1W8AA

Third lrr domain of drosophila slit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
189
Chain Sequence
DCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords SLIT PROTEIN
publication title Binding Site for Robo Receptors Revealed by Dissection of the Leucine-Rich Repeat Region of Slit.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 51
structure length 189
sequence length 192
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF01463 LRRCT Leucine rich repeat C-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1w8aA00
4NKGA 2UZXA 2WQXA 4QBZA 4R58A 5B0NA 4J4LA 4L3FA 4P8SA 4RWTC 1OOKG 4HQ1A 1WWLA 3WPFA 3KJ4A 4ECNA 1OTOA 2WFHA 4J0MA 2V9TB 3G04C 5GS0A 4PEQB 5HZLB 3RJ0A 2JE0A 5FTTB 1A4YA 4AY9X 1SQ0B 3PMHG 5D3IA 3ZYOA 5IJCA 3JB9j 5AWBA 4CNCA 3UL9A 3W3GA 3M18A 2UZYA 1DCEA 4G8AA 1M9LA 2O6QA 2OMYA 3OGLB 1GWBA 4PSJA 5CMNA 3P72A 1P8VA 4FDWA 2ASTB 2Z63A 4ECOA 1M9SA 4Q62A 4XGOA 2ID5A 4R6JA 3GOZA 3REZA 4LSCA 3CIGA 4FCGA 5HDHA 4Z64C 3WPIA 1K5GC 1LTXA 1FS2A 2IFGA 4L3AA 4Z79A 1OZNA 1H6TA 1DFJI 1M0ZA 1XCDA 2Z7XB 4R09A 3ZYNA 5GMHA 2BNHA 3OJAB 4TZHA 1P9AG 2Y5QA 2JE1A 3O53A 4Z61C 4LXSA 4MQWX 3BZ5A 4ARRA 4LXRA 3W3LA 4QC0A 2P1MB 4PKIG 4C2AB 5B4PA 4LSAA 4B8CD 4WYKA 3RGZA 1O6TA 4XOSA 4ARNA 5B0TA 4FHOA 3SB4A 2O6RA 1Z7XW 2P1PB 4R6AA 4P91A 4FD0A 2Z64A 3ZYJA 4CNMA 4R0AA 4UFRA 3ULUA 2RR6A 1OTNA 2FT3A 4XSQA 3C6PB 3RGXA 4OQTA 4Z94G 2RA8A 3WPGA 4BV4R 1O6VA 4YEBB 1H6UA 4K17A 3W3MA 3ZYIA 3WPCA 3C6OB 2Q4GW 3TSRE 2OMXA 2P1NB 4R07A 2R9UA 4R08A 3G3BA 3RFJA 3W3KA 4Q3IA 3UN9A 1XEUA 5AZ5A 2XWTC 4R5DA 4U09A 3RFSA 4PERA 4WP6A 2WQVA 2Z66A 5LFNA 5GS2B 4CILA 3W3NA 5IYXC 2O6SA 4U08A 1O6SA 4CP6A 1OGQA 5AWCA 3E2JA 1DS9A 2CA6A 4KT1A 1W8AA 3VQ2A 3G39A 2V70A 4QXEA 2OMTA 1OTMA 1M10B 3UL8A 1FQVA 1FO1A 1G9UA 5CMPA 5GMFA 2A0ZA 2OMWA 1KOHA 1XECA 3RW7A 1YRGA 3E4GA 1U0ND 3ULVA 3M19A 2V9SA 2Z65A 3C6NB 4CC4A 4LSXC 4R6FA 4H09A 2ASSB 3WPHA 4FS7A 1K5DC 1FT8A 3CIYA 4KXFB 3RW6A 3WPDA 4V2DA 3WPBA 1QYYA 2P1OB 4Z8GA 4KNGA 4PQ8A 1KOOA 4NKHA 3RIZA 1D0BA 4Y61B 4U06A 4EZGA 4CC4C 3WN4A 4C2BB 4BSUA 5AWDA 2XOTA 4V2EA 2WQUA 3FXIA 4MN8B 5GQRK 2OMZA 4LI2A 1PGVA 2JQDA 3E3ZA 1XKUA 3O6NA 3G06A 2Z82A 4M7EA 2BEXA 4GLPA 2Z81A 5IJDA 2Z7XA 3OGMB 2WQWA 2Z62A 3DZEA 3VQ1A 3G3AA 3OJAA 2ELLA 4U7LA 5IJBA 1IO0A 4GT6A 4RCAB 3E6JA 4R6GA 3ULAA 5A5CA 3W3JA 3CVRA 3A79B 3OGKB 5GMGA 3WPEA 4M7EC 4FMZA 2OMUA 4AW4A 4LSXA 4I6JB 4V2CA 1JL5A 4LI1A 4Q3GA 4BSSA 5AWAA 1A9NA 2OMVA 1P8TA 4RCWA 4BSRA 1ZIWA 1XWDC 4R5CA 3UL7A 3RFEA 4IM6A 2P1QB
chains in the Genus database with same CATH superfamily
4NKGA 2UZXA 2WQXA 4QBZA 4R58A 5B0NA 4J4LA 4L3FA 4P8SA 4NZTM 4RWTC 1OOKG 4HQ1A 1WWLA 3WPFA 3KJ4A 4ECNA 1OTOA 2WFHA 4J0MA 2V9TB 3G04C 5GS0A 4PEQB 5HZLB 3RJ0A 2JE0A 5FTTB 1A4YA 4AY9X 1SQ0B 3PMHG 5D3IA 3ZYOA 5IJCA 3JB9j 5AWBA 4CNCA 3UL9A 3W3GA 3M18A 2UZYA 1DCEA 4G8AA 1M9LA 2O6QA 2OMYA 3OGLB 1GWBA 4PSJA 5CMNA 3P72A 1P8VA 4FDWA 2ASTB 2Z63A 4ECOA 1M9SA 4Q62A 4XGOA 2ID5A 4NZRM 4R6JA 3GOZA 3REZA 4LSCA 3CIGA 4FCGA 5HDHA 4Z64C 3WPIA 1K5GC 1LTXA 1FS2A 2IFGA 4L3AA 4Z79A 1OZNA 1H6TA 1DFJI 1M0ZA 1XCDA 2Z7XB 4R09A 3ZYNA 5GMHA 2BNHA 3OJAB 4TZHA 1P9AG 2Y5QA 2JE1A 3O53A 4Z61C 4LXSA 4MQWX 3BZ5A 4ARRA 4LXRA 3W3LA 4QC0A 2P1MB 4PKIG 4C2AB 5B4PA 4LSAA 4B8CD 4WYKA 3RGZA 1O6TA 4XOSA 4ARNA 5B0TA 4FHOA 3SB4A 2O6RA 1Z7XW 2P1PB 4R6AA 4P91A 4FD0A 2Z64A 3ZYJA 4CNMA 4R0AA 4UFRA 3ULUA 2RR6A 1OTNA 2FT3A 4XSQA 3C6PB 3RGXA 4OQTA 4Z94G 2RA8A 3WPGA 4BV4R 1O6VA 4YEBB 1H6UA 4K17A 3W3MA 3ZYIA 3WPCA 3C6OB 2Q4GW 3TSRE 2OMXA 2P1NB 4R07A 2R9UA 4R08A 3G3BA 3RFJA 3W3KA 4Q3IA 3UN9A 1XEUA 5AZ5A 2XWTC 4R5DA 4U09A 3RFSA 4PERA 4WP6A 2WQVA 2Z66A 5LFNA 5GS2B 4CILA 3W3NA 5IYXC 2O6SA 4U08A 1O6SA 4CP6A 1OGQA 5AWCA 3E2JA 1DS9A 2CA6A 4KT1A 1W8AA 3VQ2A 3G39A 2V70A 4QXEA 2OMTA 1OTMA 1M10B 3UL8A 1FQVA 1FO1A 1G9UA 5CMPA 5GMFA 2A0ZA 2OMWA 1KOHA 1XECA 3RW7A 1YRGA 3E4GA 1U0ND 3ULVA 3M19A 2V9SA 2Z65A 3C6NB 4CC4A 4LSXC 4R6FA 4H09A 2ASSB 3WPHA 4FS7A 1K5DC 1FT8A 3CIYA 4KXFB 3RW6A 3WPDA 4V2DA 3WPBA 1QYYA 2P1OB 4Z8GA 4KNGA 4PQ8A 1KOOA 4NKHA 3RIZA 1D0BA 4Y61B 4U06A 4EZGA 4CC4C 3WN4A 4C2BB 4BSUA 5AWDA 2XOTA 4V2EA 2WQUA 3FXIA 4MN8B 5GQRK 2OMZA 4LI2A 1PGVA 2JQDA 3E3ZA 1XKUA 3O6NA 3G06A 2Z82A 4M7EA 2BEXA 4GLPA 2Z81A 5IJDA 2Z7XA 3OGMB 2WQWA 2Z62A 3DZEA 3VQ1A 3G3AA 3OJAA 2ELLA 4U7LA 5IJBA 1IO0A 4GT6A 4RCAB 3E6JA 4R6GA 3ULAA 5A5CA 3W3JA 3CVRA 3A79B 3OGKB 5GMGA 3WPEA 4M7EC 4FMZA 2OMUA 4AW4A 4LSXA 4I6JB 4V2CA 1JL5A 4LI1A 4Q3GA 4BSSA 5AWAA 1A9NA 2OMVA 1P8TA 4RCWA 4BSRA 1ZIWA 1XWDC 4R5CA 3UL7A 3RFEA 4IM6A 2P1QB
chains in the Genus database with same CATH topology
4NKGA 2UZXA 2WQXA 4QBZA 4R58A 5B0NA 4J4LA 4L3FA 4P8SA 4RWTC 1OOKG 4HQ1A 1WWLA 3WPFA 3KJ4A 4ECNA 1OTOA 2WFHA 4J0MA 2V9TB 3G04C 5GS0A 4PEQB 5HZLB 3RJ0A 2JE0A 5FTTB 1A4YA 4AY9X 1SQ0B 3PMHG 5D3IA 3ZYOA 5IJCA 3JB9j 5AWBA 4CNCA 3UL9A 3W3GA 3M18A 2UZYA 1DCEA 4G8AA 1M9LA 2O6QA 2OMYA 3OGLB 1GWBA 4PSJA 5CMNA 3P72A 1P8VA 4FDWA 2ASTB 2Z63A 4ECOA 1M9SA 4Q62A 4XGOA 2ID5A 4R6JA 3GOZA 3REZA 4LSCA 3CIGA 4FCGA 5HDHA 4Z64C 3WPIA 1K5GC 1LTXA 1FS2A 2IFGA 4L3AA 4Z79A 1OZNA 1H6TA 1DFJI 1M0ZA 1XCDA 2Z7XB 4R09A 3ZYNA 5GMHA 2BNHA 3OJAB 4TZHA 1P9AG 2Y5QA 2JE1A 3O53A 4Z61C 4LXSA 4MQWX 3BZ5A 4ARRA 4LXRA 3W3LA 4QC0A 2P1MB 4PKIG 4C2AB 5B4PA 4LSAA 4B8CD 4WYKA 3RGZA 1O6TA 4XOSA 4ARNA 5B0TA 4FHOA 3SB4A 2O6RA 1Z7XW 2P1PB 4R6AA 4P91A 4FD0A 2Z64A 3ZYJA 4CNMA 4R0AA 4UFRA 3ULUA 2RR6A 1OTNA 2FT3A 4XSQA 3C6PB 3RGXA 4OQTA 4Z94G 2RA8A 3WPGA 4BV4R 1O6VA 4YEBB 1H6UA 4K17A 3W3MA 3ZYIA 3WPCA 3C6OB 2Q4GW 3TSRE 2OMXA 2P1NB 4R07A 2R9UA 4R08A 3G3BA 3RFJA 3W3KA 4Q3IA 3UN9A 1XEUA 5AZ5A 2XWTC 4R5DA 4U09A 3RFSA 4PERA 4WP6A 2WQVA 2Z66A 5LFNA 5GS2B 4CILA 3W3NA 5IYXC 2O6SA 4U08A 1O6SA 4CP6A 1OGQA 5AWCA 3E2JA 1DS9A 2CA6A 4KT1A 1W8AA 3VQ2A 3G39A 2V70A 4QXEA 2OMTA 1OTMA 1M10B 3UL8A 1FQVA 1FO1A 1G9UA 5CMPA 5GMFA 2A0ZA 2OMWA 1KOHA 1XECA 3RW7A 1YRGA 3E4GA 1U0ND 3ULVA 3M19A 2V9SA 2Z65A 3C6NB 4CC4A 4LSXC 4R6FA 4H09A 2ASSB 3WPHA 4FS7A 1K5DC 1FT8A 3CIYA 4KXFB 3RW6A 3WPDA 4V2DA 3WPBA 1QYYA 2P1OB 4Z8GA 4KNGA 4PQ8A 1KOOA 4NKHA 3RIZA 1D0BA 4Y61B 4U06A 4EZGA 4CC4C 3WN4A 4C2BB 4BSUA 5AWDA 2XOTA 4V2EA 2WQUA 3FXIA 4MN8B 5GQRK 2OMZA 4LI2A 1PGVA 2JQDA 3E3ZA 1XKUA 3O6NA 3G06A 2Z82A 4M7EA 2BEXA 4GLPA 2Z81A 5IJDA 2Z7XA 3OGMB 2WQWA 2Z62A 3DZEA 3VQ1A 3G3AA 3OJAA 2ELLA 4U7LA 5IJBA 1IO0A 4GT6A 4RCAB 3E6JA 4R6GA 3ULAA 5A5CA 3W3JA 3CVRA 3A79B 3OGKB 5GMGA 3WPEA 4M7EC 4FMZA 2OMUA 4AW4A 4LSXA 4I6JB 4V2CA 1JL5A 4LI1A 4Q3GA 4BSSA 5AWAA 1A9NA 2OMVA 1P8TA 4RCWA 4BSRA 1ZIWA 1XWDC 4R5CA 3UL7A 3RFEA 4IM6A 2P1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKG A;  2UZX A;  2WQX A;  4QBZ A;  4R58 A;  5B0N A;  4J4L A;  4L3F A;  4P8S A;  4RWT C;  1OOK G;  4HQ1 A;  1WWL A;  3WPF A;  3KJ4 A;  4ECN A;  1OTO A;  2WFH A;  4J0M A;  2V9T B;  3G04 C;  5GS0 A;  4PEQ B;  5HZL B;  3RJ0 A;  2JE0 A;  5FTT B;  1A4Y A;  4AY9 X;  1SQ0 B;  3PMH G;  5D3I A;  3ZYO A;  5IJC A;  3JB9 j;  5AWB A;  4CNC A;  3UL9 A;  3W3G A;  3M18 A;  2UZY A;  1DCE A;  4G8A A;  1M9L A;  2O6Q A;  2OMY A;  3OGL B;  1GWB A;  4PSJ A;  5CMN A;  3P72 A;  1P8V A;  4FDW A;  2AST B;  2Z63 A;  4ECO A;  1M9S A;  4Q62 A;  4XGO A;  2ID5 A;  4R6J A;  3GOZ A;  3REZ A;  4LSC A;  3CIG A;  4FCG A;  5HDH A;  4Z64 C;  3WPI A;  1K5G C;  1LTX A;  1FS2 A;  2IFG A;  4L3A A;  4Z79 A;  1OZN A;  1H6T A;  1DFJ I;  1M0Z A;  1XCD A;  2Z7X B;  4R09 A;  3ZYN A;  5GMH A;  2BNH A;  3OJA B;  4TZH A;  1P9A G;  2Y5Q A;  2JE1 A;  3O53 A;  4Z61 C;  4LXS A;  4MQW X;  3BZ5 A;  4ARR A;  4LXR A;  3W3L A;  4QC0 A;  2P1M B;  4PKI G;  4C2A B;  5B4P A;  4LSA A;  4B8C D;  4WYK A;  3RGZ A;  1O6T A;  4XOS A;  4ARN A;  5B0T A;  4FHO A;  3SB4 A;  2O6R A;  1Z7X W;  2P1P B;  4R6A A;  4P91 A;  4FD0 A;  2Z64 A;  3ZYJ A;  4CNM A;  4R0A A;  4UFR A;  3ULU A;  2RR6 A;  1OTN A;  2FT3 A;  4XSQ A;  3C6P B;  3RGX A;  4OQT A;  4Z94 G;  2RA8 A;  3WPG A;  4BV4 R;  1O6V A;  4YEB B;  1H6U A;  4K17 A;  3W3M A;  3ZYI A;  3WPC A;  3C6O B;  2Q4G W;  3TSR E;  2OMX A;  2P1N B;  4R07 A;  2R9U A;  4R08 A;  3G3B A;  3RFJ A;  3W3K A;  4Q3I A;  3UN9 A;  1XEU A;  5AZ5 A;  2XWT C;  4R5D A;  4U09 A;  3RFS A;  4PER A;  4WP6 A;  2WQV A;  2Z66 A;  5LFN A;  5GS2 B;  4CIL A;  3W3N A;  5IYX C;  2O6S A;  4U08 A;  1O6S A;  4CP6 A;  1OGQ A;  5AWC A;  3E2J A;  1DS9 A;  2CA6 A;  4KT1 A;  1W8A A;  3VQ2 A;  3G39 A;  2V70 A;  4QXE A;  2OMT A;  1OTM A;  1M10 B;  3UL8 A;  1FQV A;  1FO1 A;  1G9U A;  5CMP A;  5GMF A;  2A0Z A;  2OMW A;  1KOH A;  1XEC A;  3RW7 A;  1YRG A;  3E4G A;  1U0N D;  3ULV A;  3M19 A;  2V9S A;  2Z65 A;  3C6N B;  4CC4 A;  4LSX C;  4R6F A;  4H09 A;  2ASS B;  3WPH A;  4FS7 A;  1K5D C;  1FT8 A;  3CIY A;  4KXF B;  3RW6 A;  3WPD A;  4V2D A;  3WPB A;  1QYY A;  2P1O B;  4Z8G A;  4KNG A;  4PQ8 A;  1KOO A;  4NKH A;  3RIZ A;  1D0B A;  4Y61 B;  4U06 A;  4EZG A;  4CC4 C;  3WN4 A;  4C2B B;  4BSU A;  5AWD A;  2XOT A;  4V2E A;  2WQU A;  3FXI A;  4MN8 B;  5GQR K;  2OMZ A;  4LI2 A;  1PGV A;  2JQD A;  3E3Z A;  1XKU A;  3O6N A;  3G06 A;  2Z82 A;  4M7E A;  2BEX A;  4GLP A;  2Z81 A;  5IJD A;  2Z7X A;  3OGM B;  2WQW A;  2Z62 A;  3DZE A;  3VQ1 A;  3G3A A;  3OJA A;  2ELL A;  4U7L A;  5IJB A;  1IO0 A;  4GT6 A;  4RCA B;  3E6J A;  4R6G A;  3ULA A;  5A5C A;  3W3J A;  3CVR A;  3A79 B;  3OGK B;  5GMG A;  3WPE A;  4M7E C;  4FMZ A;  2OMU A;  4AW4 A;  4LSX A;  4I6J B;  4V2C A;  1JL5 A;  4LI1 A;  4Q3G A;  4BSS A;  5AWA A;  1A9N A;  2OMV A;  1P8T A;  4RCW A;  4BSR A;  1ZIW A;  1XWD C;  4R5C A;  3UL7 A;  3RFE A;  4IM6 A;  2P1Q B; 
#chains in the Genus database with same CATH topology
 4NKG A;  2UZX A;  2WQX A;  4QBZ A;  4R58 A;  5B0N A;  4J4L A;  4L3F A;  4P8S A;  4NZT M;  4RWT C;  1OOK G;  4HQ1 A;  1WWL A;  3WPF A;  3KJ4 A;  4ECN A;  1OTO A;  2WFH A;  4J0M A;  2V9T B;  3G04 C;  5GS0 A;  4PEQ B;  5HZL B;  3RJ0 A;  2JE0 A;  5FTT B;  1A4Y A;  4AY9 X;  1SQ0 B;  3PMH G;  5D3I A;  3ZYO A;  5IJC A;  3JB9 j;  5AWB A;  4CNC A;  3UL9 A;  3W3G A;  3M18 A;  2UZY A;  1DCE A;  4G8A A;  1M9L A;  2O6Q A;  2OMY A;  3OGL B;  1GWB A;  4PSJ A;  5CMN A;  3P72 A;  1P8V A;  4FDW A;  2AST B;  2Z63 A;  4ECO A;  1M9S A;  4Q62 A;  4XGO A;  2ID5 A;  4NZR M;  4R6J A;  3GOZ A;  3REZ A;  4LSC A;  3CIG A;  4FCG A;  5HDH A;  4Z64 C;  3WPI A;  1K5G C;  1LTX A;  1FS2 A;  2IFG A;  4L3A A;  4Z79 A;  1OZN A;  1H6T A;  1DFJ I;  1M0Z A;  1XCD A;  2Z7X B;  4R09 A;  3ZYN A;  5GMH A;  2BNH A;  3OJA B;  4TZH A;  1P9A G;  2Y5Q A;  2JE1 A;  3O53 A;  4Z61 C;  4LXS A;  4MQW X;  3BZ5 A;  4ARR A;  4LXR A;  3W3L A;  4QC0 A;  2P1M B;  4PKI G;  4C2A B;  5B4P A;  4LSA A;  4B8C D;  4WYK A;  3RGZ A;  1O6T A;  4XOS A;  4ARN A;  5B0T A;  4FHO A;  3SB4 A;  2O6R A;  1Z7X W;  2P1P B;  4R6A A;  4P91 A;  4FD0 A;  2Z64 A;  3ZYJ A;  4CNM A;  4R0A A;  4UFR A;  3ULU A;  2RR6 A;  1OTN A;  2FT3 A;  4XSQ A;  3C6P B;  3RGX A;  4OQT A;  4Z94 G;  2RA8 A;  3WPG A;  4BV4 R;  1O6V A;  4YEB B;  1H6U A;  4K17 A;  3W3M A;  3ZYI A;  3WPC A;  3C6O B;  2Q4G W;  3TSR E;  2OMX A;  2P1N B;  4R07 A;  2R9U A;  4R08 A;  3G3B A;  3RFJ A;  3W3K A;  4Q3I A;  3UN9 A;  1XEU A;  5AZ5 A;  2XWT C;  4R5D A;  4U09 A;  3RFS A;  4PER A;  4WP6 A;  2WQV A;  2Z66 A;  5LFN A;  5GS2 B;  4CIL A;  3W3N A;  5IYX C;  2O6S A;  4U08 A;  1O6S A;  4CP6 A;  1OGQ A;  5AWC A;  3E2J A;  1DS9 A;  2CA6 A;  4KT1 A;  1W8A A;  3VQ2 A;  3G39 A;  2V70 A;  4QXE A;  2OMT A;  1OTM A;  1M10 B;  3UL8 A;  1FQV A;  1FO1 A;  1G9U A;  5CMP A;  5GMF A;  2A0Z A;  2OMW A;  1KOH A;  1XEC A;  3RW7 A;  1YRG A;  3E4G A;  1U0N D;  3ULV A;  3M19 A;  2V9S A;  2Z65 A;  3C6N B;  4CC4 A;  4LSX C;  4R6F A;  4H09 A;  2ASS B;  3WPH A;  4FS7 A;  1K5D C;  1FT8 A;  3CIY A;  4KXF B;  3RW6 A;  3WPD A;  4V2D A;  3WPB A;  1QYY A;  2P1O B;  4Z8G A;  4KNG A;  4PQ8 A;  1KOO A;  4NKH A;  3RIZ A;  1D0B A;  4Y61 B;  4U06 A;  4EZG A;  4CC4 C;  3WN4 A;  4C2B B;  4BSU A;  5AWD A;  2XOT A;  4V2E A;  2WQU A;  3FXI A;  4MN8 B;  5GQR K;  2OMZ A;  4LI2 A;  1PGV A;  2JQD A;  3E3Z A;  1XKU A;  3O6N A;  3G06 A;  2Z82 A;  4M7E A;  2BEX A;  4GLP A;  2Z81 A;  5IJD A;  2Z7X A;  3OGM B;  2WQW A;  2Z62 A;  3DZE A;  3VQ1 A;  3G3A A;  3OJA A;  2ELL A;  4U7L A;  5IJB A;  1IO0 A;  4GT6 A;  4RCA B;  3E6J A;  4R6G A;  3ULA A;  5A5C A;  3W3J A;  3CVR A;  3A79 B;  3OGK B;  5GMG A;  3WPE A;  4M7E C;  4FMZ A;  2OMU A;  4AW4 A;  4LSX A;  4I6J B;  4V2C A;  1JL5 A;  4LI1 A;  4Q3G A;  4BSS A;  5AWA A;  1A9N A;  2OMV A;  1P8T A;  4RCW A;  4BSR A;  1ZIW A;  1XWD C;  4R5C A;  3UL7 A;  3RFE A;  4IM6 A;  2P1Q B; 
#chains in the Genus database with same CATH homology
 4NKG A;  2UZX A;  2WQX A;  4QBZ A;  4R58 A;  5B0N A;  4J4L A;  4L3F A;  4P8S A;  4RWT C;  1OOK G;  4HQ1 A;  1WWL A;  3WPF A;  3KJ4 A;  4ECN A;  1OTO A;  2WFH A;  4J0M A;  2V9T B;  3G04 C;  5GS0 A;  4PEQ B;  5HZL B;  3RJ0 A;  2JE0 A;  5FTT B;  1A4Y A;  4AY9 X;  1SQ0 B;  3PMH G;  5D3I A;  3ZYO A;  5IJC A;  3JB9 j;  5AWB A;  4CNC A;  3UL9 A;  3W3G A;  3M18 A;  2UZY A;  1DCE A;  4G8A A;  1M9L A;  2O6Q A;  2OMY A;  3OGL B;  1GWB A;  4PSJ A;  5CMN A;  3P72 A;  1P8V A;  4FDW A;  2AST B;  2Z63 A;  4ECO A;  1M9S A;  4Q62 A;  4XGO A;  2ID5 A;  4R6J A;  3GOZ A;  3REZ A;  4LSC A;  3CIG A;  4FCG A;  5HDH A;  4Z64 C;  3WPI A;  1K5G C;  1LTX A;  1FS2 A;  2IFG A;  4L3A A;  4Z79 A;  1OZN A;  1H6T A;  1DFJ I;  1M0Z A;  1XCD A;  2Z7X B;  4R09 A;  3ZYN A;  5GMH A;  2BNH A;  3OJA B;  4TZH A;  1P9A G;  2Y5Q A;  2JE1 A;  3O53 A;  4Z61 C;  4LXS A;  4MQW X;  3BZ5 A;  4ARR A;  4LXR A;  3W3L A;  4QC0 A;  2P1M B;  4PKI G;  4C2A B;  5B4P A;  4LSA A;  4B8C D;  4WYK A;  3RGZ A;  1O6T A;  4XOS A;  4ARN A;  5B0T A;  4FHO A;  3SB4 A;  2O6R A;  1Z7X W;  2P1P B;  4R6A A;  4P91 A;  4FD0 A;  2Z64 A;  3ZYJ A;  4CNM A;  4R0A A;  4UFR A;  3ULU A;  2RR6 A;  1OTN A;  2FT3 A;  4XSQ A;  3C6P B;  3RGX A;  4OQT A;  4Z94 G;  2RA8 A;  3WPG A;  4BV4 R;  1O6V A;  4YEB B;  1H6U A;  4K17 A;  3W3M A;  3ZYI A;  3WPC A;  3C6O B;  2Q4G W;  3TSR E;  2OMX A;  2P1N B;  4R07 A;  2R9U A;  4R08 A;  3G3B A;  3RFJ A;  3W3K A;  4Q3I A;  3UN9 A;  1XEU A;  5AZ5 A;  2XWT C;  4R5D A;  4U09 A;  3RFS A;  4PER A;  4WP6 A;  2WQV A;  2Z66 A;  5LFN A;  5GS2 B;  4CIL A;  3W3N A;  5IYX C;  2O6S A;  4U08 A;  1O6S A;  4CP6 A;  1OGQ A;  5AWC A;  3E2J A;  1DS9 A;  2CA6 A;  4KT1 A;  1W8A A;  3VQ2 A;  3G39 A;  2V70 A;  4QXE A;  2OMT A;  1OTM A;  1M10 B;  3UL8 A;  1FQV A;  1FO1 A;  1G9U A;  5CMP A;  5GMF A;  2A0Z A;  2OMW A;  1KOH A;  1XEC A;  3RW7 A;  1YRG A;  3E4G A;  1U0N D;  3ULV A;  3M19 A;  2V9S A;  2Z65 A;  3C6N B;  4CC4 A;  4LSX C;  4R6F A;  4H09 A;  2ASS B;  3WPH A;  4FS7 A;  1K5D C;  1FT8 A;  3CIY A;  4KXF B;  3RW6 A;  3WPD A;  4V2D A;  3WPB A;  1QYY A;  2P1O B;  4Z8G A;  4KNG A;  4PQ8 A;  1KOO A;  4NKH A;  3RIZ A;  1D0B A;  4Y61 B;  4U06 A;  4EZG A;  4CC4 C;  3WN4 A;  4C2B B;  4BSU A;  5AWD A;  2XOT A;  4V2E A;  2WQU A;  3FXI A;  4MN8 B;  5GQR K;  2OMZ A;  4LI2 A;  1PGV A;  2JQD A;  3E3Z A;  1XKU A;  3O6N A;  3G06 A;  2Z82 A;  4M7E A;  2BEX A;  4GLP A;  2Z81 A;  5IJD A;  2Z7X A;  3OGM B;  2WQW A;  2Z62 A;  3DZE A;  3VQ1 A;  3G3A A;  3OJA A;  2ELL A;  4U7L A;  5IJB A;  1IO0 A;  4GT6 A;  4RCA B;  3E6J A;  4R6G A;  3ULA A;  5A5C A;  3W3J A;  3CVR A;  3A79 B;  3OGK B;  5GMG A;  3WPE A;  4M7E C;  4FMZ A;  2OMU A;  4AW4 A;  4LSX A;  4I6J B;  4V2C A;  1JL5 A;  4LI1 A;  4Q3G A;  4BSS A;  5AWA A;  1A9N A;  2OMV A;  1P8T A;  4RCW A;  4BSR A;  1ZIW A;  1XWD C;  4R5C A;  3UL7 A;  3RFE A;  4IM6 A;  2P1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...