3RFSA

Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
b'TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin B, repeat modules, Variable lymphocyte receptor B
publication title Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
total genus 81
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfsA00
3DZEA 4HQ1A 1DFJI 4KNGA 3ZYJA 1KOHA 1DCEA 1OTMA 5HDHA 4BSUA 3RIZA 4OQTA 4R6GA 3CVRA 4Q3GA 1ZIWA 4PQ8A 4FDWA 2P1PB 1M0ZA 1M9SA 4ECNA 5IJCA 4G8AA 1K5DC 3C6NB 4U7LA 5GMFA 3RW7A 4Q62A 4QC0A 1P9AG 2O6QA 4GLPA 4MN8B 2OMZA 4P8SA 4Z8GA 3O6NA 2V9TB 4FS7A 4NKGA 4LXRA 2ASTB 2Z82A 4CNCA 4RCAB 2ASSB 2Z66A 4YEBB 2R9UA 3ZYIA 4J4LA 2JE0A 4LSCA 3OJAB 5AWDA 2WQXA 2RA8A 1FS2A 5CMPA 4U06A 4ARNA 1H6UA 2ID5A 3OGMB 4KXFB 4FMZA 5IYXC 2WFHA 4R6FA 4PERA 1WWLA 1P8VA 3UL7A 3SB4A 3W3KA 1Z7XW 4V2CA 4AY9X 3G3AA 2OMWA 1OTNA 3WPBA 2Z64A 5AWAA 4R07A 2JE1A 4R09A 2V9SA 4V2EA 1W8AA 3E2JA 2OMUA 3WPCA 4LI1A 4GT6A 3C6PB 2P1MB 2P1QB 2FT3A 3E6JA 1A4YA 2Z7XB 5AZ5A 4H09A 3REZA 4MQWX 5HZLB 3KJ4A 3W3LA 1YRGA 2UZXA 4U08A 3G3BA 5A5CA 4C2AB 3UN9A 4UFRA 3P72A 3TSRE 2UZYA 4P91A 3RJ0A 4Q3IA 2OMYA 3WPDA 1M10B 4J0MA 1DS9A 3WPHA 2O6RA 4EZGA 4RWTC 2XWTC 1XECA 4CC4C 1OGQA 4LXSA 5GQRK 2O6SA 1KOOA 4PKIG 4CILA 1OTOA 3G39A 1K5GC 2BEXA 1FT8A 2IFGA 3M19A 4R6AA 2ELLA 4FD0A 3ZYOA 4CNMA 1LTXA 2Z63A 4Z94G 4PSJA 2OMTA 2Q4GW 4XGOA 4U09A 3W3JA 3W3GA 4NKHA 3RFEA 3RW6A 2WQWA 2OMXA 1M9LA 4C2BB 5IJDA 5LFNA 1FQVA 2CA6A 3RFSA 5D3IA 1XWDC 2BNHA 4LSAA 2WQUA 3E3ZA 4R5CA 4LSXC 3M18A 5B4PA 2P1NB 3O53A 4LI2A 5B0NA 1GWBA 1O6SA 3OGLB 1A9NA 5IJBA 3ZYNA 5GS2B 2Z65A 4RCWA 3ULUA 4CC4A 5FTTB 4AW4A 4Z64C 4XSQA 4B8CD 4R08A 5CMNA 1IO0A 2Z81A 4BSRA 4L3FA 2A0ZA 5GMGA 3WPEA 4QBZA 1JL5A 3ULAA 4I6JB 4M7EC 5GMHA 3C6OB 3W3NA 4ECOA 4L3AA 3VQ2A 3G04C 4XOSA 3WPIA 3W3MA 5AWCA 1XEUA 3WPFA 3VQ1A 4Z61C 3G06A 3A79B 1H6TA 1P8TA 3CIYA 1OOKG 4PEQB 3E4GA 3JB9j 4Z79A 4R5DA 3FXIA 5AWBA 4BV4R 2P1OB 3GOZA 2RR6A 4R58A 4WP6A 3WN4A 4FHOA 3RGXA 4LSXA 4KT1A 2Y5QA 4V2DA 1SQ0B 5B0TA 3OJAA 4QXEA 3PMHG 3ULVA 3UL9A 3CIGA 4BSSA 1U0ND 2WQVA 4Y61B 1G9UA 4K17A 2OMVA 2V70A 4FCGA 1XCDA 1D0BA 1O6TA 2JQDA 4CP6A 4R0AA 1FO1A 4ARRA 4IM6A 4R6JA 4TZHA 3BZ5A 2XOTA 1XKUA 1PGVA 1O6VA 3OGKB 3RGZA 5GS0A 1OZNA 1QYYA 2Z62A 4M7EA 2Z7XA 3WPGA 4WYKA 3RFJA 3UL8A
chains in the Genus database with same CATH superfamily
3DZEA 4HQ1A 1DFJI 4KNGA 3ZYJA 1KOHA 1DCEA 1OTMA 5HDHA 4BSUA 3RIZA 4OQTA 4R6GA 3CVRA 4Q3GA 1ZIWA 4PQ8A 4FDWA 2P1PB 1M0ZA 1M9SA 4ECNA 5IJCA 4G8AA 1K5DC 3C6NB 4U7LA 5GMFA 3RW7A 4Q62A 4QC0A 1P9AG 2O6QA 4GLPA 4MN8B 2OMZA 4P8SA 4Z8GA 3O6NA 2V9TB 4FS7A 4NKGA 4LXRA 2ASTB 2Z82A 4CNCA 4RCAB 2ASSB 2Z66A 4YEBB 2R9UA 3ZYIA 4J4LA 2JE0A 4LSCA 3OJAB 5AWDA 2WQXA 4NZRM 2RA8A 1FS2A 5CMPA 4U06A 4ARNA 1H6UA 2ID5A 3OGMB 4KXFB 4FMZA 5IYXC 2WFHA 4R6FA 4PERA 1WWLA 1P8VA 3UL7A 3SB4A 3W3KA 1Z7XW 4V2CA 4AY9X 3G3AA 2OMWA 1OTNA 3WPBA 2Z64A 5AWAA 4R07A 2JE1A 4R09A 2V9SA 4V2EA 1W8AA 3E2JA 2OMUA 3WPCA 4LI1A 4GT6A 3C6PB 2P1MB 2P1QB 2FT3A 3E6JA 1A4YA 2Z7XB 5AZ5A 4H09A 3REZA 4MQWX 5HZLB 3KJ4A 3W3LA 1YRGA 2UZXA 4U08A 3G3BA 5A5CA 4C2AB 3UN9A 4UFRA 3P72A 3TSRE 2UZYA 4P91A 3RJ0A 4Q3IA 2OMYA 3WPDA 1M10B 4J0MA 4NZTM 1DS9A 3WPHA 2O6RA 4EZGA 4RWTC 2XWTC 1XECA 4CC4C 1OGQA 4LXSA 5GQRK 2O6SA 1KOOA 4PKIG 4CILA 1OTOA 3G39A 1K5GC 2BEXA 1FT8A 2IFGA 3M19A 4R6AA 2ELLA 4FD0A 3ZYOA 4CNMA 1LTXA 2Z63A 4Z94G 4PSJA 2OMTA 2Q4GW 4XGOA 4U09A 3W3JA 3W3GA 4NKHA 3RFEA 3RW6A 2WQWA 2OMXA 1M9LA 4C2BB 5IJDA 5LFNA 1FQVA 2CA6A 3RFSA 5D3IA 1XWDC 2BNHA 4LSAA 2WQUA 3E3ZA 4R5CA 4LSXC 3M18A 5B4PA 2P1NB 3O53A 4LI2A 5B0NA 1GWBA 1O6SA 3OGLB 1A9NA 5IJBA 3ZYNA 5GS2B 2Z65A 4RCWA 3ULUA 4CC4A 5FTTB 4AW4A 4Z64C 4XSQA 4B8CD 4R08A 5CMNA 1IO0A 2Z81A 4BSRA 4L3FA 2A0ZA 5GMGA 3WPEA 4QBZA 1JL5A 3ULAA 4I6JB 4M7EC 5GMHA 3C6OB 3W3NA 4ECOA 4L3AA 3VQ2A 3G04C 4XOSA 3WPIA 3W3MA 5AWCA 1XEUA 3WPFA 3VQ1A 4Z61C 3G06A 3A79B 1H6TA 1P8TA 3CIYA 1OOKG 4PEQB 3E4GA 3JB9j 4Z79A 4R5DA 3FXIA 5AWBA 4BV4R 2P1OB 3GOZA 2RR6A 4R58A 4WP6A 3WN4A 4FHOA 3RGXA 4LSXA 4KT1A 2Y5QA 4V2DA 1SQ0B 5B0TA 3OJAA 4QXEA 3PMHG 3ULVA 3UL9A 3CIGA 4BSSA 1U0ND 2WQVA 4Y61B 1G9UA 4K17A 2OMVA 2V70A 4FCGA 1XCDA 1D0BA 1O6TA 2JQDA 4CP6A 4R0AA 1FO1A 4ARRA 4IM6A 4R6JA 4TZHA 3BZ5A 2XOTA 1XKUA 1PGVA 1O6VA 3OGKB 3RGZA 5GS0A 1OZNA 1QYYA 2Z62A 4M7EA 2Z7XA 3WPGA 4WYKA 3RFJA 3UL8A
chains in the Genus database with same CATH topology
3DZEA 4HQ1A 1DFJI 4KNGA 3ZYJA 1KOHA 1DCEA 1OTMA 5HDHA 4BSUA 3RIZA 4OQTA 4R6GA 3CVRA 4Q3GA 1ZIWA 4PQ8A 4FDWA 2P1PB 1M0ZA 1M9SA 4ECNA 5IJCA 4G8AA 1K5DC 3C6NB 4U7LA 5GMFA 3RW7A 4Q62A 4QC0A 1P9AG 2O6QA 4GLPA 4MN8B 2OMZA 4P8SA 4Z8GA 3O6NA 2V9TB 4FS7A 4NKGA 4LXRA 2ASTB 2Z82A 4CNCA 4RCAB 2ASSB 2Z66A 4YEBB 2R9UA 3ZYIA 4J4LA 2JE0A 4LSCA 3OJAB 5AWDA 2WQXA 2RA8A 1FS2A 5CMPA 4U06A 4ARNA 1H6UA 2ID5A 3OGMB 4KXFB 4FMZA 5IYXC 2WFHA 4R6FA 4PERA 1WWLA 1P8VA 3UL7A 3SB4A 3W3KA 1Z7XW 4V2CA 4AY9X 3G3AA 2OMWA 1OTNA 3WPBA 2Z64A 5AWAA 4R07A 2JE1A 4R09A 2V9SA 4V2EA 1W8AA 3E2JA 2OMUA 3WPCA 4LI1A 4GT6A 3C6PB 2P1MB 2P1QB 2FT3A 3E6JA 1A4YA 2Z7XB 5AZ5A 4H09A 3REZA 4MQWX 5HZLB 3KJ4A 3W3LA 1YRGA 2UZXA 4U08A 3G3BA 5A5CA 4C2AB 3UN9A 4UFRA 3P72A 3TSRE 2UZYA 4P91A 3RJ0A 4Q3IA 2OMYA 3WPDA 1M10B 4J0MA 1DS9A 3WPHA 2O6RA 4EZGA 4RWTC 2XWTC 1XECA 4CC4C 1OGQA 4LXSA 5GQRK 2O6SA 1KOOA 4PKIG 4CILA 1OTOA 3G39A 1K5GC 2BEXA 1FT8A 2IFGA 3M19A 4R6AA 2ELLA 4FD0A 3ZYOA 4CNMA 1LTXA 2Z63A 4Z94G 4PSJA 2OMTA 2Q4GW 4XGOA 4U09A 3W3JA 3W3GA 4NKHA 3RFEA 3RW6A 2WQWA 2OMXA 1M9LA 4C2BB 5IJDA 5LFNA 1FQVA 2CA6A 3RFSA 5D3IA 1XWDC 2BNHA 4LSAA 2WQUA 3E3ZA 4R5CA 4LSXC 3M18A 5B4PA 2P1NB 3O53A 4LI2A 5B0NA 1GWBA 1O6SA 3OGLB 1A9NA 5IJBA 3ZYNA 5GS2B 2Z65A 4RCWA 3ULUA 4CC4A 5FTTB 4AW4A 4Z64C 4XSQA 4B8CD 4R08A 5CMNA 1IO0A 2Z81A 4BSRA 4L3FA 2A0ZA 5GMGA 3WPEA 4QBZA 1JL5A 3ULAA 4I6JB 4M7EC 5GMHA 3C6OB 3W3NA 4ECOA 4L3AA 3VQ2A 3G04C 4XOSA 3WPIA 3W3MA 5AWCA 1XEUA 3WPFA 3VQ1A 4Z61C 3G06A 3A79B 1H6TA 1P8TA 3CIYA 1OOKG 4PEQB 3E4GA 3JB9j 4Z79A 4R5DA 3FXIA 5AWBA 4BV4R 2P1OB 3GOZA 2RR6A 4R58A 4WP6A 3WN4A 4FHOA 3RGXA 4LSXA 4KT1A 2Y5QA 4V2DA 1SQ0B 5B0TA 3OJAA 4QXEA 3PMHG 3ULVA 3UL9A 3CIGA 4BSSA 1U0ND 2WQVA 4Y61B 1G9UA 4K17A 2OMVA 2V70A 4FCGA 1XCDA 1D0BA 1O6TA 2JQDA 4CP6A 4R0AA 1FO1A 4ARRA 4IM6A 4R6JA 4TZHA 3BZ5A 2XOTA 1XKUA 1PGVA 1O6VA 3OGKB 3RGZA 5GS0A 1OZNA 1QYYA 2Z62A 4M7EA 2Z7XA 3WPGA 4WYKA 3RFJA 3UL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZE A;  4HQ1 A;  1DFJ I;  4KNG A;  3ZYJ A;  1KOH A;  1DCE A;  1OTM A;  5HDH A;  4BSU A;  3RIZ A;  4OQT A;  4R6G A;  3CVR A;  4Q3G A;  1ZIW A;  4PQ8 A;  4FDW A;  2P1P B;  1M0Z A;  1M9S A;  4ECN A;  5IJC A;  4G8A A;  1K5D C;  3C6N B;  4U7L A;  5GMF A;  3RW7 A;  4Q62 A;  4QC0 A;  1P9A G;  2O6Q A;  4GLP A;  4MN8 B;  2OMZ A;  4P8S A;  4Z8G A;  3O6N A;  2V9T B;  4FS7 A;  4NKG A;  4LXR A;  2AST B;  2Z82 A;  4CNC A;  4RCA B;  2ASS B;  2Z66 A;  4YEB B;  2R9U A;  3ZYI A;  4J4L A;  2JE0 A;  4LSC A;  3OJA B;  5AWD A;  2WQX A;  2RA8 A;  1FS2 A;  5CMP A;  4U06 A;  4ARN A;  1H6U A;  2ID5 A;  3OGM B;  4KXF B;  4FMZ A;  5IYX C;  2WFH A;  4R6F A;  4PER A;  1WWL A;  1P8V A;  3UL7 A;  3SB4 A;  3W3K A;  1Z7X W;  4V2C A;  4AY9 X;  3G3A A;  2OMW A;  1OTN A;  3WPB A;  2Z64 A;  5AWA A;  4R07 A;  2JE1 A;  4R09 A;  2V9S A;  4V2E A;  1W8A A;  3E2J A;  2OMU A;  3WPC A;  4LI1 A;  4GT6 A;  3C6P B;  2P1M B;  2P1Q B;  2FT3 A;  3E6J A;  1A4Y A;  2Z7X B;  5AZ5 A;  4H09 A;  3REZ A;  4MQW X;  5HZL B;  3KJ4 A;  3W3L A;  1YRG A;  2UZX A;  4U08 A;  3G3B A;  5A5C A;  4C2A B;  3UN9 A;  4UFR A;  3P72 A;  3TSR E;  2UZY A;  4P91 A;  3RJ0 A;  4Q3I A;  2OMY A;  3WPD A;  1M10 B;  4J0M A;  1DS9 A;  3WPH A;  2O6R A;  4EZG A;  4RWT C;  2XWT C;  1XEC A;  4CC4 C;  1OGQ A;  4LXS A;  5GQR K;  2O6S A;  1KOO A;  4PKI G;  4CIL A;  1OTO A;  3G39 A;  1K5G C;  2BEX A;  1FT8 A;  2IFG A;  3M19 A;  4R6A A;  2ELL A;  4FD0 A;  3ZYO A;  4CNM A;  1LTX A;  2Z63 A;  4Z94 G;  4PSJ A;  2OMT A;  2Q4G W;  4XGO A;  4U09 A;  3W3J A;  3W3G A;  4NKH A;  3RFE A;  3RW6 A;  2WQW A;  2OMX A;  1M9L A;  4C2B B;  5IJD A;  5LFN A;  1FQV A;  2CA6 A;  3RFS A;  5D3I A;  1XWD C;  2BNH A;  4LSA A;  2WQU A;  3E3Z A;  4R5C A;  4LSX C;  3M18 A;  5B4P A;  2P1N B;  3O53 A;  4LI2 A;  5B0N A;  1GWB A;  1O6S A;  3OGL B;  1A9N A;  5IJB A;  3ZYN A;  5GS2 B;  2Z65 A;  4RCW A;  3ULU A;  4CC4 A;  5FTT B;  4AW4 A;  4Z64 C;  4XSQ A;  4B8C D;  4R08 A;  5CMN A;  1IO0 A;  2Z81 A;  4BSR A;  4L3F A;  2A0Z A;  5GMG A;  3WPE A;  4QBZ A;  1JL5 A;  3ULA A;  4I6J B;  4M7E C;  5GMH A;  3C6O B;  3W3N A;  4ECO A;  4L3A A;  3VQ2 A;  3G04 C;  4XOS A;  3WPI A;  3W3M A;  5AWC A;  1XEU A;  3WPF A;  3VQ1 A;  4Z61 C;  3G06 A;  3A79 B;  1H6T A;  1P8T A;  3CIY A;  1OOK G;  4PEQ B;  3E4G A;  3JB9 j;  4Z79 A;  4R5D A;  3FXI A;  5AWB A;  4BV4 R;  2P1O B;  3GOZ A;  2RR6 A;  4R58 A;  4WP6 A;  3WN4 A;  4FHO A;  3RGX A;  4LSX A;  4KT1 A;  2Y5Q A;  4V2D A;  1SQ0 B;  5B0T A;  3OJA A;  4QXE A;  3PMH G;  3ULV A;  3UL9 A;  3CIG A;  4BSS A;  1U0N D;  2WQV A;  4Y61 B;  1G9U A;  4K17 A;  2OMV A;  2V70 A;  4FCG A;  1XCD A;  1D0B A;  1O6T A;  2JQD A;  4CP6 A;  4R0A A;  1FO1 A;  4ARR A;  4IM6 A;  4R6J A;  4TZH A;  3BZ5 A;  2XOT A;  1XKU A;  1PGV A;  1O6V A;  3OGK B;  3RGZ A;  5GS0 A;  1OZN A;  1QYY A;  2Z62 A;  4M7E A;  2Z7X A;  3WPG A;  4WYK A;  3RFJ A;  3UL8 A; 
#chains in the Genus database with same CATH topology
 3DZE A;  4HQ1 A;  1DFJ I;  4KNG A;  3ZYJ A;  1KOH A;  1DCE A;  1OTM A;  5HDH A;  4BSU A;  3RIZ A;  4OQT A;  4R6G A;  3CVR A;  4Q3G A;  1ZIW A;  4PQ8 A;  4FDW A;  2P1P B;  1M0Z A;  1M9S A;  4ECN A;  5IJC A;  4G8A A;  1K5D C;  3C6N B;  4U7L A;  5GMF A;  3RW7 A;  4Q62 A;  4QC0 A;  1P9A G;  2O6Q A;  4GLP A;  4MN8 B;  2OMZ A;  4P8S A;  4Z8G A;  3O6N A;  2V9T B;  4FS7 A;  4NKG A;  4LXR A;  2AST B;  2Z82 A;  4CNC A;  4RCA B;  2ASS B;  2Z66 A;  4YEB B;  2R9U A;  3ZYI A;  4J4L A;  2JE0 A;  4LSC A;  3OJA B;  5AWD A;  2WQX A;  4NZR M;  2RA8 A;  1FS2 A;  5CMP A;  4U06 A;  4ARN A;  1H6U A;  2ID5 A;  3OGM B;  4KXF B;  4FMZ A;  5IYX C;  2WFH A;  4R6F A;  4PER A;  1WWL A;  1P8V A;  3UL7 A;  3SB4 A;  3W3K A;  1Z7X W;  4V2C A;  4AY9 X;  3G3A A;  2OMW A;  1OTN A;  3WPB A;  2Z64 A;  5AWA A;  4R07 A;  2JE1 A;  4R09 A;  2V9S A;  4V2E A;  1W8A A;  3E2J A;  2OMU A;  3WPC A;  4LI1 A;  4GT6 A;  3C6P B;  2P1M B;  2P1Q B;  2FT3 A;  3E6J A;  1A4Y A;  2Z7X B;  5AZ5 A;  4H09 A;  3REZ A;  4MQW X;  5HZL B;  3KJ4 A;  3W3L A;  1YRG A;  2UZX A;  4U08 A;  3G3B A;  5A5C A;  4C2A B;  3UN9 A;  4UFR A;  3P72 A;  3TSR E;  2UZY A;  4P91 A;  3RJ0 A;  4Q3I A;  2OMY A;  3WPD A;  1M10 B;  4J0M A;  4NZT M;  1DS9 A;  3WPH A;  2O6R A;  4EZG A;  4RWT C;  2XWT C;  1XEC A;  4CC4 C;  1OGQ A;  4LXS A;  5GQR K;  2O6S A;  1KOO A;  4PKI G;  4CIL A;  1OTO A;  3G39 A;  1K5G C;  2BEX A;  1FT8 A;  2IFG A;  3M19 A;  4R6A A;  2ELL A;  4FD0 A;  3ZYO A;  4CNM A;  1LTX A;  2Z63 A;  4Z94 G;  4PSJ A;  2OMT A;  2Q4G W;  4XGO A;  4U09 A;  3W3J A;  3W3G A;  4NKH A;  3RFE A;  3RW6 A;  2WQW A;  2OMX A;  1M9L A;  4C2B B;  5IJD A;  5LFN A;  1FQV A;  2CA6 A;  3RFS A;  5D3I A;  1XWD C;  2BNH A;  4LSA A;  2WQU A;  3E3Z A;  4R5C A;  4LSX C;  3M18 A;  5B4P A;  2P1N B;  3O53 A;  4LI2 A;  5B0N A;  1GWB A;  1O6S A;  3OGL B;  1A9N A;  5IJB A;  3ZYN A;  5GS2 B;  2Z65 A;  4RCW A;  3ULU A;  4CC4 A;  5FTT B;  4AW4 A;  4Z64 C;  4XSQ A;  4B8C D;  4R08 A;  5CMN A;  1IO0 A;  2Z81 A;  4BSR A;  4L3F A;  2A0Z A;  5GMG A;  3WPE A;  4QBZ A;  1JL5 A;  3ULA A;  4I6J B;  4M7E C;  5GMH A;  3C6O B;  3W3N A;  4ECO A;  4L3A A;  3VQ2 A;  3G04 C;  4XOS A;  3WPI A;  3W3M A;  5AWC A;  1XEU A;  3WPF A;  3VQ1 A;  4Z61 C;  3G06 A;  3A79 B;  1H6T A;  1P8T A;  3CIY A;  1OOK G;  4PEQ B;  3E4G A;  3JB9 j;  4Z79 A;  4R5D A;  3FXI A;  5AWB A;  4BV4 R;  2P1O B;  3GOZ A;  2RR6 A;  4R58 A;  4WP6 A;  3WN4 A;  4FHO A;  3RGX A;  4LSX A;  4KT1 A;  2Y5Q A;  4V2D A;  1SQ0 B;  5B0T A;  3OJA A;  4QXE A;  3PMH G;  3ULV A;  3UL9 A;  3CIG A;  4BSS A;  1U0N D;  2WQV A;  4Y61 B;  1G9U A;  4K17 A;  2OMV A;  2V70 A;  4FCG A;  1XCD A;  1D0B A;  1O6T A;  2JQD A;  4CP6 A;  4R0A A;  1FO1 A;  4ARR A;  4IM6 A;  4R6J A;  4TZH A;  3BZ5 A;  2XOT A;  1XKU A;  1PGV A;  1O6V A;  3OGK B;  3RGZ A;  5GS0 A;  1OZN A;  1QYY A;  2Z62 A;  4M7E A;  2Z7X A;  3WPG A;  4WYK A;  3RFJ A;  3UL8 A; 
#chains in the Genus database with same CATH homology
 3DZE A;  4HQ1 A;  1DFJ I;  4KNG A;  3ZYJ A;  1KOH A;  1DCE A;  1OTM A;  5HDH A;  4BSU A;  3RIZ A;  4OQT A;  4R6G A;  3CVR A;  4Q3G A;  1ZIW A;  4PQ8 A;  4FDW A;  2P1P B;  1M0Z A;  1M9S A;  4ECN A;  5IJC A;  4G8A A;  1K5D C;  3C6N B;  4U7L A;  5GMF A;  3RW7 A;  4Q62 A;  4QC0 A;  1P9A G;  2O6Q A;  4GLP A;  4MN8 B;  2OMZ A;  4P8S A;  4Z8G A;  3O6N A;  2V9T B;  4FS7 A;  4NKG A;  4LXR A;  2AST B;  2Z82 A;  4CNC A;  4RCA B;  2ASS B;  2Z66 A;  4YEB B;  2R9U A;  3ZYI A;  4J4L A;  2JE0 A;  4LSC A;  3OJA B;  5AWD A;  2WQX A;  2RA8 A;  1FS2 A;  5CMP A;  4U06 A;  4ARN A;  1H6U A;  2ID5 A;  3OGM B;  4KXF B;  4FMZ A;  5IYX C;  2WFH A;  4R6F A;  4PER A;  1WWL A;  1P8V A;  3UL7 A;  3SB4 A;  3W3K A;  1Z7X W;  4V2C A;  4AY9 X;  3G3A A;  2OMW A;  1OTN A;  3WPB A;  2Z64 A;  5AWA A;  4R07 A;  2JE1 A;  4R09 A;  2V9S A;  4V2E A;  1W8A A;  3E2J A;  2OMU A;  3WPC A;  4LI1 A;  4GT6 A;  3C6P B;  2P1M B;  2P1Q B;  2FT3 A;  3E6J A;  1A4Y A;  2Z7X B;  5AZ5 A;  4H09 A;  3REZ A;  4MQW X;  5HZL B;  3KJ4 A;  3W3L A;  1YRG A;  2UZX A;  4U08 A;  3G3B A;  5A5C A;  4C2A B;  3UN9 A;  4UFR A;  3P72 A;  3TSR E;  2UZY A;  4P91 A;  3RJ0 A;  4Q3I A;  2OMY A;  3WPD A;  1M10 B;  4J0M A;  1DS9 A;  3WPH A;  2O6R A;  4EZG A;  4RWT C;  2XWT C;  1XEC A;  4CC4 C;  1OGQ A;  4LXS A;  5GQR K;  2O6S A;  1KOO A;  4PKI G;  4CIL A;  1OTO A;  3G39 A;  1K5G C;  2BEX A;  1FT8 A;  2IFG A;  3M19 A;  4R6A A;  2ELL A;  4FD0 A;  3ZYO A;  4CNM A;  1LTX A;  2Z63 A;  4Z94 G;  4PSJ A;  2OMT A;  2Q4G W;  4XGO A;  4U09 A;  3W3J A;  3W3G A;  4NKH A;  3RFE A;  3RW6 A;  2WQW A;  2OMX A;  1M9L A;  4C2B B;  5IJD A;  5LFN A;  1FQV A;  2CA6 A;  3RFS A;  5D3I A;  1XWD C;  2BNH A;  4LSA A;  2WQU A;  3E3Z A;  4R5C A;  4LSX C;  3M18 A;  5B4P A;  2P1N B;  3O53 A;  4LI2 A;  5B0N A;  1GWB A;  1O6S A;  3OGL B;  1A9N A;  5IJB A;  3ZYN A;  5GS2 B;  2Z65 A;  4RCW A;  3ULU A;  4CC4 A;  5FTT B;  4AW4 A;  4Z64 C;  4XSQ A;  4B8C D;  4R08 A;  5CMN A;  1IO0 A;  2Z81 A;  4BSR A;  4L3F A;  2A0Z A;  5GMG A;  3WPE A;  4QBZ A;  1JL5 A;  3ULA A;  4I6J B;  4M7E C;  5GMH A;  3C6O B;  3W3N A;  4ECO A;  4L3A A;  3VQ2 A;  3G04 C;  4XOS A;  3WPI A;  3W3M A;  5AWC A;  1XEU A;  3WPF A;  3VQ1 A;  4Z61 C;  3G06 A;  3A79 B;  1H6T A;  1P8T A;  3CIY A;  1OOK G;  4PEQ B;  3E4G A;  3JB9 j;  4Z79 A;  4R5D A;  3FXI A;  5AWB A;  4BV4 R;  2P1O B;  3GOZ A;  2RR6 A;  4R58 A;  4WP6 A;  3WN4 A;  4FHO A;  3RGX A;  4LSX A;  4KT1 A;  2Y5Q A;  4V2D A;  1SQ0 B;  5B0T A;  3OJA A;  4QXE A;  3PMH G;  3ULV A;  3UL9 A;  3CIG A;  4BSS A;  1U0N D;  2WQV A;  4Y61 B;  1G9U A;  4K17 A;  2OMV A;  2V70 A;  4FCG A;  1XCD A;  1D0B A;  1O6T A;  2JQD A;  4CP6 A;  4R0A A;  1FO1 A;  4ARR A;  4IM6 A;  4R6J A;  4TZH A;  3BZ5 A;  2XOT A;  1XKU A;  1PGV A;  1O6V A;  3OGK B;  3RGZ A;  5GS0 A;  1OZN A;  1QYY A;  2Z62 A;  4M7E A;  2Z7X A;  3WPG A;  4WYK A;  3RFJ A;  3UL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...