1U0ND 3ULAA 1FO1A 2OMXA 4PQ8A 1A4YA 3WPHA 5CMNA 2WQWA 3RIZA 4KNGA 5AWBA 2WQXA 2UZYA 3G06A 4R6AA 1O6SA 2Z7XA 2OMZA 2O6QA 2Q4GW 2Z65A 4PSJA 2Z63A 5FTTB 3O53A 4UFRA 1M9LA 4I6JB 4LXRA 3TSRE 3ULUA 3UL8A 4NKGA 3G39A 3WN4A 1OOKG 1P8TA 4CILA 2Z66A 1H6UA 3C6OB 4U7LA 3ZYJA 2OMYA 4NKHA 4BV4R 4V2EA 2ASSB 5B4PA 5GMHA 2OMUA 3CIYA 3M18A 5IJDA 4CC4A 3UN9A 3RFSA 5GS0A 2OMTA
chains in the Genus database with same CATH superfamily
4R58A 4RCAB 4QBZA 2OMWA 5AWAA 4R6FA 4LSCA 4LI1A 4U06A 4FS7A 4R6GA 5D3IA 1P8VA 3UL9A 4FD0A 4BSSA 4Z79A 4YEBB 3G04C 1JL5A 4Q3IA 4FDWA 3CIGA 2Z64A 5HDHA 3CVRA 4KXFB 2JQDA 3RGXA 2R9UA 4BSUA 1D0BA 5IJBA 3VQ2A 2BEXA 4CNCA 5GMGA 1DS9A 3JB9j 3E6JA 4FCGA 1P9AG 1M10B 3W3NA 4ARNA 3RW6A 1OGQA 2V9SA 3GOZA 5A5CA 4B8CD 4R5DA 4P8SA 4R6JA 3REZA 4LSXA 5HZLB 1LTXA 1OTOA 5AZ5A 1G9UA 4C2AB 4Z94G 2JE0A 4ECNA 5IJCA 5GQRK 1XKUA 3O6NA 5AWCA 4TZHA 4Z61C 4XOSA 4MN8B 3W3GA 4HQ1A 4GT6A 4ARRA 2FT3A 4CC4C 1ZIWA 3OGLB 4U08A 2ID5A 3W3MA 3UL7A 1A9NA 4PKIG 2RR6A 2P1OB 4P91A 4V2CA 2WQUA 2ELLA 1PGVA 4G8AA 3M19A 4PEQB 3RFJA 2Z62A 2XWTC 3WPCA 1W8AA 2A0ZA 3WPEA 1SQ0B 4NZTM 1H6TA 3OJAA 2XOTA 4AW4A 4M7EA 1OZNA 2CA6A 2Z81A 2RA8A 1K5GC 2IFGA 2UZXA 3ZYNA 1DFJI 4KT1A 1O6TA 3W3KA 3WPFA 3WPGA 1XECA 3WPIA 4R08A 3C6PB 4Y61B 2Z7XB 2P1QB 3E3ZA 3P72A 4WP6A 3ULVA 4LSAA 4R5CA 5B0NA 1M0ZA 3ZYOA 2O6RA 1IO0A 4H09A 4L3FA 4PERA 4LSXC 4L3AA 4R07A 1FQVA 5B0TA 3FXIA 4Q62A 2WFHA 1M9SA 3WPDA 4MQWX 4J4LA 1QYYA 1O6VA 1XCDA 4CNMA 4R0AA 1XWDC 5GMFA 5GS2B 2JE1A 4IM6A 2P1NB 4K17A 3W3LA 1KOOA 3BZ5A 3RGZA 4AY9X 1DCEA 2ASTB 4RWTC 1FT8A 3VQ1A 3OGMB 3E4GA 4Z64C 3RW7A 5AWDA 3RJ0A 5IYXC 2Z82A 4OQTA 3PMHG 2O6SA 3C6NB 2OMVA 4QC0A 4XSQA 3SB4A 4R09A 3E2JA 4QXEA 3OJAB 4GLPA 4CP6A 1OTNA 4M7EC 4J0MA 5CMPA 2V70A 3KJ4A 2P1MB 1FS2A 2P1PB 4LXSA 3WPBA 1Z7XW 2V9TB 3G3BA 4U09A 1WWLA 1K5DC 3W3JA 4WYKA 1XEUA 3OGKB 4C2BB 4BSRA 4Q3GA 4ECOA 2WQVA 4V2DA 1YRGA 4LI2A 4XGOA 3A79B 2Y5QA 3G3AA 1OTMA 2BNHA 3RFEA 1KOHA 4FMZA 4RCWA 3DZEA 5LFNA 4Z8GA 4EZGA 3ZYIA 4FHOA 1GWBA 1U0ND 3ULAA 1FO1A 2OMXA 4PQ8A 1A4YA 3WPHA 5CMNA 4NZRM 2WQWA 3RIZA 4KNGA 5AWBA 2WQXA 2UZYA 3G06A 4R6AA 1O6SA 2Z7XA 2OMZA 2O6QA 2Q4GW 2Z65A 4PSJA 2Z63A 5FTTB 3O53A 4UFRA 1M9LA 4I6JB 4LXRA 3TSRE 3ULUA 3UL8A 4NKGA 3G39A 3WN4A 1OOKG 1P8TA 4CILA 2Z66A 1H6UA 3C6OB 4U7LA 3ZYJA 2OMYA 4NKHA 4BV4R 4V2EA 2ASSB 5B4PA 5GMHA 2OMUA 3CIYA 3M18A 5IJDA 4CC4A 3UN9A 3RFSA 5GS0A 2OMTA
chains in the Genus database with same CATH topology
4R58A 4RCAB 4QBZA 2OMWA 5AWAA 4R6FA 4LSCA 4LI1A 4U06A 4FS7A 4R6GA 5D3IA 1P8VA 3UL9A 4FD0A 4BSSA 4Z79A 4YEBB 3G04C 1JL5A 4Q3IA 4FDWA 3CIGA 2Z64A 5HDHA 3CVRA 4KXFB 2JQDA 3RGXA 2R9UA 4BSUA 1D0BA 5IJBA 3VQ2A 2BEXA 4CNCA 5GMGA 1DS9A 3JB9j 3E6JA 4FCGA 1P9AG 1M10B 3W3NA 4ARNA 3RW6A 1OGQA 2V9SA 3GOZA 5A5CA 4B8CD 4R5DA 4P8SA 4R6JA 3REZA 4LSXA 5HZLB 1LTXA 1OTOA 5AZ5A 1G9UA 4C2AB 4Z94G 2JE0A 4ECNA 5IJCA 5GQRK 1XKUA 3O6NA 5AWCA 4TZHA 4Z61C 4XOSA 4MN8B 3W3GA 4HQ1A 4GT6A 4ARRA 2FT3A 4CC4C 1ZIWA 3OGLB 4U08A 2ID5A 3W3MA 3UL7A 1A9NA 4PKIG 2RR6A 2P1OB 4P91A 4V2CA 2WQUA 2ELLA 1PGVA 4G8AA 3M19A 4PEQB 3RFJA 2Z62A 2XWTC 3WPCA 1W8AA 2A0ZA 3WPEA 1SQ0B 1H6TA 3OJAA 2XOTA 4AW4A 4M7EA 1OZNA 2CA6A 2Z81A 2RA8A 1K5GC 2IFGA 2UZXA 3ZYNA 1DFJI 4KT1A 1O6TA 3W3KA 3WPFA 3WPGA 1XECA 3WPIA 4R08A 3C6PB 4Y61B 2Z7XB 2P1QB 3E3ZA 3P72A 4WP6A 3ULVA 4LSAA 4R5CA 5B0NA 1M0ZA 3ZYOA 2O6RA 1IO0A 4H09A 4L3FA 4PERA 4LSXC 4L3AA 4R07A 1FQVA 5B0TA 3FXIA 4Q62A 2WFHA 1M9SA 3WPDA 4MQWX 4J4LA 1QYYA 1O6VA 1XCDA 4CNMA 4R0AA 1XWDC 5GMFA 5GS2B 2JE1A 4IM6A 2P1NB 4K17A 3W3LA 1KOOA 3BZ5A 3RGZA 4AY9X 1DCEA 2ASTB 4RWTC 1FT8A 3VQ1A 3OGMB 3E4GA 4Z64C 3RW7A 5AWDA 3RJ0A 5IYXC 2Z82A 4OQTA 3PMHG 2O6SA 3C6NB 2OMVA 4QC0A 4XSQA 3SB4A 4R09A 3E2JA 4QXEA 3OJAB 4GLPA 4CP6A 1OTNA 4M7EC 4J0MA 5CMPA 2V70A 3KJ4A 2P1MB 1FS2A 2P1PB 4LXSA 3WPBA 1Z7XW 2V9TB 3G3BA 4U09A 1WWLA 1K5DC 3W3JA 4WYKA 1XEUA 3OGKB 4C2BB 4BSRA 4Q3GA 4ECOA 2WQVA 4V2DA 1YRGA 4LI2A 4XGOA 3A79B 2Y5QA 3G3AA 1OTMA 2BNHA 3RFEA 1KOHA 4FMZA 4RCWA 3DZEA 5LFNA 4Z8GA 4EZGA 3ZYIA 4FHOA 1GWBA 1U0ND 3ULAA 1FO1A 2OMXA 4PQ8A 1A4YA 3WPHA 5CMNA 2WQWA 3RIZA 4KNGA 5AWBA 2WQXA 2UZYA 3G06A 4R6AA 1O6SA 2Z7XA 2OMZA 2O6QA 2Q4GW 2Z65A 4PSJA 2Z63A 5FTTB 3O53A 4UFRA 1M9LA 4I6JB 4LXRA 3TSRE 3ULUA 3UL8A 4NKGA 3G39A 3WN4A 1OOKG 1P8TA 4CILA 2Z66A 1H6UA 3C6OB 4U7LA 3ZYJA 2OMYA 4NKHA 4BV4R 4V2EA 2ASSB 5B4PA 5GMHA 2OMUA 3CIYA 3M18A 5IJDA 4CC4A 3UN9A 3RFSA 5GS0A 2OMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R58 A;  4RCA B;  4QBZ A;  2OMW A;  5AWA A;  4R6F A;  4LSC A;  4LI1 A;  4U06 A;  4FS7 A;  4R6G A;  5D3I A;  1P8V A;  3UL9 A;  4FD0 A;  4BSS A;  4Z79 A;  4YEB B;  3G04 C;  1JL5 A;  4Q3I A;  4FDW A;  3CIG A;  2Z64 A;  5HDH A;  3CVR A;  4KXF B;  2JQD A;  3RGX A;  2R9U A;  4BSU A;  1D0B A;  5IJB A;  3VQ2 A;  2BEX A;  4CNC A;  5GMG A;  1DS9 A;  3JB9 j;  3E6J A;  4FCG A;  1P9A G;  1M10 B;  3W3N A;  4ARN A;  3RW6 A;  1OGQ A;  2V9S A;  3GOZ A;  5A5C A;  4B8C D;  4R5D A;  4P8S A;  4R6J A;  3REZ A;  4LSX A;  5HZL B;  1LTX A;  1OTO A;  5AZ5 A;  1G9U A;  4C2A B;  4Z94 G;  2JE0 A;  4ECN A;  5IJC A;  5GQR K;  1XKU A;  3O6N A;  5AWC A;  4TZH A;  4Z61 C;  4XOS A;  4MN8 B;  3W3G A;  4HQ1 A;  4GT6 A;  4ARR A;  2FT3 A;  4CC4 C;  1ZIW A;  3OGL B;  4U08 A;  2ID5 A;  3W3M A;  3UL7 A;  1A9N A;  4PKI G;  2RR6 A;  2P1O B;  4P91 A;  4V2C A;  2WQU A;  2ELL A;  1PGV A;  4G8A A;  3M19 A;  4PEQ B;  3RFJ A;  2Z62 A;  2XWT C;  3WPC A;  1W8A A;  2A0Z A;  3WPE A;  1SQ0 B;  1H6T A;  3OJA A;  2XOT A;  4AW4 A;  4M7E A;  1OZN A;  2CA6 A;  2Z81 A;  2RA8 A;  1K5G C;  2IFG A;  2UZX A;  3ZYN A;  1DFJ I;  4KT1 A;  1O6T A;  3W3K A;  3WPF A;  3WPG A;  1XEC A;  3WPI A;  4R08 A;  3C6P B;  4Y61 B;  2Z7X B;  2P1Q B;  3E3Z A;  3P72 A;  4WP6 A;  3ULV A;  4LSA A;  4R5C A;  5B0N A;  1M0Z A;  3ZYO A;  2O6R A;  1IO0 A;  4H09 A;  4L3F A;  4PER A;  4LSX C;  4L3A A;  4R07 A;  1FQV A;  5B0T A;  3FXI A;  4Q62 A;  2WFH A;  1M9S A;  3WPD A;  4MQW X;  4J4L A;  1QYY A;  1O6V A;  1XCD A;  4CNM A;  4R0A A;  1XWD C;  5GMF A;  5GS2 B;  2JE1 A;  4IM6 A;  2P1N B;  4K17 A;  3W3L A;  1KOO A;  3BZ5 A;  3RGZ A;  4AY9 X;  1DCE A;  2AST B;  4RWT C;  1FT8 A;  3VQ1 A;  3OGM B;  3E4G A;  4Z64 C;  3RW7 A;  5AWD A;  3RJ0 A;  5IYX C;  2Z82 A;  4OQT A;  3PMH G;  2O6S A;  3C6N B;  2OMV A;  4QC0 A;  4XSQ A;  3SB4 A;  4R09 A;  3E2J A;  4QXE A;  3OJA B;  4GLP A;  4CP6 A;  1OTN A;  4M7E C;  4J0M A;  5CMP A;  2V70 A;  3KJ4 A;  2P1M B;  1FS2 A;  2P1P B;  4LXS A;  3WPB A;  1Z7X W;  2V9T B;  3G3B A;  4U09 A;  1WWL A;  1K5D C;  3W3J A;  4WYK A;  1XEU A;  3OGK B;  4C2B B;  4BSR A;  4Q3G A;  4ECO A;  2WQV A;  4V2D A;  1YRG A;  4LI2 A;  4XGO A;  3A79 B;  2Y5Q A;  3G3A A;  1OTM A;  2BNH A;  3RFE A;  1KOH A;  4FMZ A;  4RCW A;  3DZE A;  5LFN A;  4Z8G A;  4EZG A;  3ZYI A;  4FHO A;  1GWB A;  1U0N D;  3ULA A;  1FO1 A;  2OMX A;  4PQ8 A;  1A4Y A;  3WPH A;  5CMN A;  2WQW A;  3RIZ A;  4KNG A;  5AWB A;  2WQX A;  2UZY A;  3G06 A;  4R6A A;  1O6S A;  2Z7X A;  2OMZ A;  2O6Q A;  2Q4G W;  2Z65 A;  4PSJ A;  2Z63 A;  5FTT B;  3O53 A;  4UFR A;  1M9L A;  4I6J B;  4LXR A;  3TSR E;  3ULU A;  3UL8 A;  4NKG A;  3G39 A;  3WN4 A;  1OOK G;  1P8T A;  4CIL A;  2Z66 A;  1H6U A;  3C6O B;  4U7L A;  3ZYJ A;  2OMY A;  4NKH A;  4BV4 R;  4V2E A;  2ASS B;  5B4P A;  5GMH A;  2OMU A;  3CIY A;  3M18 A;  5IJD A;  4CC4 A;  3UN9 A;  3RFS A;  5GS0 A;  2OMT A; 
#chains in the Genus database with same CATH topology
 4R58 A;  4RCA B;  4QBZ A;  2OMW A;  5AWA A;  4R6F A;  4LSC A;  4LI1 A;  4U06 A;  4FS7 A;  4R6G A;  5D3I A;  1P8V A;  3UL9 A;  4FD0 A;  4BSS A;  4Z79 A;  4YEB B;  3G04 C;  1JL5 A;  4Q3I A;  4FDW A;  3CIG A;  2Z64 A;  5HDH A;  3CVR A;  4KXF B;  2JQD A;  3RGX A;  2R9U A;  4BSU A;  1D0B A;  5IJB A;  3VQ2 A;  2BEX A;  4CNC A;  5GMG A;  1DS9 A;  3JB9 j;  3E6J A;  4FCG A;  1P9A G;  1M10 B;  3W3N A;  4ARN A;  3RW6 A;  1OGQ A;  2V9S A;  3GOZ A;  5A5C A;  4B8C D;  4R5D A;  4P8S A;  4R6J A;  3REZ A;  4LSX A;  5HZL B;  1LTX A;  1OTO A;  5AZ5 A;  1G9U A;  4C2A B;  4Z94 G;  2JE0 A;  4ECN A;  5IJC A;  5GQR K;  1XKU A;  3O6N A;  5AWC A;  4TZH A;  4Z61 C;  4XOS A;  4MN8 B;  3W3G A;  4HQ1 A;  4GT6 A;  4ARR A;  2FT3 A;  4CC4 C;  1ZIW A;  3OGL B;  4U08 A;  2ID5 A;  3W3M A;  3UL7 A;  1A9N A;  4PKI G;  2RR6 A;  2P1O B;  4P91 A;  4V2C A;  2WQU A;  2ELL A;  1PGV A;  4G8A A;  3M19 A;  4PEQ B;  3RFJ A;  2Z62 A;  2XWT C;  3WPC A;  1W8A A;  2A0Z A;  3WPE A;  1SQ0 B;  4NZT M;  1H6T A;  3OJA A;  2XOT A;  4AW4 A;  4M7E A;  1OZN A;  2CA6 A;  2Z81 A;  2RA8 A;  1K5G C;  2IFG A;  2UZX A;  3ZYN A;  1DFJ I;  4KT1 A;  1O6T A;  3W3K A;  3WPF A;  3WPG A;  1XEC A;  3WPI A;  4R08 A;  3C6P B;  4Y61 B;  2Z7X B;  2P1Q B;  3E3Z A;  3P72 A;  4WP6 A;  3ULV A;  4LSA A;  4R5C A;  5B0N A;  1M0Z A;  3ZYO A;  2O6R A;  1IO0 A;  4H09 A;  4L3F A;  4PER A;  4LSX C;  4L3A A;  4R07 A;  1FQV A;  5B0T A;  3FXI A;  4Q62 A;  2WFH A;  1M9S A;  3WPD A;  4MQW X;  4J4L A;  1QYY A;  1O6V A;  1XCD A;  4CNM A;  4R0A A;  1XWD C;  5GMF A;  5GS2 B;  2JE1 A;  4IM6 A;  2P1N B;  4K17 A;  3W3L A;  1KOO A;  3BZ5 A;  3RGZ A;  4AY9 X;  1DCE A;  2AST B;  4RWT C;  1FT8 A;  3VQ1 A;  3OGM B;  3E4G A;  4Z64 C;  3RW7 A;  5AWD A;  3RJ0 A;  5IYX C;  2Z82 A;  4OQT A;  3PMH G;  2O6S A;  3C6N B;  2OMV A;  4QC0 A;  4XSQ A;  3SB4 A;  4R09 A;  3E2J A;  4QXE A;  3OJA B;  4GLP A;  4CP6 A;  1OTN A;  4M7E C;  4J0M A;  5CMP A;  2V70 A;  3KJ4 A;  2P1M B;  1FS2 A;  2P1P B;  4LXS A;  3WPB A;  1Z7X W;  2V9T B;  3G3B A;  4U09 A;  1WWL A;  1K5D C;  3W3J A;  4WYK A;  1XEU A;  3OGK B;  4C2B B;  4BSR A;  4Q3G A;  4ECO A;  2WQV A;  4V2D A;  1YRG A;  4LI2 A;  4XGO A;  3A79 B;  2Y5Q A;  3G3A A;  1OTM A;  2BNH A;  3RFE A;  1KOH A;  4FMZ A;  4RCW A;  3DZE A;  5LFN A;  4Z8G A;  4EZG A;  3ZYI A;  4FHO A;  1GWB A;  1U0N D;  3ULA A;  1FO1 A;  2OMX A;  4PQ8 A;  1A4Y A;  3WPH A;  5CMN A;  4NZR M;  2WQW A;  3RIZ A;  4KNG A;  5AWB A;  2WQX A;  2UZY A;  3G06 A;  4R6A A;  1O6S A;  2Z7X A;  2OMZ A;  2O6Q A;  2Q4G W;  2Z65 A;  4PSJ A;  2Z63 A;  5FTT B;  3O53 A;  4UFR A;  1M9L A;  4I6J B;  4LXR A;  3TSR E;  3ULU A;  3UL8 A;  4NKG A;  3G39 A;  3WN4 A;  1OOK G;  1P8T A;  4CIL A;  2Z66 A;  1H6U A;  3C6O B;  4U7L A;  3ZYJ A;  2OMY A;  4NKH A;  4BV4 R;  4V2E A;  2ASS B;  5B4P A;  5GMH A;  2OMU A;  3CIY A;  3M18 A;  5IJD A;  4CC4 A;  3UN9 A;  3RFS A;  5GS0 A;  2OMT A; 
#chains in the Genus database with same CATH homology
 4R58 A;  4RCA B;  4QBZ A;  2OMW A;  5AWA A;  4R6F A;  4LSC A;  4LI1 A;  4U06 A;  4FS7 A;  4R6G A;  5D3I A;  1P8V A;  3UL9 A;  4FD0 A;  4BSS A;  4Z79 A;  4YEB B;  3G04 C;  1JL5 A;  4Q3I A;  4FDW A;  3CIG A;  2Z64 A;  5HDH A;  3CVR A;  4KXF B;  2JQD A;  3RGX A;  2R9U A;  4BSU A;  1D0B A;  5IJB A;  3VQ2 A;  2BEX A;  4CNC A;  5GMG A;  1DS9 A;  3JB9 j;  3E6J A;  4FCG A;  1P9A G;  1M10 B;  3W3N A;  4ARN A;  3RW6 A;  1OGQ A;  2V9S A;  3GOZ A;  5A5C A;  4B8C D;  4R5D A;  4P8S A;  4R6J A;  3REZ A;  4LSX A;  5HZL B;  1LTX A;  1OTO A;  5AZ5 A;  1G9U A;  4C2A B;  4Z94 G;  2JE0 A;  4ECN A;  5IJC A;  5GQR K;  1XKU A;  3O6N A;  5AWC A;  4TZH A;  4Z61 C;  4XOS A;  4MN8 B;  3W3G A;  4HQ1 A;  4GT6 A;  4ARR A;  2FT3 A;  4CC4 C;  1ZIW A;  3OGL B;  4U08 A;  2ID5 A;  3W3M A;  3UL7 A;  1A9N A;  4PKI G;  2RR6 A;  2P1O B;  4P91 A;  4V2C A;  2WQU A;  2ELL A;  1PGV A;  4G8A A;  3M19 A;  4PEQ B;  3RFJ A;  2Z62 A;  2XWT C;  3WPC A;  1W8A A;  2A0Z A;  3WPE A;  1SQ0 B;  1H6T A;  3OJA A;  2XOT A;  4AW4 A;  4M7E A;  1OZN A;  2CA6 A;  2Z81 A;  2RA8 A;  1K5G C;  2IFG A;  2UZX A;  3ZYN A;  1DFJ I;  4KT1 A;  1O6T A;  3W3K A;  3WPF A;  3WPG A;  1XEC A;  3WPI A;  4R08 A;  3C6P B;  4Y61 B;  2Z7X B;  2P1Q B;  3E3Z A;  3P72 A;  4WP6 A;  3ULV A;  4LSA A;  4R5C A;  5B0N A;  1M0Z A;  3ZYO A;  2O6R A;  1IO0 A;  4H09 A;  4L3F A;  4PER A;  4LSX C;  4L3A A;  4R07 A;  1FQV A;  5B0T A;  3FXI A;  4Q62 A;  2WFH A;  1M9S A;  3WPD A;  4MQW X;  4J4L A;  1QYY A;  1O6V A;  1XCD A;  4CNM A;  4R0A A;  1XWD C;  5GMF A;  5GS2 B;  2JE1 A;  4IM6 A;  2P1N B;  4K17 A;  3W3L A;  1KOO A;  3BZ5 A;  3RGZ A;  4AY9 X;  1DCE A;  2AST B;  4RWT C;  1FT8 A;  3VQ1 A;  3OGM B;  3E4G A;  4Z64 C;  3RW7 A;  5AWD A;  3RJ0 A;  5IYX C;  2Z82 A;  4OQT A;  3PMH G;  2O6S A;  3C6N B;  2OMV A;  4QC0 A;  4XSQ A;  3SB4 A;  4R09 A;  3E2J A;  4QXE A;  3OJA B;  4GLP A;  4CP6 A;  1OTN A;  4M7E C;  4J0M A;  5CMP A;  2V70 A;  3KJ4 A;  2P1M B;  1FS2 A;  2P1P B;  4LXS A;  3WPB A;  1Z7X W;  2V9T B;  3G3B A;  4U09 A;  1WWL A;  1K5D C;  3W3J A;  4WYK A;  1XEU A;  3OGK B;  4C2B B;  4BSR A;  4Q3G A;  4ECO A;  2WQV A;  4V2D A;  1YRG A;  4LI2 A;  4XGO A;  3A79 B;  2Y5Q A;  3G3A A;  1OTM A;  2BNH A;  3RFE A;  1KOH A;  4FMZ A;  4RCW A;  3DZE A;  5LFN A;  4Z8G A;  4EZG A;  3ZYI A;  4FHO A;  1GWB A;  1U0N D;  3ULA A;  1FO1 A;  2OMX A;  4PQ8 A;  1A4Y A;  3WPH A;  5CMN A;  2WQW A;  3RIZ A;  4KNG A;  5AWB A;  2WQX A;  2UZY A;  3G06 A;  4R6A A;  1O6S A;  2Z7X A;  2OMZ A;  2O6Q A;  2Q4G W;  2Z65 A;  4PSJ A;  2Z63 A;  5FTT B;  3O53 A;  4UFR A;  1M9L A;  4I6J B;  4LXR A;  3TSR E;  3ULU A;  3UL8 A;  4NKG A;  3G39 A;  3WN4 A;  1OOK G;  1P8T A;  4CIL A;  2Z66 A;  1H6U A;  3C6O B;  4U7L A;  3ZYJ A;  2OMY A;  4NKH A;  4BV4 R;  4V2E A;  2ASS B;  5B4P A;  5GMH A;  2OMU A;  3CIY A;  3M18 A;  5IJD A;  4CC4 A;  3UN9 A;  3RFS A;  5GS0 A;  2OMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...