1W8AA

Third lrr domain of drosophila slit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
189
Chain Sequence
DCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SLIT PROTEIN
publication title Binding Site for Robo Receptors Revealed by Dissection of the Leucine-Rich Repeat Region of Slit.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 51
structure length 189
sequence length 192
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF01463 LRRCT Leucine rich repeat C-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1w8aA00
3M18A 4Y61B 2Z82A 3RFSA 3BZ5A 3E6JA 4NKGA 3O6NA 1OGQA 4C2AB 4WYKA 4BSRA 4L3FA 4PERA 4LSAA 4YEBB 2UZXA 4I6JB 4LXRA 1U0ND 3WPGA 1M0ZA 2O6RA 2V9TB 2Y5QA 3RW7A 1OOKG 4M7EC 1LTXA 2P1NB 4R6AA 2Z63A 4R58A 1A9NA 2V70A 1OZNA 2ID5A 3OJAB 3WPCA 4V2EA 4CNMA 4KNGA 2FT3A 4ARRA 2Z66A 4XOSA 3TSRE 5GS0A 3ZYOA 4U7LA 4CC4C 2CA6A 2P1QB 4CNCA 4Q3GA 3VQ2A 1FT8A 5B4PA 2BNHA 5LFNA 4Z79A 3WN4A 1FQVA 2A0ZA 3ULAA 5GMGA 5AWBA 3WPEA 3UL9A 4R5DA 3C6OB 2Z81A 1Z7XW 4R6FA 4BV4R 4Q3IA 5IJCA 1FO1A 4R08A 4XSQA 3RFJA 4RWTC 2UZYA 2OMZA 1GWBA 4Q62A 1OTMA 3OGKB 5AWCA 5CMPA 2P1MB 2WFHA 3CVRA 4LSCA 3PMHG 3WPHA 2O6QA 2ASTB 1XECA 1G9UA 3RGZA 4Z64C 4FD0A 4U08A 3RFEA 5GMHA 1D0BA 5IYXC 2OMUA 4FDWA 4LSXA 4TZHA 3M19A 4J4LA 1XWDC 2P1PB 1M9LA 2WQUA 4QXEA 4HQ1A 4CP6A 3WPFA 1WWLA 4KXFB 4R6JA 4K17A 2R9UA 3C6PB 4Z61C 2WQXA 4R0AA 4R09A 3DZEA 5IJDA 4J0MA 3OGMB 3P72A 2V9SA 1XKUA 3WPIA 4LI1A 1H6TA 4AY9X 3RW6A 4GLPA 2OMWA 4MN8B 1OTOA 5B0NA 4U09A 3KJ4A 2ELLA 3G04C 4LI2A 4CILA 5HDHA 3VQ1A 4OQTA 2IFGA 5GS2B 4Z8GA 3ULUA 3CIGA 2OMVA 4Z94G 3G06A 5AZ5A 5D3IA 4PQ8A 1A4YA 3GOZA 5A5CA 4M7EA 2Z7XA 2ASSB 1PGVA 2OMYA 3W3KA 1QYYA 1KOOA 4R6GA 4G8AA 3E2JA 4P8SA 4PSJA 5B0TA 1O6SA 4R5CA 3RJ0A 3A79B 1O6VA 4C2BB 5IJBA 1P9AG 4U06A 1O6TA 4FMZA 2JE1A 4WP6A 2P1OB 2O6SA 2JE0A 3UN9A 3RGXA 4IM6A 3W3GA 5AWDA 3G3AA 1DCEA 4NKHA 5CMNA 3CIYA 3E3ZA 1XCDA 2OMTA 4GT6A 3O53A 3OGLB 3RIZA 1ZIWA 2OMXA 3ZYJA 1P8VA 3FXIA 4ARNA 1M10B 2BEXA 4BSSA 3W3MA 2Z7XB 3JB9j 1P8TA 4V2DA 4ECNA 3UL7A 4AW4A 4QC0A 1IO0A 2RR6A 1H6UA 3W3JA 4FCGA 1OTNA 4EZGA 1DS9A 2WQVA 4H09A 3ZYIA 4FHOA 1XEUA 4MQWX 4R07A 4UFRA 3W3NA 1KOHA 2XOTA 1YRGA 3W3LA 5FTTB 2Z65A 2RA8A 1W8AA 2Z64A 4QBZA 5HZLB 2Q4GW 4FS7A 3ZYNA 4LXSA 3WPDA 4LSXC 4KT1A 1M9SA 4RCWA 2Z62A 2JQDA 3C6NB 1SQ0B 4RCAB 4ECOA 4P91A 4XGOA 3ULVA 5GMFA 1K5GC 1DFJI 1K5DC 3E4GA 4V2CA 1JL5A 3UL8A 3WPBA 5AWAA 2XWTC 4PEQB 4L3AA 3REZA 5GQRK 4CC4A 4BSUA 3SB4A 3OJAA 2WQWA 3G39A 4B8CD 1FS2A 3G3BA 4PKIG
chains in the Genus database with same CATH superfamily
3M18A 4Y61B 2Z82A 3RFSA 3BZ5A 3E6JA 4NKGA 3O6NA 1OGQA 4C2AB 4WYKA 4BSRA 4L3FA 4PERA 4LSAA 4YEBB 2UZXA 4I6JB 4LXRA 1U0ND 3WPGA 1M0ZA 2O6RA 2V9TB 2Y5QA 3RW7A 1OOKG 4M7EC 1LTXA 2P1NB 4R6AA 2Z63A 4R58A 1A9NA 2V70A 1OZNA 2ID5A 3OJAB 3WPCA 4V2EA 4CNMA 4KNGA 2FT3A 4ARRA 2Z66A 4XOSA 3TSRE 5GS0A 3ZYOA 4U7LA 4CC4C 2CA6A 2P1QB 4CNCA 4Q3GA 3VQ2A 1FT8A 5B4PA 2BNHA 5LFNA 4Z79A 3WN4A 1FQVA 2A0ZA 3ULAA 5GMGA 5AWBA 3WPEA 3UL9A 4R5DA 3C6OB 2Z81A 1Z7XW 4R6FA 4BV4R 4Q3IA 5IJCA 1FO1A 4R08A 4XSQA 3RFJA 4RWTC 2UZYA 2OMZA 1GWBA 4Q62A 1OTMA 3OGKB 5AWCA 5CMPA 2P1MB 2WFHA 3CVRA 4LSCA 3PMHG 3WPHA 2O6QA 2ASTB 1XECA 1G9UA 3RGZA 4Z64C 4FD0A 4U08A 3RFEA 5GMHA 1D0BA 5IYXC 2OMUA 4FDWA 4LSXA 4TZHA 3M19A 4J4LA 1XWDC 2P1PB 1M9LA 2WQUA 4QXEA 4HQ1A 4CP6A 3WPFA 1WWLA 4KXFB 4R6JA 4K17A 2R9UA 3C6PB 4Z61C 2WQXA 4R0AA 4R09A 3DZEA 5IJDA 4J0MA 3OGMB 3P72A 2V9SA 1XKUA 3WPIA 4LI1A 1H6TA 4AY9X 3RW6A 4GLPA 2OMWA 4MN8B 1OTOA 5B0NA 4U09A 3KJ4A 2ELLA 3G04C 4LI2A 4CILA 5HDHA 3VQ1A 4OQTA 2IFGA 5GS2B 4Z8GA 3ULUA 3CIGA 2OMVA 4Z94G 3G06A 5AZ5A 5D3IA 4PQ8A 1A4YA 3GOZA 5A5CA 4M7EA 2Z7XA 2ASSB 1PGVA 2OMYA 3W3KA 1QYYA 1KOOA 4R6GA 4G8AA 3E2JA 4P8SA 4PSJA 5B0TA 1O6SA 4R5CA 3RJ0A 3A79B 1O6VA 4C2BB 5IJBA 1P9AG 4U06A 4NZTM 1O6TA 4FMZA 2JE1A 4WP6A 2P1OB 2O6SA 2JE0A 3UN9A 3RGXA 4IM6A 3W3GA 5AWDA 3G3AA 1DCEA 4NKHA 5CMNA 3CIYA 3E3ZA 1XCDA 2OMTA 4GT6A 3O53A 3OGLB 3RIZA 1ZIWA 2OMXA 3ZYJA 1P8VA 3FXIA 4ARNA 1M10B 2BEXA 4BSSA 3W3MA 2Z7XB 3JB9j 1P8TA 4V2DA 4ECNA 3UL7A 4AW4A 4NZRM 4QC0A 1IO0A 2RR6A 1H6UA 3W3JA 4FCGA 1OTNA 4EZGA 1DS9A 2WQVA 4H09A 3ZYIA 4FHOA 1XEUA 4MQWX 4R07A 4UFRA 3W3NA 1KOHA 2XOTA 1YRGA 3W3LA 5FTTB 2Z65A 2RA8A 1W8AA 2Z64A 4QBZA 5HZLB 2Q4GW 4FS7A 3ZYNA 4LXSA 3WPDA 4LSXC 4KT1A 1M9SA 4RCWA 2Z62A 2JQDA 3C6NB 1SQ0B 4RCAB 4ECOA 4P91A 4XGOA 3ULVA 5GMFA 1K5GC 1DFJI 1K5DC 3E4GA 4V2CA 1JL5A 3UL8A 3WPBA 5AWAA 2XWTC 4PEQB 4L3AA 3REZA 5GQRK 4CC4A 4BSUA 3SB4A 3OJAA 2WQWA 3G39A 4B8CD 1FS2A 3G3BA 4PKIG
chains in the Genus database with same CATH topology
3M18A 4Y61B 2Z82A 3RFSA 3BZ5A 3E6JA 4NKGA 3O6NA 1OGQA 4C2AB 4WYKA 4BSRA 4L3FA 4PERA 4LSAA 4YEBB 2UZXA 4I6JB 4LXRA 1U0ND 3WPGA 1M0ZA 2O6RA 2V9TB 2Y5QA 3RW7A 1OOKG 4M7EC 1LTXA 2P1NB 4R6AA 2Z63A 4R58A 1A9NA 2V70A 1OZNA 2ID5A 3OJAB 3WPCA 4V2EA 4CNMA 4KNGA 2FT3A 4ARRA 2Z66A 4XOSA 3TSRE 5GS0A 3ZYOA 4U7LA 4CC4C 2CA6A 2P1QB 4CNCA 4Q3GA 3VQ2A 1FT8A 5B4PA 2BNHA 5LFNA 4Z79A 3WN4A 1FQVA 2A0ZA 3ULAA 5GMGA 5AWBA 3WPEA 3UL9A 4R5DA 3C6OB 2Z81A 1Z7XW 4R6FA 4BV4R 4Q3IA 5IJCA 1FO1A 4R08A 4XSQA 3RFJA 4RWTC 2UZYA 2OMZA 1GWBA 4Q62A 1OTMA 3OGKB 5AWCA 5CMPA 2P1MB 2WFHA 3CVRA 4LSCA 3PMHG 3WPHA 2O6QA 2ASTB 1XECA 1G9UA 3RGZA 4Z64C 4FD0A 4U08A 3RFEA 5GMHA 1D0BA 5IYXC 2OMUA 4FDWA 4LSXA 4TZHA 3M19A 4J4LA 1XWDC 2P1PB 1M9LA 2WQUA 4QXEA 4HQ1A 4CP6A 3WPFA 1WWLA 4KXFB 4R6JA 4K17A 2R9UA 3C6PB 4Z61C 2WQXA 4R0AA 4R09A 3DZEA 5IJDA 4J0MA 3OGMB 3P72A 2V9SA 1XKUA 3WPIA 4LI1A 1H6TA 4AY9X 3RW6A 4GLPA 2OMWA 4MN8B 1OTOA 5B0NA 4U09A 3KJ4A 2ELLA 3G04C 4LI2A 4CILA 5HDHA 3VQ1A 4OQTA 2IFGA 5GS2B 4Z8GA 3ULUA 3CIGA 2OMVA 4Z94G 3G06A 5AZ5A 5D3IA 4PQ8A 1A4YA 3GOZA 5A5CA 4M7EA 2Z7XA 2ASSB 1PGVA 2OMYA 3W3KA 1QYYA 1KOOA 4R6GA 4G8AA 3E2JA 4P8SA 4PSJA 5B0TA 1O6SA 4R5CA 3RJ0A 3A79B 1O6VA 4C2BB 5IJBA 1P9AG 4U06A 1O6TA 4FMZA 2JE1A 4WP6A 2P1OB 2O6SA 2JE0A 3UN9A 3RGXA 4IM6A 3W3GA 5AWDA 3G3AA 1DCEA 4NKHA 5CMNA 3CIYA 3E3ZA 1XCDA 2OMTA 4GT6A 3O53A 3OGLB 3RIZA 1ZIWA 2OMXA 3ZYJA 1P8VA 3FXIA 4ARNA 1M10B 2BEXA 4BSSA 3W3MA 2Z7XB 3JB9j 1P8TA 4V2DA 4ECNA 3UL7A 4AW4A 4QC0A 1IO0A 2RR6A 1H6UA 3W3JA 4FCGA 1OTNA 4EZGA 1DS9A 2WQVA 4H09A 3ZYIA 4FHOA 1XEUA 4MQWX 4R07A 4UFRA 3W3NA 1KOHA 2XOTA 1YRGA 3W3LA 5FTTB 2Z65A 2RA8A 1W8AA 2Z64A 4QBZA 5HZLB 2Q4GW 4FS7A 3ZYNA 4LXSA 3WPDA 4LSXC 4KT1A 1M9SA 4RCWA 2Z62A 2JQDA 3C6NB 1SQ0B 4RCAB 4ECOA 4P91A 4XGOA 3ULVA 5GMFA 1K5GC 1DFJI 1K5DC 3E4GA 4V2CA 1JL5A 3UL8A 3WPBA 5AWAA 2XWTC 4PEQB 4L3AA 3REZA 5GQRK 4CC4A 4BSUA 3SB4A 3OJAA 2WQWA 3G39A 4B8CD 1FS2A 3G3BA 4PKIG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M18 A;  4Y61 B;  2Z82 A;  3RFS A;  3BZ5 A;  3E6J A;  4NKG A;  3O6N A;  1OGQ A;  4C2A B;  4WYK A;  4BSR A;  4L3F A;  4PER A;  4LSA A;  4YEB B;  2UZX A;  4I6J B;  4LXR A;  1U0N D;  3WPG A;  1M0Z A;  2O6R A;  2V9T B;  2Y5Q A;  3RW7 A;  1OOK G;  4M7E C;  1LTX A;  2P1N B;  4R6A A;  2Z63 A;  4R58 A;  1A9N A;  2V70 A;  1OZN A;  2ID5 A;  3OJA B;  3WPC A;  4V2E A;  4CNM A;  4KNG A;  2FT3 A;  4ARR A;  2Z66 A;  4XOS A;  3TSR E;  5GS0 A;  3ZYO A;  4U7L A;  4CC4 C;  2CA6 A;  2P1Q B;  4CNC A;  4Q3G A;  3VQ2 A;  1FT8 A;  5B4P A;  2BNH A;  5LFN A;  4Z79 A;  3WN4 A;  1FQV A;  2A0Z A;  3ULA A;  5GMG A;  5AWB A;  3WPE A;  3UL9 A;  4R5D A;  3C6O B;  2Z81 A;  1Z7X W;  4R6F A;  4BV4 R;  4Q3I A;  5IJC A;  1FO1 A;  4R08 A;  4XSQ A;  3RFJ A;  4RWT C;  2UZY A;  2OMZ A;  1GWB A;  4Q62 A;  1OTM A;  3OGK B;  5AWC A;  5CMP A;  2P1M B;  2WFH A;  3CVR A;  4LSC A;  3PMH G;  3WPH A;  2O6Q A;  2AST B;  1XEC A;  1G9U A;  3RGZ A;  4Z64 C;  4FD0 A;  4U08 A;  3RFE A;  5GMH A;  1D0B A;  5IYX C;  2OMU A;  4FDW A;  4LSX A;  4TZH A;  3M19 A;  4J4L A;  1XWD C;  2P1P B;  1M9L A;  2WQU A;  4QXE A;  4HQ1 A;  4CP6 A;  3WPF A;  1WWL A;  4KXF B;  4R6J A;  4K17 A;  2R9U A;  3C6P B;  4Z61 C;  2WQX A;  4R0A A;  4R09 A;  3DZE A;  5IJD A;  4J0M A;  3OGM B;  3P72 A;  2V9S A;  1XKU A;  3WPI A;  4LI1 A;  1H6T A;  4AY9 X;  3RW6 A;  4GLP A;  2OMW A;  4MN8 B;  1OTO A;  5B0N A;  4U09 A;  3KJ4 A;  2ELL A;  3G04 C;  4LI2 A;  4CIL A;  5HDH A;  3VQ1 A;  4OQT A;  2IFG A;  5GS2 B;  4Z8G A;  3ULU A;  3CIG A;  2OMV A;  4Z94 G;  3G06 A;  5AZ5 A;  5D3I A;  4PQ8 A;  1A4Y A;  3GOZ A;  5A5C A;  4M7E A;  2Z7X A;  2ASS B;  1PGV A;  2OMY A;  3W3K A;  1QYY A;  1KOO A;  4R6G A;  4G8A A;  3E2J A;  4P8S A;  4PSJ A;  5B0T A;  1O6S A;  4R5C A;  3RJ0 A;  3A79 B;  1O6V A;  4C2B B;  5IJB A;  1P9A G;  4U06 A;  1O6T A;  4FMZ A;  2JE1 A;  4WP6 A;  2P1O B;  2O6S A;  2JE0 A;  3UN9 A;  3RGX A;  4IM6 A;  3W3G A;  5AWD A;  3G3A A;  1DCE A;  4NKH A;  5CMN A;  3CIY A;  3E3Z A;  1XCD A;  2OMT A;  4GT6 A;  3O53 A;  3OGL B;  3RIZ A;  1ZIW A;  2OMX A;  3ZYJ A;  1P8V A;  3FXI A;  4ARN A;  1M10 B;  2BEX A;  4BSS A;  3W3M A;  2Z7X B;  3JB9 j;  1P8T A;  4V2D A;  4ECN A;  3UL7 A;  4AW4 A;  4QC0 A;  1IO0 A;  2RR6 A;  1H6U A;  3W3J A;  4FCG A;  1OTN A;  4EZG A;  1DS9 A;  2WQV A;  4H09 A;  3ZYI A;  4FHO A;  1XEU A;  4MQW X;  4R07 A;  4UFR A;  3W3N A;  1KOH A;  2XOT A;  1YRG A;  3W3L A;  5FTT B;  2Z65 A;  2RA8 A;  1W8A A;  2Z64 A;  4QBZ A;  5HZL B;  2Q4G W;  4FS7 A;  3ZYN A;  4LXS A;  3WPD A;  4LSX C;  4KT1 A;  1M9S A;  4RCW A;  2Z62 A;  2JQD A;  3C6N B;  1SQ0 B;  4RCA B;  4ECO A;  4P91 A;  4XGO A;  3ULV A;  5GMF A;  1K5G C;  1DFJ I;  1K5D C;  3E4G A;  4V2C A;  1JL5 A;  3UL8 A;  3WPB A;  5AWA A;  2XWT C;  4PEQ B;  4L3A A;  3REZ A;  5GQR K;  4CC4 A;  4BSU A;  3SB4 A;  3OJA A;  2WQW A;  3G39 A;  4B8C D;  1FS2 A;  3G3B A;  4PKI G; 
#chains in the Genus database with same CATH topology
 3M18 A;  4Y61 B;  2Z82 A;  3RFS A;  3BZ5 A;  3E6J A;  4NKG A;  3O6N A;  1OGQ A;  4C2A B;  4WYK A;  4BSR A;  4L3F A;  4PER A;  4LSA A;  4YEB B;  2UZX A;  4I6J B;  4LXR A;  1U0N D;  3WPG A;  1M0Z A;  2O6R A;  2V9T B;  2Y5Q A;  3RW7 A;  1OOK G;  4M7E C;  1LTX A;  2P1N B;  4R6A A;  2Z63 A;  4R58 A;  1A9N A;  2V70 A;  1OZN A;  2ID5 A;  3OJA B;  3WPC A;  4V2E A;  4CNM A;  4KNG A;  2FT3 A;  4ARR A;  2Z66 A;  4XOS A;  3TSR E;  5GS0 A;  3ZYO A;  4U7L A;  4CC4 C;  2CA6 A;  2P1Q B;  4CNC A;  4Q3G A;  3VQ2 A;  1FT8 A;  5B4P A;  2BNH A;  5LFN A;  4Z79 A;  3WN4 A;  1FQV A;  2A0Z A;  3ULA A;  5GMG A;  5AWB A;  3WPE A;  3UL9 A;  4R5D A;  3C6O B;  2Z81 A;  1Z7X W;  4R6F A;  4BV4 R;  4Q3I A;  5IJC A;  1FO1 A;  4R08 A;  4XSQ A;  3RFJ A;  4RWT C;  2UZY A;  2OMZ A;  1GWB A;  4Q62 A;  1OTM A;  3OGK B;  5AWC A;  5CMP A;  2P1M B;  2WFH A;  3CVR A;  4LSC A;  3PMH G;  3WPH A;  2O6Q A;  2AST B;  1XEC A;  1G9U A;  3RGZ A;  4Z64 C;  4FD0 A;  4U08 A;  3RFE A;  5GMH A;  1D0B A;  5IYX C;  2OMU A;  4FDW A;  4LSX A;  4TZH A;  3M19 A;  4J4L A;  1XWD C;  2P1P B;  1M9L A;  2WQU A;  4QXE A;  4HQ1 A;  4CP6 A;  3WPF A;  1WWL A;  4KXF B;  4R6J A;  4K17 A;  2R9U A;  3C6P B;  4Z61 C;  2WQX A;  4R0A A;  4R09 A;  3DZE A;  5IJD A;  4J0M A;  3OGM B;  3P72 A;  2V9S A;  1XKU A;  3WPI A;  4LI1 A;  1H6T A;  4AY9 X;  3RW6 A;  4GLP A;  2OMW A;  4MN8 B;  1OTO A;  5B0N A;  4U09 A;  3KJ4 A;  2ELL A;  3G04 C;  4LI2 A;  4CIL A;  5HDH A;  3VQ1 A;  4OQT A;  2IFG A;  5GS2 B;  4Z8G A;  3ULU A;  3CIG A;  2OMV A;  4Z94 G;  3G06 A;  5AZ5 A;  5D3I A;  4PQ8 A;  1A4Y A;  3GOZ A;  5A5C A;  4M7E A;  2Z7X A;  2ASS B;  1PGV A;  2OMY A;  3W3K A;  1QYY A;  1KOO A;  4R6G A;  4G8A A;  3E2J A;  4P8S A;  4PSJ A;  5B0T A;  1O6S A;  4R5C A;  3RJ0 A;  3A79 B;  1O6V A;  4C2B B;  5IJB A;  1P9A G;  4U06 A;  4NZT M;  1O6T A;  4FMZ A;  2JE1 A;  4WP6 A;  2P1O B;  2O6S A;  2JE0 A;  3UN9 A;  3RGX A;  4IM6 A;  3W3G A;  5AWD A;  3G3A A;  1DCE A;  4NKH A;  5CMN A;  3CIY A;  3E3Z A;  1XCD A;  2OMT A;  4GT6 A;  3O53 A;  3OGL B;  3RIZ A;  1ZIW A;  2OMX A;  3ZYJ A;  1P8V A;  3FXI A;  4ARN A;  1M10 B;  2BEX A;  4BSS A;  3W3M A;  2Z7X B;  3JB9 j;  1P8T A;  4V2D A;  4ECN A;  3UL7 A;  4AW4 A;  4NZR M;  4QC0 A;  1IO0 A;  2RR6 A;  1H6U A;  3W3J A;  4FCG A;  1OTN A;  4EZG A;  1DS9 A;  2WQV A;  4H09 A;  3ZYI A;  4FHO A;  1XEU A;  4MQW X;  4R07 A;  4UFR A;  3W3N A;  1KOH A;  2XOT A;  1YRG A;  3W3L A;  5FTT B;  2Z65 A;  2RA8 A;  1W8A A;  2Z64 A;  4QBZ A;  5HZL B;  2Q4G W;  4FS7 A;  3ZYN A;  4LXS A;  3WPD A;  4LSX C;  4KT1 A;  1M9S A;  4RCW A;  2Z62 A;  2JQD A;  3C6N B;  1SQ0 B;  4RCA B;  4ECO A;  4P91 A;  4XGO A;  3ULV A;  5GMF A;  1K5G C;  1DFJ I;  1K5D C;  3E4G A;  4V2C A;  1JL5 A;  3UL8 A;  3WPB A;  5AWA A;  2XWT C;  4PEQ B;  4L3A A;  3REZ A;  5GQR K;  4CC4 A;  4BSU A;  3SB4 A;  3OJA A;  2WQW A;  3G39 A;  4B8C D;  1FS2 A;  3G3B A;  4PKI G; 
#chains in the Genus database with same CATH homology
 3M18 A;  4Y61 B;  2Z82 A;  3RFS A;  3BZ5 A;  3E6J A;  4NKG A;  3O6N A;  1OGQ A;  4C2A B;  4WYK A;  4BSR A;  4L3F A;  4PER A;  4LSA A;  4YEB B;  2UZX A;  4I6J B;  4LXR A;  1U0N D;  3WPG A;  1M0Z A;  2O6R A;  2V9T B;  2Y5Q A;  3RW7 A;  1OOK G;  4M7E C;  1LTX A;  2P1N B;  4R6A A;  2Z63 A;  4R58 A;  1A9N A;  2V70 A;  1OZN A;  2ID5 A;  3OJA B;  3WPC A;  4V2E A;  4CNM A;  4KNG A;  2FT3 A;  4ARR A;  2Z66 A;  4XOS A;  3TSR E;  5GS0 A;  3ZYO A;  4U7L A;  4CC4 C;  2CA6 A;  2P1Q B;  4CNC A;  4Q3G A;  3VQ2 A;  1FT8 A;  5B4P A;  2BNH A;  5LFN A;  4Z79 A;  3WN4 A;  1FQV A;  2A0Z A;  3ULA A;  5GMG A;  5AWB A;  3WPE A;  3UL9 A;  4R5D A;  3C6O B;  2Z81 A;  1Z7X W;  4R6F A;  4BV4 R;  4Q3I A;  5IJC A;  1FO1 A;  4R08 A;  4XSQ A;  3RFJ A;  4RWT C;  2UZY A;  2OMZ A;  1GWB A;  4Q62 A;  1OTM A;  3OGK B;  5AWC A;  5CMP A;  2P1M B;  2WFH A;  3CVR A;  4LSC A;  3PMH G;  3WPH A;  2O6Q A;  2AST B;  1XEC A;  1G9U A;  3RGZ A;  4Z64 C;  4FD0 A;  4U08 A;  3RFE A;  5GMH A;  1D0B A;  5IYX C;  2OMU A;  4FDW A;  4LSX A;  4TZH A;  3M19 A;  4J4L A;  1XWD C;  2P1P B;  1M9L A;  2WQU A;  4QXE A;  4HQ1 A;  4CP6 A;  3WPF A;  1WWL A;  4KXF B;  4R6J A;  4K17 A;  2R9U A;  3C6P B;  4Z61 C;  2WQX A;  4R0A A;  4R09 A;  3DZE A;  5IJD A;  4J0M A;  3OGM B;  3P72 A;  2V9S A;  1XKU A;  3WPI A;  4LI1 A;  1H6T A;  4AY9 X;  3RW6 A;  4GLP A;  2OMW A;  4MN8 B;  1OTO A;  5B0N A;  4U09 A;  3KJ4 A;  2ELL A;  3G04 C;  4LI2 A;  4CIL A;  5HDH A;  3VQ1 A;  4OQT A;  2IFG A;  5GS2 B;  4Z8G A;  3ULU A;  3CIG A;  2OMV A;  4Z94 G;  3G06 A;  5AZ5 A;  5D3I A;  4PQ8 A;  1A4Y A;  3GOZ A;  5A5C A;  4M7E A;  2Z7X A;  2ASS B;  1PGV A;  2OMY A;  3W3K A;  1QYY A;  1KOO A;  4R6G A;  4G8A A;  3E2J A;  4P8S A;  4PSJ A;  5B0T A;  1O6S A;  4R5C A;  3RJ0 A;  3A79 B;  1O6V A;  4C2B B;  5IJB A;  1P9A G;  4U06 A;  1O6T A;  4FMZ A;  2JE1 A;  4WP6 A;  2P1O B;  2O6S A;  2JE0 A;  3UN9 A;  3RGX A;  4IM6 A;  3W3G A;  5AWD A;  3G3A A;  1DCE A;  4NKH A;  5CMN A;  3CIY A;  3E3Z A;  1XCD A;  2OMT A;  4GT6 A;  3O53 A;  3OGL B;  3RIZ A;  1ZIW A;  2OMX A;  3ZYJ A;  1P8V A;  3FXI A;  4ARN A;  1M10 B;  2BEX A;  4BSS A;  3W3M A;  2Z7X B;  3JB9 j;  1P8T A;  4V2D A;  4ECN A;  3UL7 A;  4AW4 A;  4QC0 A;  1IO0 A;  2RR6 A;  1H6U A;  3W3J A;  4FCG A;  1OTN A;  4EZG A;  1DS9 A;  2WQV A;  4H09 A;  3ZYI A;  4FHO A;  1XEU A;  4MQW X;  4R07 A;  4UFR A;  3W3N A;  1KOH A;  2XOT A;  1YRG A;  3W3L A;  5FTT B;  2Z65 A;  2RA8 A;  1W8A A;  2Z64 A;  4QBZ A;  5HZL B;  2Q4G W;  4FS7 A;  3ZYN A;  4LXS A;  3WPD A;  4LSX C;  4KT1 A;  1M9S A;  4RCW A;  2Z62 A;  2JQD A;  3C6N B;  1SQ0 B;  4RCA B;  4ECO A;  4P91 A;  4XGO A;  3ULV A;  5GMF A;  1K5G C;  1DFJ I;  1K5D C;  3E4G A;  4V2C A;  1JL5 A;  3UL8 A;  3WPB A;  5AWA A;  2XWT C;  4PEQ B;  4L3A A;  3REZ A;  5GQR K;  4CC4 A;  4BSU A;  3SB4 A;  3OJA A;  2WQW A;  3G39 A;  4B8C D;  1FS2 A;  3G3B A;  4PKI G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...