3RFSA

Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
molecule keywords Internalin B, repeat modules, Variable lymphocyte receptor B
total genus 81
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfsA00
3RW6A 3CIGA 4RCAB 4XOSA 3G3AA 4TZHA 4B8CD 2V9TB 4KT1A 3E6JA 4Q3IA 3CVRA 4YEBB 1KOHA 1M9SA 3C6NB 4C2AB 1A9NA 3O53A 4Q3GA 3ZYNA 5GMFA 2OMVA 1OTOA 5CMNA 3SB4A 1DFJI 1YRGA 4FD0A 4CC4C 4CC4A 4LI1A 1OZNA 2V9SA 4BV4R 2JE0A 3DZEA 3G39A 5B4PA 2Z65A 4R08A 5IJBA 2OMYA 3OGKB 2IFGA 3W3KA 2ASTB 2FT3A 2WQXA 3WPFA 2WQVA 3FXIA 4GLPA 4ARRA 1OGQA 2RA8A 5AZ5A 4MN8B 4L3FA 4L3AA 5GMHA 2P1OB 2ELLA 4G8AA 4R6JA 5AWDA 5GS0A 3W3NA 4LI2A 5D3IA 4AW4A 2JE1A 1O6SA 3WPHA 5GQRK 4Z94G 4M7EA 1XKUA 4FDWA 4J0MA 1H6UA 3RIZA 4ECNA 4QC0A 3RJ0A 4FS7A 2ASSB 3E4GA 4Y61B 5FTTB 4H09A 2V70A 3WPBA 3ZYIA 4U08A 1FQVA 4LSXC 2Z64A 4C2BB 1K5DC 4XSQA 5A5CA 3BZ5A 2Q4GW 1XECA 2Z7XA 5AWAA 3A79B 4WP6A 1H6TA 4PQ8A 3ZYOA 4EZGA 3G04C 3G3BA 3O6NA 1FS2A 5AWCA 3W3MA 4WYKA 2BEXA 3UL9A 2Z81A 4BSSA 1O6VA 4R6FA 1M9LA 2Z62A 2P1QB 4PEQB 2R9UA 4R09A 4Z8GA 3VQ2A 2BNHA 4R0AA 2RR6A 4U06A 1FO1A 3TSRE 5IJCA 5B0TA 2P1MB 2OMXA 4LXRA 3OGMB 3RGZA 1LTXA 5GS2B 4IM6A 2Z63A 1OTMA 4LXSA 3ULUA 4ARNA 2WQUA 4AY9X 2JQDA 3P72A 1SQ0B 1XEUA 4NKHA 3RGXA 4GT6A 3CIYA 1D0BA 4FMZA 3UN9A 4BSUA 3OJAB 4R07A 1U0ND 1OTNA 2O6QA 5B0NA 1DS9A 2WFHA 1OOKG 3GOZA 3W3LA 4NKGA 4RCWA 2WQWA 4QXEA 3WN4A 3E3ZA 1M0ZA 4MQWX 4R6GA 2XOTA 4U09A 4CILA 3WPEA 4OQTA 3VQ1A 1PGVA 5HZLB 4U7LA 2OMUA 1M10B 3PMHG 2OMWA 4R6AA 3RFEA 4Z61C 3WPDA 1GWBA 4FCGA 2P1NB 4CNMA 4CP6A 5CMPA 4BSRA 5HDHA 1XWDC 4LSCA 4PERA 2ID5A 4KNGA 3RFJA 4LSAA 1KOOA 1DCEA 1W8AA 4KXFB 3W3GA 3C6PB 3WPCA 4V2CA 3ULAA 5LFNA 3M19A 4I6JB 3UL8A 4R58A 2Z82A 3UL7A 2XWTC 5AWBA 3C6OB 3OGLB 5GMGA 4XGOA 2O6RA 3RW7A 1A4YA 3OJAA 2O6SA 4PSJA 3ULVA 1WWLA 4Z79A 1P9AG 1G9UA 2A0ZA 1Z7XW 4Z64C 4V2DA 2UZYA 4R5DA 2P1PB 3REZA 1P8VA 3ZYJA 4V2EA 1K5GC 2CA6A 4QBZA 5IYXC 2Z66A 5IJDA 4M7EC 3W3JA 4J4LA 4FHOA 4P8SA 2UZXA 1FT8A 4PKIG 4CNCA 1QYYA 1ZIWA 3M18A 2OMTA 3RFSA 2OMZA 4HQ1A 3WPGA 4R5CA 4P91A 1P8TA 1IO0A 2Z7XB 1O6TA 2Y5QA 3E2JA 1JL5A 3JB9j 3G06A 4LSXA 4Q62A 3WPIA 4K17A 3KJ4A 4ECOA 4RWTC 4UFRA 1XCDA
chains in the Genus database with same CATH superfamily
3RW6A 3CIGA 4RCAB 4XOSA 3G3AA 4TZHA 4B8CD 2V9TB 4KT1A 3E6JA 4Q3IA 3CVRA 4YEBB 1KOHA 1M9SA 3C6NB 4C2AB 1A9NA 3O53A 4Q3GA 3ZYNA 5GMFA 2OMVA 1OTOA 5CMNA 3SB4A 1DFJI 1YRGA 4FD0A 4CC4C 4CC4A 4LI1A 1OZNA 2V9SA 4BV4R 2JE0A 3DZEA 3G39A 5B4PA 2Z65A 4R08A 5IJBA 2OMYA 3OGKB 2IFGA 3W3KA 2ASTB 2FT3A 2WQXA 3WPFA 2WQVA 3FXIA 4GLPA 4ARRA 1OGQA 2RA8A 5AZ5A 4MN8B 4L3FA 4L3AA 5GMHA 2P1OB 2ELLA 4G8AA 4R6JA 5AWDA 5GS0A 3W3NA 4LI2A 5D3IA 4AW4A 2JE1A 1O6SA 3WPHA 5GQRK 4Z94G 4M7EA 1XKUA 4FDWA 4J0MA 1H6UA 3RIZA 4ECNA 4QC0A 3RJ0A 4FS7A 2ASSB 3E4GA 4Y61B 5FTTB 4H09A 2V70A 3WPBA 3ZYIA 4U08A 1FQVA 4LSXC 2Z64A 4C2BB 1K5DC 4XSQA 5A5CA 3BZ5A 2Q4GW 1XECA 2Z7XA 5AWAA 3A79B 4WP6A 1H6TA 4PQ8A 3ZYOA 4EZGA 3G04C 3G3BA 3O6NA 1FS2A 5AWCA 3W3MA 4WYKA 2BEXA 3UL9A 2Z81A 4BSSA 1O6VA 4R6FA 1M9LA 2Z62A 2P1QB 4PEQB 2R9UA 4R09A 4Z8GA 4NZTM 3VQ2A 2BNHA 4R0AA 2RR6A 4U06A 1FO1A 3TSRE 5IJCA 5B0TA 2P1MB 2OMXA 4LXRA 3OGMB 3RGZA 1LTXA 5GS2B 4IM6A 2Z63A 1OTMA 4LXSA 3ULUA 4ARNA 2WQUA 4AY9X 2JQDA 3P72A 1SQ0B 1XEUA 4NKHA 3RGXA 4GT6A 3CIYA 1D0BA 4FMZA 3UN9A 4BSUA 3OJAB 4R07A 1U0ND 1OTNA 2O6QA 5B0NA 1DS9A 2WFHA 1OOKG 3GOZA 3W3LA 4NKGA 4RCWA 2WQWA 4QXEA 3WN4A 3E3ZA 1M0ZA 4MQWX 4R6GA 2XOTA 4U09A 4CILA 3WPEA 4OQTA 3VQ1A 1PGVA 5HZLB 4U7LA 2OMUA 1M10B 3PMHG 2OMWA 4R6AA 3RFEA 4Z61C 3WPDA 1GWBA 4FCGA 2P1NB 4CNMA 4NZRM 4CP6A 5CMPA 4BSRA 5HDHA 1XWDC 4LSCA 4PERA 2ID5A 4KNGA 3RFJA 4LSAA 1KOOA 1DCEA 1W8AA 4KXFB 3W3GA 3C6PB 3WPCA 4V2CA 3ULAA 5LFNA 3M19A 4I6JB 3UL8A 4R58A 2Z82A 3UL7A 2XWTC 5AWBA 3C6OB 3OGLB 5GMGA 4XGOA 2O6RA 3RW7A 1A4YA 3OJAA 2O6SA 4PSJA 3ULVA 1WWLA 4Z79A 1P9AG 1G9UA 2A0ZA 1Z7XW 4Z64C 4V2DA 2UZYA 4R5DA 2P1PB 3REZA 1P8VA 3ZYJA 4V2EA 1K5GC 2CA6A 4QBZA 5IYXC 2Z66A 5IJDA 4M7EC 3W3JA 4J4LA 4FHOA 4P8SA 2UZXA 1FT8A 4PKIG 4CNCA 1QYYA 1ZIWA 3M18A 2OMTA 3RFSA 2OMZA 4HQ1A 3WPGA 4R5CA 4P91A 1P8TA 1IO0A 2Z7XB 1O6TA 2Y5QA 3E2JA 1JL5A 3JB9j 3G06A 4LSXA 4Q62A 3WPIA 4K17A 3KJ4A 4ECOA 4RWTC 4UFRA 1XCDA
chains in the Genus database with same CATH topology
3RW6A 3CIGA 4RCAB 4XOSA 3G3AA 4TZHA 4B8CD 2V9TB 4KT1A 3E6JA 4Q3IA 3CVRA 4YEBB 1KOHA 1M9SA 3C6NB 4C2AB 1A9NA 3O53A 4Q3GA 3ZYNA 5GMFA 2OMVA 1OTOA 5CMNA 3SB4A 1DFJI 1YRGA 4FD0A 4CC4C 4CC4A 4LI1A 1OZNA 2V9SA 4BV4R 2JE0A 3DZEA 3G39A 5B4PA 2Z65A 4R08A 5IJBA 2OMYA 3OGKB 2IFGA 3W3KA 2ASTB 2FT3A 2WQXA 3WPFA 2WQVA 3FXIA 4GLPA 4ARRA 1OGQA 2RA8A 5AZ5A 4MN8B 4L3FA 4L3AA 5GMHA 2P1OB 2ELLA 4G8AA 4R6JA 5AWDA 5GS0A 3W3NA 4LI2A 5D3IA 4AW4A 2JE1A 1O6SA 3WPHA 5GQRK 4Z94G 4M7EA 1XKUA 4FDWA 4J0MA 1H6UA 3RIZA 4ECNA 4QC0A 3RJ0A 4FS7A 2ASSB 3E4GA 4Y61B 5FTTB 4H09A 2V70A 3WPBA 3ZYIA 4U08A 1FQVA 4LSXC 2Z64A 4C2BB 1K5DC 4XSQA 5A5CA 3BZ5A 2Q4GW 1XECA 2Z7XA 5AWAA 3A79B 4WP6A 1H6TA 4PQ8A 3ZYOA 4EZGA 3G04C 3G3BA 3O6NA 1FS2A 5AWCA 3W3MA 4WYKA 2BEXA 3UL9A 2Z81A 4BSSA 1O6VA 4R6FA 1M9LA 2Z62A 2P1QB 4PEQB 2R9UA 4R09A 4Z8GA 3VQ2A 2BNHA 4R0AA 2RR6A 4U06A 1FO1A 3TSRE 5IJCA 5B0TA 2P1MB 2OMXA 4LXRA 3OGMB 3RGZA 1LTXA 5GS2B 4IM6A 2Z63A 1OTMA 4LXSA 3ULUA 4ARNA 2WQUA 4AY9X 2JQDA 3P72A 1SQ0B 1XEUA 4NKHA 3RGXA 4GT6A 3CIYA 1D0BA 4FMZA 3UN9A 4BSUA 3OJAB 4R07A 1U0ND 1OTNA 2O6QA 5B0NA 1DS9A 2WFHA 1OOKG 3GOZA 3W3LA 4NKGA 4RCWA 2WQWA 4QXEA 3WN4A 3E3ZA 1M0ZA 4MQWX 4R6GA 2XOTA 4U09A 4CILA 3WPEA 4OQTA 3VQ1A 1PGVA 5HZLB 4U7LA 2OMUA 1M10B 3PMHG 2OMWA 4R6AA 3RFEA 4Z61C 3WPDA 1GWBA 4FCGA 2P1NB 4CNMA 4CP6A 5CMPA 4BSRA 5HDHA 1XWDC 4LSCA 4PERA 2ID5A 4KNGA 3RFJA 4LSAA 1KOOA 1DCEA 1W8AA 4KXFB 3W3GA 3C6PB 3WPCA 4V2CA 3ULAA 5LFNA 3M19A 4I6JB 3UL8A 4R58A 2Z82A 3UL7A 2XWTC 5AWBA 3C6OB 3OGLB 5GMGA 4XGOA 2O6RA 3RW7A 1A4YA 3OJAA 2O6SA 4PSJA 3ULVA 1WWLA 4Z79A 1P9AG 1G9UA 2A0ZA 1Z7XW 4Z64C 4V2DA 2UZYA 4R5DA 2P1PB 3REZA 1P8VA 3ZYJA 4V2EA 1K5GC 2CA6A 4QBZA 5IYXC 2Z66A 5IJDA 4M7EC 3W3JA 4J4LA 4FHOA 4P8SA 2UZXA 1FT8A 4PKIG 4CNCA 1QYYA 1ZIWA 3M18A 2OMTA 3RFSA 2OMZA 4HQ1A 3WPGA 4R5CA 4P91A 1P8TA 1IO0A 2Z7XB 1O6TA 2Y5QA 3E2JA 1JL5A 3JB9j 3G06A 4LSXA 4Q62A 3WPIA 4K17A 3KJ4A 4ECOA 4RWTC 4UFRA 1XCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RW6 A;  3CIG A;  4RCA B;  4XOS A;  3G3A A;  4TZH A;  4B8C D;  2V9T B;  4KT1 A;  3E6J A;  4Q3I A;  3CVR A;  4YEB B;  1KOH A;  1M9S A;  3C6N B;  4C2A B;  1A9N A;  3O53 A;  4Q3G A;  3ZYN A;  5GMF A;  2OMV A;  1OTO A;  5CMN A;  3SB4 A;  1DFJ I;  1YRG A;  4FD0 A;  4CC4 C;  4CC4 A;  4LI1 A;  1OZN A;  2V9S A;  4BV4 R;  2JE0 A;  3DZE A;  3G39 A;  5B4P A;  2Z65 A;  4R08 A;  5IJB A;  2OMY A;  3OGK B;  2IFG A;  3W3K A;  2AST B;  2FT3 A;  2WQX A;  3WPF A;  2WQV A;  3FXI A;  4GLP A;  4ARR A;  1OGQ A;  2RA8 A;  5AZ5 A;  4MN8 B;  4L3F A;  4L3A A;  5GMH A;  2P1O B;  2ELL A;  4G8A A;  4R6J A;  5AWD A;  5GS0 A;  3W3N A;  4LI2 A;  5D3I A;  4AW4 A;  2JE1 A;  1O6S A;  3WPH A;  5GQR K;  4Z94 G;  4M7E A;  1XKU A;  4FDW A;  4J0M A;  1H6U A;  3RIZ A;  4ECN A;  4QC0 A;  3RJ0 A;  4FS7 A;  2ASS B;  3E4G A;  4Y61 B;  5FTT B;  4H09 A;  2V70 A;  3WPB A;  3ZYI A;  4U08 A;  1FQV A;  4LSX C;  2Z64 A;  4C2B B;  1K5D C;  4XSQ A;  5A5C A;  3BZ5 A;  2Q4G W;  1XEC A;  2Z7X A;  5AWA A;  3A79 B;  4WP6 A;  1H6T A;  4PQ8 A;  3ZYO A;  4EZG A;  3G04 C;  3G3B A;  3O6N A;  1FS2 A;  5AWC A;  3W3M A;  4WYK A;  2BEX A;  3UL9 A;  2Z81 A;  4BSS A;  1O6V A;  4R6F A;  1M9L A;  2Z62 A;  2P1Q B;  4PEQ B;  2R9U A;  4R09 A;  4Z8G A;  3VQ2 A;  2BNH A;  4R0A A;  2RR6 A;  4U06 A;  1FO1 A;  3TSR E;  5IJC A;  5B0T A;  2P1M B;  2OMX A;  4LXR A;  3OGM B;  3RGZ A;  1LTX A;  5GS2 B;  4IM6 A;  2Z63 A;  1OTM A;  4LXS A;  3ULU A;  4ARN A;  2WQU A;  4AY9 X;  2JQD A;  3P72 A;  1SQ0 B;  1XEU A;  4NKH A;  3RGX A;  4GT6 A;  3CIY A;  1D0B A;  4FMZ A;  3UN9 A;  4BSU A;  3OJA B;  4R07 A;  1U0N D;  1OTN A;  2O6Q A;  5B0N A;  1DS9 A;  2WFH A;  1OOK G;  3GOZ A;  3W3L A;  4NKG A;  4RCW A;  2WQW A;  4QXE A;  3WN4 A;  3E3Z A;  1M0Z A;  4MQW X;  4R6G A;  2XOT A;  4U09 A;  4CIL A;  3WPE A;  4OQT A;  3VQ1 A;  1PGV A;  5HZL B;  4U7L A;  2OMU A;  1M10 B;  3PMH G;  2OMW A;  4R6A A;  3RFE A;  4Z61 C;  3WPD A;  1GWB A;  4FCG A;  2P1N B;  4CNM A;  4CP6 A;  5CMP A;  4BSR A;  5HDH A;  1XWD C;  4LSC A;  4PER A;  2ID5 A;  4KNG A;  3RFJ A;  4LSA A;  1KOO A;  1DCE A;  1W8A A;  4KXF B;  3W3G A;  3C6P B;  3WPC A;  4V2C A;  3ULA A;  5LFN A;  3M19 A;  4I6J B;  3UL8 A;  4R58 A;  2Z82 A;  3UL7 A;  2XWT C;  5AWB A;  3C6O B;  3OGL B;  5GMG A;  4XGO A;  2O6R A;  3RW7 A;  1A4Y A;  3OJA A;  2O6S A;  4PSJ A;  3ULV A;  1WWL A;  4Z79 A;  1P9A G;  1G9U A;  2A0Z A;  1Z7X W;  4Z64 C;  4V2D A;  2UZY A;  4R5D A;  2P1P B;  3REZ A;  1P8V A;  3ZYJ A;  4V2E A;  1K5G C;  2CA6 A;  4QBZ A;  5IYX C;  2Z66 A;  5IJD A;  4M7E C;  3W3J A;  4J4L A;  4FHO A;  4P8S A;  2UZX A;  1FT8 A;  4PKI G;  4CNC A;  1QYY A;  1ZIW A;  3M18 A;  2OMT A;  3RFS A;  2OMZ A;  4HQ1 A;  3WPG A;  4R5C A;  4P91 A;  1P8T A;  1IO0 A;  2Z7X B;  1O6T A;  2Y5Q A;  3E2J A;  1JL5 A;  3JB9 j;  3G06 A;  4LSX A;  4Q62 A;  3WPI A;  4K17 A;  3KJ4 A;  4ECO A;  4RWT C;  4UFR A;  1XCD A; 
#chains in the Genus database with same CATH topology
 3RW6 A;  3CIG A;  4RCA B;  4XOS A;  3G3A A;  4TZH A;  4B8C D;  2V9T B;  4KT1 A;  3E6J A;  4Q3I A;  3CVR A;  4YEB B;  1KOH A;  1M9S A;  3C6N B;  4C2A B;  1A9N A;  3O53 A;  4Q3G A;  3ZYN A;  5GMF A;  2OMV A;  1OTO A;  5CMN A;  3SB4 A;  1DFJ I;  1YRG A;  4FD0 A;  4CC4 C;  4CC4 A;  4LI1 A;  1OZN A;  2V9S A;  4BV4 R;  2JE0 A;  3DZE A;  3G39 A;  5B4P A;  2Z65 A;  4R08 A;  5IJB A;  2OMY A;  3OGK B;  2IFG A;  3W3K A;  2AST B;  2FT3 A;  2WQX A;  3WPF A;  2WQV A;  3FXI A;  4GLP A;  4ARR A;  1OGQ A;  2RA8 A;  5AZ5 A;  4MN8 B;  4L3F A;  4L3A A;  5GMH A;  2P1O B;  2ELL A;  4G8A A;  4R6J A;  5AWD A;  5GS0 A;  3W3N A;  4LI2 A;  5D3I A;  4AW4 A;  2JE1 A;  1O6S A;  3WPH A;  5GQR K;  4Z94 G;  4M7E A;  1XKU A;  4FDW A;  4J0M A;  1H6U A;  3RIZ A;  4ECN A;  4QC0 A;  3RJ0 A;  4FS7 A;  2ASS B;  3E4G A;  4Y61 B;  5FTT B;  4H09 A;  2V70 A;  3WPB A;  3ZYI A;  4U08 A;  1FQV A;  4LSX C;  2Z64 A;  4C2B B;  1K5D C;  4XSQ A;  5A5C A;  3BZ5 A;  2Q4G W;  1XEC A;  2Z7X A;  5AWA A;  3A79 B;  4WP6 A;  1H6T A;  4PQ8 A;  3ZYO A;  4EZG A;  3G04 C;  3G3B A;  3O6N A;  1FS2 A;  5AWC A;  3W3M A;  4WYK A;  2BEX A;  3UL9 A;  2Z81 A;  4BSS A;  1O6V A;  4R6F A;  1M9L A;  2Z62 A;  2P1Q B;  4PEQ B;  2R9U A;  4R09 A;  4Z8G A;  4NZT M;  3VQ2 A;  2BNH A;  4R0A A;  2RR6 A;  4U06 A;  1FO1 A;  3TSR E;  5IJC A;  5B0T A;  2P1M B;  2OMX A;  4LXR A;  3OGM B;  3RGZ A;  1LTX A;  5GS2 B;  4IM6 A;  2Z63 A;  1OTM A;  4LXS A;  3ULU A;  4ARN A;  2WQU A;  4AY9 X;  2JQD A;  3P72 A;  1SQ0 B;  1XEU A;  4NKH A;  3RGX A;  4GT6 A;  3CIY A;  1D0B A;  4FMZ A;  3UN9 A;  4BSU A;  3OJA B;  4R07 A;  1U0N D;  1OTN A;  2O6Q A;  5B0N A;  1DS9 A;  2WFH A;  1OOK G;  3GOZ A;  3W3L A;  4NKG A;  4RCW A;  2WQW A;  4QXE A;  3WN4 A;  3E3Z A;  1M0Z A;  4MQW X;  4R6G A;  2XOT A;  4U09 A;  4CIL A;  3WPE A;  4OQT A;  3VQ1 A;  1PGV A;  5HZL B;  4U7L A;  2OMU A;  1M10 B;  3PMH G;  2OMW A;  4R6A A;  3RFE A;  4Z61 C;  3WPD A;  1GWB A;  4FCG A;  2P1N B;  4CNM A;  4NZR M;  4CP6 A;  5CMP A;  4BSR A;  5HDH A;  1XWD C;  4LSC A;  4PER A;  2ID5 A;  4KNG A;  3RFJ A;  4LSA A;  1KOO A;  1DCE A;  1W8A A;  4KXF B;  3W3G A;  3C6P B;  3WPC A;  4V2C A;  3ULA A;  5LFN A;  3M19 A;  4I6J B;  3UL8 A;  4R58 A;  2Z82 A;  3UL7 A;  2XWT C;  5AWB A;  3C6O B;  3OGL B;  5GMG A;  4XGO A;  2O6R A;  3RW7 A;  1A4Y A;  3OJA A;  2O6S A;  4PSJ A;  3ULV A;  1WWL A;  4Z79 A;  1P9A G;  1G9U A;  2A0Z A;  1Z7X W;  4Z64 C;  4V2D A;  2UZY A;  4R5D A;  2P1P B;  3REZ A;  1P8V A;  3ZYJ A;  4V2E A;  1K5G C;  2CA6 A;  4QBZ A;  5IYX C;  2Z66 A;  5IJD A;  4M7E C;  3W3J A;  4J4L A;  4FHO A;  4P8S A;  2UZX A;  1FT8 A;  4PKI G;  4CNC A;  1QYY A;  1ZIW A;  3M18 A;  2OMT A;  3RFS A;  2OMZ A;  4HQ1 A;  3WPG A;  4R5C A;  4P91 A;  1P8T A;  1IO0 A;  2Z7X B;  1O6T A;  2Y5Q A;  3E2J A;  1JL5 A;  3JB9 j;  3G06 A;  4LSX A;  4Q62 A;  3WPI A;  4K17 A;  3KJ4 A;  4ECO A;  4RWT C;  4UFR A;  1XCD A; 
#chains in the Genus database with same CATH homology
 3RW6 A;  3CIG A;  4RCA B;  4XOS A;  3G3A A;  4TZH A;  4B8C D;  2V9T B;  4KT1 A;  3E6J A;  4Q3I A;  3CVR A;  4YEB B;  1KOH A;  1M9S A;  3C6N B;  4C2A B;  1A9N A;  3O53 A;  4Q3G A;  3ZYN A;  5GMF A;  2OMV A;  1OTO A;  5CMN A;  3SB4 A;  1DFJ I;  1YRG A;  4FD0 A;  4CC4 C;  4CC4 A;  4LI1 A;  1OZN A;  2V9S A;  4BV4 R;  2JE0 A;  3DZE A;  3G39 A;  5B4P A;  2Z65 A;  4R08 A;  5IJB A;  2OMY A;  3OGK B;  2IFG A;  3W3K A;  2AST B;  2FT3 A;  2WQX A;  3WPF A;  2WQV A;  3FXI A;  4GLP A;  4ARR A;  1OGQ A;  2RA8 A;  5AZ5 A;  4MN8 B;  4L3F A;  4L3A A;  5GMH A;  2P1O B;  2ELL A;  4G8A A;  4R6J A;  5AWD A;  5GS0 A;  3W3N A;  4LI2 A;  5D3I A;  4AW4 A;  2JE1 A;  1O6S A;  3WPH A;  5GQR K;  4Z94 G;  4M7E A;  1XKU A;  4FDW A;  4J0M A;  1H6U A;  3RIZ A;  4ECN A;  4QC0 A;  3RJ0 A;  4FS7 A;  2ASS B;  3E4G A;  4Y61 B;  5FTT B;  4H09 A;  2V70 A;  3WPB A;  3ZYI A;  4U08 A;  1FQV A;  4LSX C;  2Z64 A;  4C2B B;  1K5D C;  4XSQ A;  5A5C A;  3BZ5 A;  2Q4G W;  1XEC A;  2Z7X A;  5AWA A;  3A79 B;  4WP6 A;  1H6T A;  4PQ8 A;  3ZYO A;  4EZG A;  3G04 C;  3G3B A;  3O6N A;  1FS2 A;  5AWC A;  3W3M A;  4WYK A;  2BEX A;  3UL9 A;  2Z81 A;  4BSS A;  1O6V A;  4R6F A;  1M9L A;  2Z62 A;  2P1Q B;  4PEQ B;  2R9U A;  4R09 A;  4Z8G A;  3VQ2 A;  2BNH A;  4R0A A;  2RR6 A;  4U06 A;  1FO1 A;  3TSR E;  5IJC A;  5B0T A;  2P1M B;  2OMX A;  4LXR A;  3OGM B;  3RGZ A;  1LTX A;  5GS2 B;  4IM6 A;  2Z63 A;  1OTM A;  4LXS A;  3ULU A;  4ARN A;  2WQU A;  4AY9 X;  2JQD A;  3P72 A;  1SQ0 B;  1XEU A;  4NKH A;  3RGX A;  4GT6 A;  3CIY A;  1D0B A;  4FMZ A;  3UN9 A;  4BSU A;  3OJA B;  4R07 A;  1U0N D;  1OTN A;  2O6Q A;  5B0N A;  1DS9 A;  2WFH A;  1OOK G;  3GOZ A;  3W3L A;  4NKG A;  4RCW A;  2WQW A;  4QXE A;  3WN4 A;  3E3Z A;  1M0Z A;  4MQW X;  4R6G A;  2XOT A;  4U09 A;  4CIL A;  3WPE A;  4OQT A;  3VQ1 A;  1PGV A;  5HZL B;  4U7L A;  2OMU A;  1M10 B;  3PMH G;  2OMW A;  4R6A A;  3RFE A;  4Z61 C;  3WPD A;  1GWB A;  4FCG A;  2P1N B;  4CNM A;  4CP6 A;  5CMP A;  4BSR A;  5HDH A;  1XWD C;  4LSC A;  4PER A;  2ID5 A;  4KNG A;  3RFJ A;  4LSA A;  1KOO A;  1DCE A;  1W8A A;  4KXF B;  3W3G A;  3C6P B;  3WPC A;  4V2C A;  3ULA A;  5LFN A;  3M19 A;  4I6J B;  3UL8 A;  4R58 A;  2Z82 A;  3UL7 A;  2XWT C;  5AWB A;  3C6O B;  3OGL B;  5GMG A;  4XGO A;  2O6R A;  3RW7 A;  1A4Y A;  3OJA A;  2O6S A;  4PSJ A;  3ULV A;  1WWL A;  4Z79 A;  1P9A G;  1G9U A;  2A0Z A;  1Z7X W;  4Z64 C;  4V2D A;  2UZY A;  4R5D A;  2P1P B;  3REZ A;  1P8V A;  3ZYJ A;  4V2E A;  1K5G C;  2CA6 A;  4QBZ A;  5IYX C;  2Z66 A;  5IJD A;  4M7E C;  3W3J A;  4J4L A;  4FHO A;  4P8S A;  2UZX A;  1FT8 A;  4PKI G;  4CNC A;  1QYY A;  1ZIW A;  3M18 A;  2OMT A;  3RFS A;  2OMZ A;  4HQ1 A;  3WPG A;  4R5C A;  4P91 A;  1P8T A;  1IO0 A;  2Z7X B;  1O6T A;  2Y5Q A;  3E2J A;  1JL5 A;  3JB9 j;  3G06 A;  4LSX A;  4Q62 A;  3WPI A;  4K17 A;  3KJ4 A;  4ECO A;  4RWT C;  4UFR A;  1XCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...