3RFSA

Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin B, repeat modules, Variable lymphocyte receptor B
publication title Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
total genus 81
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfsA00
4RCAB 4CP6A 4LSAA 2P1PB 3RFEA 1FQVA 3WPCA 4XSQA 3RJ0A 5IJDA 4M7EC 4Q3IA 2ID5A 4U09A 3JB9j 5A5CA 1O6VA 1H6TA 4LXSA 4P8SA 2P1OB 2OMXA 2Z65A 4B8CD 2Z64A 4Y61B 3OJAA 4QXEA 3G3AA 4FDWA 3C6NB 4NKGA 1PGVA 2ASTB 1IO0A 3UN9A 2JE0A 4L3FA 4J0MA 4CILA 5CMNA 3E4GA 3ZYNA 4PSJA 5FTTB 4U08A 2OMZA 2P1QB 4LSXC 5HZLB 3CVRA 4XGOA 3KJ4A 4CC4C 4R6GA 4CC4A 3P72A 3WPIA 3RGZA 2UZXA 2V9SA 2OMVA 2XWTC 1D0BA 1XCDA 4LI1A 4C2BB 2ASSB 3C6PB 4PEQB 5B0TA 4V2EA 4OQTA 1DCEA 3OJAB 3G3BA 3O53A 1P8VA 3RFSA 4FS7A 4PQ8A 2RR6A 4MN8B 4CNMA 1OTOA 5GS2B 2XOTA 1OGQA 3CIYA 3WPEA 3RIZA 3SB4A 4Q3GA 1P9AG 4WYKA 4QC0A 3RW7A 1FO1A 3WPGA 5GMGA 1H6UA 1O6SA 1QYYA 5CMPA 3WPDA 5GMFA 2Z66A 2OMWA 4Z94G 4LSCA 4I6JB 4Z64C 5LFNA 4R6FA 2O6QA 3CIGA 4KNGA 3OGMB 4K17A 3TSRE 4FMZA 3UL8A 1OZNA 1KOOA 4XOSA 4GT6A 1OTNA 4LXRA 3ZYOA 4GLPA 3RFJA 3RGXA 4AW4A 2OMUA 4BSUA 4G8AA 3A79B 3ULAA 4PERA 4R58A 5B0NA 3W3MA 4AY9X 4R08A 3E2JA 4H09A 3W3JA 3W3LA 4HQ1A 3C6OB 3E3ZA 2WQUA 4U06A 5AWBA 4R5DA 2Q4GW 1M10B 2WQWA 2OMTA 4ECOA 3M19A 4L3AA 4V2DA 1FS2A 4FHOA 4RCWA 1M9SA 1YRGA 2R9UA 4PKIG 3O6NA 4KXFB 5AWDA 2OMYA 2V70A 1XECA 1XKUA 3G04C 4J4LA 4IM6A 2ELLA 4WP6A 3WN4A 3ZYJA 2P1MB 2RA8A 4NKHA 4FCGA 1P8TA 1G9UA 3W3NA 2UZYA 2P1NB 1U0ND 2JE1A 4ECNA 5GS0A 3G39A 5IJCA 4MQWX 2Z62A 3UL9A 4CNCA 2WFHA 3BZ5A 1K5GC 1GWBA 5D3IA 5AWAA 3VQ1A 1OOKG 3UL7A 4C2AB 3DZEA 4Z61C 4Z8GA 3OGLB 3FXIA 4M7EA 3ULUA 4BV4R 5B4PA 2O6SA 4R07A 3GOZA 4P91A 3PMHG 4YEBB 5AWCA 1FT8A 4BSRA 1A9NA 5AZ5A 2Z7XA 1XWDC 4U7LA 4ARRA 2Z63A 2WQVA 1DFJI 2Z81A 1DS9A 1W8AA 4LI2A 3VQ2A 4TZHA 1M9LA 2Y5QA 2A0ZA 5IJBA 4RWTC 1JL5A 4ARNA 1Z7XW 4R5CA 1KOHA 3M18A 1A4YA 5IYXC 1SQ0B 1M0ZA 4R6AA 3RW6A 1ZIWA 1O6TA 5GMHA 2CA6A 2Z82A 4Q62A 4LSXA 4EZGA 3REZA 2BEXA 3ULVA 4V2CA 4QBZA 4BSSA 3G06A 2JQDA 3WPBA 4R09A 3WPFA 3W3KA 2WQXA 2FT3A 3W3GA 2O6RA 3E6JA 2Z7XB 1XEUA 4R0AA 4KT1A 5GQRK 1WWLA 4Z79A 4FD0A 2BNHA 5HDHA 2V9TB 2IFGA 3WPHA 1LTXA 4UFRA 3ZYIA 3OGKB 1OTMA 4R6JA 1K5DC
chains in the Genus database with same CATH superfamily
4RCAB 4CP6A 4LSAA 2P1PB 3RFEA 1FQVA 3WPCA 4XSQA 3RJ0A 5IJDA 4M7EC 4Q3IA 2ID5A 4U09A 3JB9j 5A5CA 1O6VA 1H6TA 4LXSA 4P8SA 2P1OB 2OMXA 2Z65A 4B8CD 2Z64A 4Y61B 3OJAA 4QXEA 3G3AA 4FDWA 3C6NB 4NKGA 1PGVA 2ASTB 1IO0A 3UN9A 2JE0A 4L3FA 4J0MA 4CILA 5CMNA 3E4GA 3ZYNA 4PSJA 5FTTB 4U08A 2OMZA 2P1QB 4LSXC 5HZLB 3CVRA 4XGOA 3KJ4A 4CC4C 4R6GA 4CC4A 3P72A 4NZRM 3WPIA 3RGZA 2UZXA 2V9SA 2OMVA 2XWTC 1D0BA 1XCDA 4LI1A 4C2BB 2ASSB 3C6PB 4PEQB 5B0TA 4V2EA 4OQTA 1DCEA 3OJAB 3G3BA 3O53A 1P8VA 3RFSA 4FS7A 4PQ8A 2RR6A 4MN8B 4CNMA 1OTOA 5GS2B 2XOTA 1OGQA 3CIYA 3WPEA 3RIZA 3SB4A 4Q3GA 1P9AG 4WYKA 4QC0A 3RW7A 1FO1A 3WPGA 5GMGA 1H6UA 1O6SA 1QYYA 5CMPA 3WPDA 5GMFA 2Z66A 2OMWA 4Z94G 4LSCA 4I6JB 4Z64C 5LFNA 4R6FA 2O6QA 3CIGA 4KNGA 3OGMB 4K17A 3TSRE 4FMZA 3UL8A 1OZNA 1KOOA 4XOSA 4GT6A 1OTNA 4LXRA 3ZYOA 4GLPA 3RFJA 3RGXA 4AW4A 2OMUA 4BSUA 4G8AA 3A79B 3ULAA 4PERA 4R58A 5B0NA 3W3MA 4AY9X 4R08A 3E2JA 4H09A 3W3JA 3W3LA 4HQ1A 3C6OB 3E3ZA 2WQUA 4U06A 5AWBA 4R5DA 2Q4GW 1M10B 2WQWA 2OMTA 4ECOA 3M19A 4L3AA 4V2DA 1FS2A 4FHOA 4RCWA 1M9SA 1YRGA 2R9UA 4PKIG 3O6NA 4KXFB 5AWDA 2OMYA 2V70A 1XECA 1XKUA 3G04C 4J4LA 4IM6A 2ELLA 4WP6A 3WN4A 3ZYJA 2P1MB 2RA8A 4NKHA 4FCGA 1P8TA 1G9UA 3W3NA 2UZYA 2P1NB 1U0ND 2JE1A 4ECNA 4NZTM 5GS0A 3G39A 5IJCA 4MQWX 2Z62A 3UL9A 4CNCA 2WFHA 3BZ5A 1K5GC 1GWBA 5D3IA 5AWAA 3VQ1A 1OOKG 3UL7A 4C2AB 3DZEA 4Z61C 4Z8GA 3OGLB 3FXIA 4M7EA 3ULUA 4BV4R 5B4PA 2O6SA 4R07A 3GOZA 4P91A 3PMHG 4YEBB 5AWCA 1FT8A 4BSRA 1A9NA 5AZ5A 2Z7XA 1XWDC 4U7LA 4ARRA 2Z63A 2WQVA 1DFJI 2Z81A 1DS9A 1W8AA 4LI2A 3VQ2A 4TZHA 1M9LA 2Y5QA 2A0ZA 5IJBA 4RWTC 1JL5A 4ARNA 1Z7XW 4R5CA 1KOHA 3M18A 1A4YA 5IYXC 1SQ0B 1M0ZA 4R6AA 3RW6A 1ZIWA 1O6TA 5GMHA 2CA6A 2Z82A 4Q62A 4LSXA 4EZGA 3REZA 2BEXA 3ULVA 4V2CA 4QBZA 4BSSA 3G06A 2JQDA 3WPBA 4R09A 3WPFA 3W3KA 2WQXA 2FT3A 3W3GA 2O6RA 3E6JA 2Z7XB 1XEUA 4R0AA 4KT1A 5GQRK 1WWLA 4Z79A 4FD0A 2BNHA 5HDHA 2V9TB 2IFGA 3WPHA 1LTXA 4UFRA 3ZYIA 3OGKB 1OTMA 4R6JA 1K5DC
chains in the Genus database with same CATH topology
4RCAB 4CP6A 4LSAA 2P1PB 3RFEA 1FQVA 3WPCA 4XSQA 3RJ0A 5IJDA 4M7EC 4Q3IA 2ID5A 4U09A 3JB9j 5A5CA 1O6VA 1H6TA 4LXSA 4P8SA 2P1OB 2OMXA 2Z65A 4B8CD 2Z64A 4Y61B 3OJAA 4QXEA 3G3AA 4FDWA 3C6NB 4NKGA 1PGVA 2ASTB 1IO0A 3UN9A 2JE0A 4L3FA 4J0MA 4CILA 5CMNA 3E4GA 3ZYNA 4PSJA 5FTTB 4U08A 2OMZA 2P1QB 4LSXC 5HZLB 3CVRA 4XGOA 3KJ4A 4CC4C 4R6GA 4CC4A 3P72A 3WPIA 3RGZA 2UZXA 2V9SA 2OMVA 2XWTC 1D0BA 1XCDA 4LI1A 4C2BB 2ASSB 3C6PB 4PEQB 5B0TA 4V2EA 4OQTA 1DCEA 3OJAB 3G3BA 3O53A 1P8VA 3RFSA 4FS7A 4PQ8A 2RR6A 4MN8B 4CNMA 1OTOA 5GS2B 2XOTA 1OGQA 3CIYA 3WPEA 3RIZA 3SB4A 4Q3GA 1P9AG 4WYKA 4QC0A 3RW7A 1FO1A 3WPGA 5GMGA 1H6UA 1O6SA 1QYYA 5CMPA 3WPDA 5GMFA 2Z66A 2OMWA 4Z94G 4LSCA 4I6JB 4Z64C 5LFNA 4R6FA 2O6QA 3CIGA 4KNGA 3OGMB 4K17A 3TSRE 4FMZA 3UL8A 1OZNA 1KOOA 4XOSA 4GT6A 1OTNA 4LXRA 3ZYOA 4GLPA 3RFJA 3RGXA 4AW4A 2OMUA 4BSUA 4G8AA 3A79B 3ULAA 4PERA 4R58A 5B0NA 3W3MA 4AY9X 4R08A 3E2JA 4H09A 3W3JA 3W3LA 4HQ1A 3C6OB 3E3ZA 2WQUA 4U06A 5AWBA 4R5DA 2Q4GW 1M10B 2WQWA 2OMTA 4ECOA 3M19A 4L3AA 4V2DA 1FS2A 4FHOA 4RCWA 1M9SA 1YRGA 2R9UA 4PKIG 3O6NA 4KXFB 5AWDA 2OMYA 2V70A 1XECA 1XKUA 3G04C 4J4LA 4IM6A 2ELLA 4WP6A 3WN4A 3ZYJA 2P1MB 2RA8A 4NKHA 4FCGA 1P8TA 1G9UA 3W3NA 2UZYA 2P1NB 1U0ND 2JE1A 4ECNA 5GS0A 3G39A 5IJCA 4MQWX 2Z62A 3UL9A 4CNCA 2WFHA 3BZ5A 1K5GC 1GWBA 5D3IA 5AWAA 3VQ1A 1OOKG 3UL7A 4C2AB 3DZEA 4Z61C 4Z8GA 3OGLB 3FXIA 4M7EA 3ULUA 4BV4R 5B4PA 2O6SA 4R07A 3GOZA 4P91A 3PMHG 4YEBB 5AWCA 1FT8A 4BSRA 1A9NA 5AZ5A 2Z7XA 1XWDC 4U7LA 4ARRA 2Z63A 2WQVA 1DFJI 2Z81A 1DS9A 1W8AA 4LI2A 3VQ2A 4TZHA 1M9LA 2Y5QA 2A0ZA 5IJBA 4RWTC 1JL5A 4ARNA 1Z7XW 4R5CA 1KOHA 3M18A 1A4YA 5IYXC 1SQ0B 1M0ZA 4R6AA 3RW6A 1ZIWA 1O6TA 5GMHA 2CA6A 2Z82A 4Q62A 4LSXA 4EZGA 3REZA 2BEXA 3ULVA 4V2CA 4QBZA 4BSSA 3G06A 2JQDA 3WPBA 4R09A 3WPFA 3W3KA 2WQXA 2FT3A 3W3GA 2O6RA 3E6JA 2Z7XB 1XEUA 4R0AA 4KT1A 5GQRK 1WWLA 4Z79A 4FD0A 2BNHA 5HDHA 2V9TB 2IFGA 3WPHA 1LTXA 4UFRA 3ZYIA 3OGKB 1OTMA 4R6JA 1K5DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCA B;  4CP6 A;  4LSA A;  2P1P B;  3RFE A;  1FQV A;  3WPC A;  4XSQ A;  3RJ0 A;  5IJD A;  4M7E C;  4Q3I A;  2ID5 A;  4U09 A;  3JB9 j;  5A5C A;  1O6V A;  1H6T A;  4LXS A;  4P8S A;  2P1O B;  2OMX A;  2Z65 A;  4B8C D;  2Z64 A;  4Y61 B;  3OJA A;  4QXE A;  3G3A A;  4FDW A;  3C6N B;  4NKG A;  1PGV A;  2AST B;  1IO0 A;  3UN9 A;  2JE0 A;  4L3F A;  4J0M A;  4CIL A;  5CMN A;  3E4G A;  3ZYN A;  4PSJ A;  5FTT B;  4U08 A;  2OMZ A;  2P1Q B;  4LSX C;  5HZL B;  3CVR A;  4XGO A;  3KJ4 A;  4CC4 C;  4R6G A;  4CC4 A;  3P72 A;  3WPI A;  3RGZ A;  2UZX A;  2V9S A;  2OMV A;  2XWT C;  1D0B A;  1XCD A;  4LI1 A;  4C2B B;  2ASS B;  3C6P B;  4PEQ B;  5B0T A;  4V2E A;  4OQT A;  1DCE A;  3OJA B;  3G3B A;  3O53 A;  1P8V A;  3RFS A;  4FS7 A;  4PQ8 A;  2RR6 A;  4MN8 B;  4CNM A;  1OTO A;  5GS2 B;  2XOT A;  1OGQ A;  3CIY A;  3WPE A;  3RIZ A;  3SB4 A;  4Q3G A;  1P9A G;  4WYK A;  4QC0 A;  3RW7 A;  1FO1 A;  3WPG A;  5GMG A;  1H6U A;  1O6S A;  1QYY A;  5CMP A;  3WPD A;  5GMF A;  2Z66 A;  2OMW A;  4Z94 G;  4LSC A;  4I6J B;  4Z64 C;  5LFN A;  4R6F A;  2O6Q A;  3CIG A;  4KNG A;  3OGM B;  4K17 A;  3TSR E;  4FMZ A;  3UL8 A;  1OZN A;  1KOO A;  4XOS A;  4GT6 A;  1OTN A;  4LXR A;  3ZYO A;  4GLP A;  3RFJ A;  3RGX A;  4AW4 A;  2OMU A;  4BSU A;  4G8A A;  3A79 B;  3ULA A;  4PER A;  4R58 A;  5B0N A;  3W3M A;  4AY9 X;  4R08 A;  3E2J A;  4H09 A;  3W3J A;  3W3L A;  4HQ1 A;  3C6O B;  3E3Z A;  2WQU A;  4U06 A;  5AWB A;  4R5D A;  2Q4G W;  1M10 B;  2WQW A;  2OMT A;  4ECO A;  3M19 A;  4L3A A;  4V2D A;  1FS2 A;  4FHO A;  4RCW A;  1M9S A;  1YRG A;  2R9U A;  4PKI G;  3O6N A;  4KXF B;  5AWD A;  2OMY A;  2V70 A;  1XEC A;  1XKU A;  3G04 C;  4J4L A;  4IM6 A;  2ELL A;  4WP6 A;  3WN4 A;  3ZYJ A;  2P1M B;  2RA8 A;  4NKH A;  4FCG A;  1P8T A;  1G9U A;  3W3N A;  2UZY A;  2P1N B;  1U0N D;  2JE1 A;  4ECN A;  5GS0 A;  3G39 A;  5IJC A;  4MQW X;  2Z62 A;  3UL9 A;  4CNC A;  2WFH A;  3BZ5 A;  1K5G C;  1GWB A;  5D3I A;  5AWA A;  3VQ1 A;  1OOK G;  3UL7 A;  4C2A B;  3DZE A;  4Z61 C;  4Z8G A;  3OGL B;  3FXI A;  4M7E A;  3ULU A;  4BV4 R;  5B4P A;  2O6S A;  4R07 A;  3GOZ A;  4P91 A;  3PMH G;  4YEB B;  5AWC A;  1FT8 A;  4BSR A;  1A9N A;  5AZ5 A;  2Z7X A;  1XWD C;  4U7L A;  4ARR A;  2Z63 A;  2WQV A;  1DFJ I;  2Z81 A;  1DS9 A;  1W8A A;  4LI2 A;  3VQ2 A;  4TZH A;  1M9L A;  2Y5Q A;  2A0Z A;  5IJB A;  4RWT C;  1JL5 A;  4ARN A;  1Z7X W;  4R5C A;  1KOH A;  3M18 A;  1A4Y A;  5IYX C;  1SQ0 B;  1M0Z A;  4R6A A;  3RW6 A;  1ZIW A;  1O6T A;  5GMH A;  2CA6 A;  2Z82 A;  4Q62 A;  4LSX A;  4EZG A;  3REZ A;  2BEX A;  3ULV A;  4V2C A;  4QBZ A;  4BSS A;  3G06 A;  2JQD A;  3WPB A;  4R09 A;  3WPF A;  3W3K A;  2WQX A;  2FT3 A;  3W3G A;  2O6R A;  3E6J A;  2Z7X B;  1XEU A;  4R0A A;  4KT1 A;  5GQR K;  1WWL A;  4Z79 A;  4FD0 A;  2BNH A;  5HDH A;  2V9T B;  2IFG A;  3WPH A;  1LTX A;  4UFR A;  3ZYI A;  3OGK B;  1OTM A;  4R6J A;  1K5D C; 
#chains in the Genus database with same CATH topology
 4RCA B;  4CP6 A;  4LSA A;  2P1P B;  3RFE A;  1FQV A;  3WPC A;  4XSQ A;  3RJ0 A;  5IJD A;  4M7E C;  4Q3I A;  2ID5 A;  4U09 A;  3JB9 j;  5A5C A;  1O6V A;  1H6T A;  4LXS A;  4P8S A;  2P1O B;  2OMX A;  2Z65 A;  4B8C D;  2Z64 A;  4Y61 B;  3OJA A;  4QXE A;  3G3A A;  4FDW A;  3C6N B;  4NKG A;  1PGV A;  2AST B;  1IO0 A;  3UN9 A;  2JE0 A;  4L3F A;  4J0M A;  4CIL A;  5CMN A;  3E4G A;  3ZYN A;  4PSJ A;  5FTT B;  4U08 A;  2OMZ A;  2P1Q B;  4LSX C;  5HZL B;  3CVR A;  4XGO A;  3KJ4 A;  4CC4 C;  4R6G A;  4CC4 A;  3P72 A;  4NZR M;  3WPI A;  3RGZ A;  2UZX A;  2V9S A;  2OMV A;  2XWT C;  1D0B A;  1XCD A;  4LI1 A;  4C2B B;  2ASS B;  3C6P B;  4PEQ B;  5B0T A;  4V2E A;  4OQT A;  1DCE A;  3OJA B;  3G3B A;  3O53 A;  1P8V A;  3RFS A;  4FS7 A;  4PQ8 A;  2RR6 A;  4MN8 B;  4CNM A;  1OTO A;  5GS2 B;  2XOT A;  1OGQ A;  3CIY A;  3WPE A;  3RIZ A;  3SB4 A;  4Q3G A;  1P9A G;  4WYK A;  4QC0 A;  3RW7 A;  1FO1 A;  3WPG A;  5GMG A;  1H6U A;  1O6S A;  1QYY A;  5CMP A;  3WPD A;  5GMF A;  2Z66 A;  2OMW A;  4Z94 G;  4LSC A;  4I6J B;  4Z64 C;  5LFN A;  4R6F A;  2O6Q A;  3CIG A;  4KNG A;  3OGM B;  4K17 A;  3TSR E;  4FMZ A;  3UL8 A;  1OZN A;  1KOO A;  4XOS A;  4GT6 A;  1OTN A;  4LXR A;  3ZYO A;  4GLP A;  3RFJ A;  3RGX A;  4AW4 A;  2OMU A;  4BSU A;  4G8A A;  3A79 B;  3ULA A;  4PER A;  4R58 A;  5B0N A;  3W3M A;  4AY9 X;  4R08 A;  3E2J A;  4H09 A;  3W3J A;  3W3L A;  4HQ1 A;  3C6O B;  3E3Z A;  2WQU A;  4U06 A;  5AWB A;  4R5D A;  2Q4G W;  1M10 B;  2WQW A;  2OMT A;  4ECO A;  3M19 A;  4L3A A;  4V2D A;  1FS2 A;  4FHO A;  4RCW A;  1M9S A;  1YRG A;  2R9U A;  4PKI G;  3O6N A;  4KXF B;  5AWD A;  2OMY A;  2V70 A;  1XEC A;  1XKU A;  3G04 C;  4J4L A;  4IM6 A;  2ELL A;  4WP6 A;  3WN4 A;  3ZYJ A;  2P1M B;  2RA8 A;  4NKH A;  4FCG A;  1P8T A;  1G9U A;  3W3N A;  2UZY A;  2P1N B;  1U0N D;  2JE1 A;  4ECN A;  4NZT M;  5GS0 A;  3G39 A;  5IJC A;  4MQW X;  2Z62 A;  3UL9 A;  4CNC A;  2WFH A;  3BZ5 A;  1K5G C;  1GWB A;  5D3I A;  5AWA A;  3VQ1 A;  1OOK G;  3UL7 A;  4C2A B;  3DZE A;  4Z61 C;  4Z8G A;  3OGL B;  3FXI A;  4M7E A;  3ULU A;  4BV4 R;  5B4P A;  2O6S A;  4R07 A;  3GOZ A;  4P91 A;  3PMH G;  4YEB B;  5AWC A;  1FT8 A;  4BSR A;  1A9N A;  5AZ5 A;  2Z7X A;  1XWD C;  4U7L A;  4ARR A;  2Z63 A;  2WQV A;  1DFJ I;  2Z81 A;  1DS9 A;  1W8A A;  4LI2 A;  3VQ2 A;  4TZH A;  1M9L A;  2Y5Q A;  2A0Z A;  5IJB A;  4RWT C;  1JL5 A;  4ARN A;  1Z7X W;  4R5C A;  1KOH A;  3M18 A;  1A4Y A;  5IYX C;  1SQ0 B;  1M0Z A;  4R6A A;  3RW6 A;  1ZIW A;  1O6T A;  5GMH A;  2CA6 A;  2Z82 A;  4Q62 A;  4LSX A;  4EZG A;  3REZ A;  2BEX A;  3ULV A;  4V2C A;  4QBZ A;  4BSS A;  3G06 A;  2JQD A;  3WPB A;  4R09 A;  3WPF A;  3W3K A;  2WQX A;  2FT3 A;  3W3G A;  2O6R A;  3E6J A;  2Z7X B;  1XEU A;  4R0A A;  4KT1 A;  5GQR K;  1WWL A;  4Z79 A;  4FD0 A;  2BNH A;  5HDH A;  2V9T B;  2IFG A;  3WPH A;  1LTX A;  4UFR A;  3ZYI A;  3OGK B;  1OTM A;  4R6J A;  1K5D C; 
#chains in the Genus database with same CATH homology
 4RCA B;  4CP6 A;  4LSA A;  2P1P B;  3RFE A;  1FQV A;  3WPC A;  4XSQ A;  3RJ0 A;  5IJD A;  4M7E C;  4Q3I A;  2ID5 A;  4U09 A;  3JB9 j;  5A5C A;  1O6V A;  1H6T A;  4LXS A;  4P8S A;  2P1O B;  2OMX A;  2Z65 A;  4B8C D;  2Z64 A;  4Y61 B;  3OJA A;  4QXE A;  3G3A A;  4FDW A;  3C6N B;  4NKG A;  1PGV A;  2AST B;  1IO0 A;  3UN9 A;  2JE0 A;  4L3F A;  4J0M A;  4CIL A;  5CMN A;  3E4G A;  3ZYN A;  4PSJ A;  5FTT B;  4U08 A;  2OMZ A;  2P1Q B;  4LSX C;  5HZL B;  3CVR A;  4XGO A;  3KJ4 A;  4CC4 C;  4R6G A;  4CC4 A;  3P72 A;  3WPI A;  3RGZ A;  2UZX A;  2V9S A;  2OMV A;  2XWT C;  1D0B A;  1XCD A;  4LI1 A;  4C2B B;  2ASS B;  3C6P B;  4PEQ B;  5B0T A;  4V2E A;  4OQT A;  1DCE A;  3OJA B;  3G3B A;  3O53 A;  1P8V A;  3RFS A;  4FS7 A;  4PQ8 A;  2RR6 A;  4MN8 B;  4CNM A;  1OTO A;  5GS2 B;  2XOT A;  1OGQ A;  3CIY A;  3WPE A;  3RIZ A;  3SB4 A;  4Q3G A;  1P9A G;  4WYK A;  4QC0 A;  3RW7 A;  1FO1 A;  3WPG A;  5GMG A;  1H6U A;  1O6S A;  1QYY A;  5CMP A;  3WPD A;  5GMF A;  2Z66 A;  2OMW A;  4Z94 G;  4LSC A;  4I6J B;  4Z64 C;  5LFN A;  4R6F A;  2O6Q A;  3CIG A;  4KNG A;  3OGM B;  4K17 A;  3TSR E;  4FMZ A;  3UL8 A;  1OZN A;  1KOO A;  4XOS A;  4GT6 A;  1OTN A;  4LXR A;  3ZYO A;  4GLP A;  3RFJ A;  3RGX A;  4AW4 A;  2OMU A;  4BSU A;  4G8A A;  3A79 B;  3ULA A;  4PER A;  4R58 A;  5B0N A;  3W3M A;  4AY9 X;  4R08 A;  3E2J A;  4H09 A;  3W3J A;  3W3L A;  4HQ1 A;  3C6O B;  3E3Z A;  2WQU A;  4U06 A;  5AWB A;  4R5D A;  2Q4G W;  1M10 B;  2WQW A;  2OMT A;  4ECO A;  3M19 A;  4L3A A;  4V2D A;  1FS2 A;  4FHO A;  4RCW A;  1M9S A;  1YRG A;  2R9U A;  4PKI G;  3O6N A;  4KXF B;  5AWD A;  2OMY A;  2V70 A;  1XEC A;  1XKU A;  3G04 C;  4J4L A;  4IM6 A;  2ELL A;  4WP6 A;  3WN4 A;  3ZYJ A;  2P1M B;  2RA8 A;  4NKH A;  4FCG A;  1P8T A;  1G9U A;  3W3N A;  2UZY A;  2P1N B;  1U0N D;  2JE1 A;  4ECN A;  5GS0 A;  3G39 A;  5IJC A;  4MQW X;  2Z62 A;  3UL9 A;  4CNC A;  2WFH A;  3BZ5 A;  1K5G C;  1GWB A;  5D3I A;  5AWA A;  3VQ1 A;  1OOK G;  3UL7 A;  4C2A B;  3DZE A;  4Z61 C;  4Z8G A;  3OGL B;  3FXI A;  4M7E A;  3ULU A;  4BV4 R;  5B4P A;  2O6S A;  4R07 A;  3GOZ A;  4P91 A;  3PMH G;  4YEB B;  5AWC A;  1FT8 A;  4BSR A;  1A9N A;  5AZ5 A;  2Z7X A;  1XWD C;  4U7L A;  4ARR A;  2Z63 A;  2WQV A;  1DFJ I;  2Z81 A;  1DS9 A;  1W8A A;  4LI2 A;  3VQ2 A;  4TZH A;  1M9L A;  2Y5Q A;  2A0Z A;  5IJB A;  4RWT C;  1JL5 A;  4ARN A;  1Z7X W;  4R5C A;  1KOH A;  3M18 A;  1A4Y A;  5IYX C;  1SQ0 B;  1M0Z A;  4R6A A;  3RW6 A;  1ZIW A;  1O6T A;  5GMH A;  2CA6 A;  2Z82 A;  4Q62 A;  4LSX A;  4EZG A;  3REZ A;  2BEX A;  3ULV A;  4V2C A;  4QBZ A;  4BSS A;  3G06 A;  2JQD A;  3WPB A;  4R09 A;  3WPF A;  3W3K A;  2WQX A;  2FT3 A;  3W3G A;  2O6R A;  3E6J A;  2Z7X B;  1XEU A;  4R0A A;  4KT1 A;  5GQR K;  1WWL A;  4Z79 A;  4FD0 A;  2BNH A;  5HDH A;  2V9T B;  2IFG A;  3WPH A;  1LTX A;  4UFR A;  3ZYI A;  3OGK B;  1OTM A;  4R6J A;  1K5D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...