3JB9j

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
160
Chain Sequence
MRLNAEFLSQVPSFISPLKETELDLRQIPIIENLGVLRDVHDAIDFTDNDIRYLGNFPRMKRLQTLLCGNNRITAIAPDIGKVLPNLKTLSLAQNHLQEIADLDPLASCPQLTNLSCIDNPVAQKQYYRLYLIWRIPSLHILDFERVRRNERLRAEEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 47
structure length 160
sequence length 162
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3jb9j00
3WPDA 1M10B 2P1QB 3W3JA 3TSRE 3G3AA 4Q3IA 3GOZA 2Y5QA 4PSJA 4LSAA 4BSUA 3WPEA 1W8AA 4R6AA 4V2DA 3RW7A 1P8VA 2BEXA 4PEQB 4BSRA 3OGLB 3E6JA 4CP6A 2WQVA 5IJDA 1O6SA 1ZIWA 4WYKA 4M7EC 2Q4GW 3ZYJA 4EZGA 4FHOA 4FCGA 4U7LA 4LI2A 4QXEA 5AWBA 3WPGA 4CILA 3ZYIA 3C6OB 2P1MB 2Z63A 3P72A 4U08A 4Q3GA 4R09A 4WP6A 1OTOA 4ECNA 1XWDC 1K5GC 4QC0A 5AWAA 4J0MA 2Z82A 5AWCA 3E3ZA 3ULUA 4R07A 2WFHA 1D0BA 3REZA 4XSQA 4U09A 2O6RA 2FT3A 4FD0A 1DFJI 1P8TA 4RCAB 4OQTA 2O6QA 1A4YA 2XOTA 3SB4A 4FS7A 5GS2B 4LI1A 3JB9j 3CIYA 4FMZA 3ZYNA 1WWLA 3WPIA 2Z81A 4Z94G 3RGZA 3KJ4A 3OGMB 2UZXA 3W3KA 1JL5A 2XWTC 4B8CD 3CIGA 3WPFA 3FXIA 1YRGA 4PQ8A 3RJ0A 4XOSA 4K17A 4L3FA 4Q62A 1FO1A 3O53A 4H09A 3OJAA 1OOKG 3G06A 4R6JA 4KNGA 3ZYOA 4LSCA 4I6JB 3W3GA 1GWBA 5AWDA 3C6PB 1LTXA 4ECOA 4M7EA 5GQRK 4AW4A 4LSXC 3M19A 3M18A 1QYYA 4XGOA 3RFEA 3G3BA 4CC4C 4GLPA 3CVRA 4R5CA 1KOHA 1SQ0B 3W3NA 4R08A 4R5DA 2WQWA 1OTMA 3VQ2A 5A5CA 2V9SA 4BV4R 3G04C 2OMXA 2O6SA 3E2JA 4Y61B 4NKGA 3ULAA 4LXRA 3UL9A 4FDWA 4ARRA 2OMZA 5CMPA 3WPHA 5HZLB 4LXSA 1FT8A 2Z62A 4C2BB 2WQUA 3DZEA 3G39A 3C6NB 3UL7A 2JE1A 4R0AA 1XECA 3WN4A 5IJCA 4G8AA 3RIZA 2A0ZA 4PERA 4IM6A 1M9LA 4MQWX 4R6GA 1PGVA 1XCDA 3RGXA 3BZ5A 4QBZA 2CA6A 4P8SA 4V2EA 1KOOA 4MN8B 2ELLA 4AY9X 5GMGA 4U06A 4J4LA 1O6VA 2Z66A 1H6UA 2JQDA 3OGKB 4V2CA 2WQXA 3UL8A 4GT6A 4LSXA 2P1OB 2UZYA 2P1NB 1IO0A 1A9NA 3VQ1A 2ID5A 4KT1A 2V9TB 4CC4A 1P9AG 4CNCA 2RA8A 5HDHA 1DS9A 4P91A 2ASTB 4ARNA 4BSSA 2OMUA 1FQVA 1XKUA 3RFSA 2R9UA 4Z64C 2Z65A 2JE0A 2Z7XB 1U0ND 5B0NA 5LFNA 1M0ZA 2BNHA 4HQ1A 1XEUA 5CMNA 2OMVA 3PMHG 5IYXC 1OGQA 4L3AA 2OMYA 1G9UA 3UN9A 4CNMA 4Z79A 5GS0A 2Z7XA 2OMWA 5AZ5A 2V70A 5FTTB 4RCWA 2OMTA 1O6TA 4PKIG 2RR6A 3W3MA 3WPCA 3A79B 4NKHA 1H6TA 5GMFA 5B0TA 4YEBB 4UFRA 2P1PB 3RW6A 4R6FA 3ULVA 5D3IA 1Z7XW 1FS2A 4Z8GA 3WPBA 2ASSB 2Z64A 4Z61C 1DCEA 3RFJA 5GMHA 4C2AB 4RWTC 3OJAB 4TZHA 1M9SA 1OTNA 1K5DC 4R58A 1OZNA 2IFGA 5B4PA 5IJBA 3W3LA 4KXFB 3O6NA 3E4GA
chains in the Genus database with same CATH superfamily
3WPDA 1M10B 2P1QB 3W3JA 3TSRE 3G3AA 4Q3IA 3GOZA 2Y5QA 4PSJA 4LSAA 4BSUA 3WPEA 1W8AA 4R6AA 4V2DA 3RW7A 1P8VA 2BEXA 4PEQB 4BSRA 3OGLB 3E6JA 4CP6A 2WQVA 5IJDA 1O6SA 1ZIWA 4WYKA 4M7EC 2Q4GW 3ZYJA 4EZGA 4FHOA 4FCGA 4U7LA 4LI2A 4QXEA 5AWBA 3WPGA 4CILA 3ZYIA 3C6OB 2P1MB 2Z63A 3P72A 4U08A 4Q3GA 4R09A 4WP6A 1OTOA 4ECNA 1XWDC 1K5GC 4QC0A 5AWAA 4J0MA 2Z82A 5AWCA 3E3ZA 3ULUA 4R07A 2WFHA 1D0BA 3REZA 4XSQA 4U09A 2O6RA 2FT3A 4FD0A 1DFJI 1P8TA 4RCAB 4OQTA 2O6QA 1A4YA 2XOTA 3SB4A 4FS7A 5GS2B 4LI1A 3JB9j 3CIYA 4FMZA 3ZYNA 1WWLA 3WPIA 2Z81A 4Z94G 3RGZA 3KJ4A 3OGMB 2UZXA 3W3KA 1JL5A 2XWTC 4B8CD 3CIGA 3WPFA 3FXIA 1YRGA 4PQ8A 3RJ0A 4XOSA 4K17A 4L3FA 4Q62A 1FO1A 3O53A 4H09A 3OJAA 1OOKG 3G06A 4R6JA 4KNGA 3ZYOA 4LSCA 4I6JB 3W3GA 1GWBA 5AWDA 3C6PB 1LTXA 4ECOA 4M7EA 5GQRK 4AW4A 4LSXC 3M19A 3M18A 1QYYA 4XGOA 3RFEA 3G3BA 4CC4C 4GLPA 3CVRA 4R5CA 1KOHA 1SQ0B 3W3NA 4R08A 4R5DA 2WQWA 1OTMA 3VQ2A 5A5CA 2V9SA 4BV4R 3G04C 2OMXA 2O6SA 3E2JA 4Y61B 4NKGA 3ULAA 4LXRA 3UL9A 4FDWA 4ARRA 2OMZA 5CMPA 3WPHA 5HZLB 4LXSA 4NZRM 1FT8A 2Z62A 4C2BB 2WQUA 3DZEA 3G39A 3C6NB 3UL7A 2JE1A 4R0AA 1XECA 3WN4A 5IJCA 4G8AA 3RIZA 2A0ZA 4PERA 4IM6A 1M9LA 4MQWX 4R6GA 1PGVA 1XCDA 3RGXA 3BZ5A 4QBZA 2CA6A 4P8SA 4V2EA 1KOOA 4MN8B 2ELLA 4AY9X 5GMGA 4NZTM 4U06A 4J4LA 1O6VA 2Z66A 1H6UA 2JQDA 3OGKB 4V2CA 2WQXA 3UL8A 4GT6A 4LSXA 2P1OB 2UZYA 2P1NB 1IO0A 1A9NA 3VQ1A 2ID5A 4KT1A 2V9TB 4CC4A 1P9AG 4CNCA 2RA8A 5HDHA 1DS9A 4P91A 2ASTB 4ARNA 4BSSA 2OMUA 1FQVA 1XKUA 3RFSA 2R9UA 4Z64C 2Z65A 2JE0A 2Z7XB 1U0ND 5B0NA 5LFNA 1M0ZA 2BNHA 4HQ1A 1XEUA 5CMNA 2OMVA 3PMHG 5IYXC 1OGQA 4L3AA 2OMYA 1G9UA 3UN9A 4CNMA 4Z79A 5GS0A 2Z7XA 2OMWA 5AZ5A 2V70A 5FTTB 4RCWA 2OMTA 1O6TA 4PKIG 2RR6A 3W3MA 3WPCA 3A79B 4NKHA 1H6TA 5GMFA 5B0TA 4YEBB 4UFRA 2P1PB 3RW6A 4R6FA 3ULVA 5D3IA 1Z7XW 1FS2A 4Z8GA 3WPBA 2ASSB 2Z64A 4Z61C 1DCEA 3RFJA 5GMHA 4C2AB 4RWTC 3OJAB 4TZHA 1M9SA 1OTNA 1K5DC 4R58A 1OZNA 2IFGA 5B4PA 5IJBA 3W3LA 4KXFB 3O6NA 3E4GA
chains in the Genus database with same CATH topology
3WPDA 1M10B 2P1QB 3W3JA 3TSRE 3G3AA 4Q3IA 3GOZA 2Y5QA 4PSJA 4LSAA 4BSUA 3WPEA 1W8AA 4R6AA 4V2DA 3RW7A 1P8VA 2BEXA 4PEQB 4BSRA 3OGLB 3E6JA 4CP6A 2WQVA 5IJDA 1O6SA 1ZIWA 4WYKA 4M7EC 2Q4GW 3ZYJA 4EZGA 4FHOA 4FCGA 4U7LA 4LI2A 4QXEA 5AWBA 3WPGA 4CILA 3ZYIA 3C6OB 2P1MB 2Z63A 3P72A 4U08A 4Q3GA 4R09A 4WP6A 1OTOA 4ECNA 1XWDC 1K5GC 4QC0A 5AWAA 4J0MA 2Z82A 5AWCA 3E3ZA 3ULUA 4R07A 2WFHA 1D0BA 3REZA 4XSQA 4U09A 2O6RA 2FT3A 4FD0A 1DFJI 1P8TA 4RCAB 4OQTA 2O6QA 1A4YA 2XOTA 3SB4A 4FS7A 5GS2B 4LI1A 3JB9j 3CIYA 4FMZA 3ZYNA 1WWLA 3WPIA 2Z81A 4Z94G 3RGZA 3KJ4A 3OGMB 2UZXA 3W3KA 1JL5A 2XWTC 4B8CD 3CIGA 3WPFA 3FXIA 1YRGA 4PQ8A 3RJ0A 4XOSA 4K17A 4L3FA 4Q62A 1FO1A 3O53A 4H09A 3OJAA 1OOKG 3G06A 4R6JA 4KNGA 3ZYOA 4LSCA 4I6JB 3W3GA 1GWBA 5AWDA 3C6PB 1LTXA 4ECOA 4M7EA 5GQRK 4AW4A 4LSXC 3M19A 3M18A 1QYYA 4XGOA 3RFEA 3G3BA 4CC4C 4GLPA 3CVRA 4R5CA 1KOHA 1SQ0B 3W3NA 4R08A 4R5DA 2WQWA 1OTMA 3VQ2A 5A5CA 2V9SA 4BV4R 3G04C 2OMXA 2O6SA 3E2JA 4Y61B 4NKGA 3ULAA 4LXRA 3UL9A 4FDWA 4ARRA 2OMZA 5CMPA 3WPHA 5HZLB 4LXSA 1FT8A 2Z62A 4C2BB 2WQUA 3DZEA 3G39A 3C6NB 3UL7A 2JE1A 4R0AA 1XECA 3WN4A 5IJCA 4G8AA 3RIZA 2A0ZA 4PERA 4IM6A 1M9LA 4MQWX 4R6GA 1PGVA 1XCDA 3RGXA 3BZ5A 4QBZA 2CA6A 4P8SA 4V2EA 1KOOA 4MN8B 2ELLA 4AY9X 5GMGA 4U06A 4J4LA 1O6VA 2Z66A 1H6UA 2JQDA 3OGKB 4V2CA 2WQXA 3UL8A 4GT6A 4LSXA 2P1OB 2UZYA 2P1NB 1IO0A 1A9NA 3VQ1A 2ID5A 4KT1A 2V9TB 4CC4A 1P9AG 4CNCA 2RA8A 5HDHA 1DS9A 4P91A 2ASTB 4ARNA 4BSSA 2OMUA 1FQVA 1XKUA 3RFSA 2R9UA 4Z64C 2Z65A 2JE0A 2Z7XB 1U0ND 5B0NA 5LFNA 1M0ZA 2BNHA 4HQ1A 1XEUA 5CMNA 2OMVA 3PMHG 5IYXC 1OGQA 4L3AA 2OMYA 1G9UA 3UN9A 4CNMA 4Z79A 5GS0A 2Z7XA 2OMWA 5AZ5A 2V70A 5FTTB 4RCWA 2OMTA 1O6TA 4PKIG 2RR6A 3W3MA 3WPCA 3A79B 4NKHA 1H6TA 5GMFA 5B0TA 4YEBB 4UFRA 2P1PB 3RW6A 4R6FA 3ULVA 5D3IA 1Z7XW 1FS2A 4Z8GA 3WPBA 2ASSB 2Z64A 4Z61C 1DCEA 3RFJA 5GMHA 4C2AB 4RWTC 3OJAB 4TZHA 1M9SA 1OTNA 1K5DC 4R58A 1OZNA 2IFGA 5B4PA 5IJBA 3W3LA 4KXFB 3O6NA 3E4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPD A;  1M10 B;  2P1Q B;  3W3J A;  3TSR E;  3G3A A;  4Q3I A;  3GOZ A;  2Y5Q A;  4PSJ A;  4LSA A;  4BSU A;  3WPE A;  1W8A A;  4R6A A;  4V2D A;  3RW7 A;  1P8V A;  2BEX A;  4PEQ B;  4BSR A;  3OGL B;  3E6J A;  4CP6 A;  2WQV A;  5IJD A;  1O6S A;  1ZIW A;  4WYK A;  4M7E C;  2Q4G W;  3ZYJ A;  4EZG A;  4FHO A;  4FCG A;  4U7L A;  4LI2 A;  4QXE A;  5AWB A;  3WPG A;  4CIL A;  3ZYI A;  3C6O B;  2P1M B;  2Z63 A;  3P72 A;  4U08 A;  4Q3G A;  4R09 A;  4WP6 A;  1OTO A;  4ECN A;  1XWD C;  1K5G C;  4QC0 A;  5AWA A;  4J0M A;  2Z82 A;  5AWC A;  3E3Z A;  3ULU A;  4R07 A;  2WFH A;  1D0B A;  3REZ A;  4XSQ A;  4U09 A;  2O6R A;  2FT3 A;  4FD0 A;  1DFJ I;  1P8T A;  4RCA B;  4OQT A;  2O6Q A;  1A4Y A;  2XOT A;  3SB4 A;  4FS7 A;  5GS2 B;  4LI1 A;  3JB9 j;  3CIY A;  4FMZ A;  3ZYN A;  1WWL A;  3WPI A;  2Z81 A;  4Z94 G;  3RGZ A;  3KJ4 A;  3OGM B;  2UZX A;  3W3K A;  1JL5 A;  2XWT C;  4B8C D;  3CIG A;  3WPF A;  3FXI A;  1YRG A;  4PQ8 A;  3RJ0 A;  4XOS A;  4K17 A;  4L3F A;  4Q62 A;  1FO1 A;  3O53 A;  4H09 A;  3OJA A;  1OOK G;  3G06 A;  4R6J A;  4KNG A;  3ZYO A;  4LSC A;  4I6J B;  3W3G A;  1GWB A;  5AWD A;  3C6P B;  1LTX A;  4ECO A;  4M7E A;  5GQR K;  4AW4 A;  4LSX C;  3M19 A;  3M18 A;  1QYY A;  4XGO A;  3RFE A;  3G3B A;  4CC4 C;  4GLP A;  3CVR A;  4R5C A;  1KOH A;  1SQ0 B;  3W3N A;  4R08 A;  4R5D A;  2WQW A;  1OTM A;  3VQ2 A;  5A5C A;  2V9S A;  4BV4 R;  3G04 C;  2OMX A;  2O6S A;  3E2J A;  4Y61 B;  4NKG A;  3ULA A;  4LXR A;  3UL9 A;  4FDW A;  4ARR A;  2OMZ A;  5CMP A;  3WPH A;  5HZL B;  4LXS A;  1FT8 A;  2Z62 A;  4C2B B;  2WQU A;  3DZE A;  3G39 A;  3C6N B;  3UL7 A;  2JE1 A;  4R0A A;  1XEC A;  3WN4 A;  5IJC A;  4G8A A;  3RIZ A;  2A0Z A;  4PER A;  4IM6 A;  1M9L A;  4MQW X;  4R6G A;  1PGV A;  1XCD A;  3RGX A;  3BZ5 A;  4QBZ A;  2CA6 A;  4P8S A;  4V2E A;  1KOO A;  4MN8 B;  2ELL A;  4AY9 X;  5GMG A;  4U06 A;  4J4L A;  1O6V A;  2Z66 A;  1H6U A;  2JQD A;  3OGK B;  4V2C A;  2WQX A;  3UL8 A;  4GT6 A;  4LSX A;  2P1O B;  2UZY A;  2P1N B;  1IO0 A;  1A9N A;  3VQ1 A;  2ID5 A;  4KT1 A;  2V9T B;  4CC4 A;  1P9A G;  4CNC A;  2RA8 A;  5HDH A;  1DS9 A;  4P91 A;  2AST B;  4ARN A;  4BSS A;  2OMU A;  1FQV A;  1XKU A;  3RFS A;  2R9U A;  4Z64 C;  2Z65 A;  2JE0 A;  2Z7X B;  1U0N D;  5B0N A;  5LFN A;  1M0Z A;  2BNH A;  4HQ1 A;  1XEU A;  5CMN A;  2OMV A;  3PMH G;  5IYX C;  1OGQ A;  4L3A A;  2OMY A;  1G9U A;  3UN9 A;  4CNM A;  4Z79 A;  5GS0 A;  2Z7X A;  2OMW A;  5AZ5 A;  2V70 A;  5FTT B;  4RCW A;  2OMT A;  1O6T A;  4PKI G;  2RR6 A;  3W3M A;  3WPC A;  3A79 B;  4NKH A;  1H6T A;  5GMF A;  5B0T A;  4YEB B;  4UFR A;  2P1P B;  3RW6 A;  4R6F A;  3ULV A;  5D3I A;  1Z7X W;  1FS2 A;  4Z8G A;  3WPB A;  2ASS B;  2Z64 A;  4Z61 C;  1DCE A;  3RFJ A;  5GMH A;  4C2A B;  4RWT C;  3OJA B;  4TZH A;  1M9S A;  1OTN A;  1K5D C;  4R58 A;  1OZN A;  2IFG A;  5B4P A;  5IJB A;  3W3L A;  4KXF B;  3O6N A;  3E4G A; 
#chains in the Genus database with same CATH topology
 3WPD A;  1M10 B;  2P1Q B;  3W3J A;  3TSR E;  3G3A A;  4Q3I A;  3GOZ A;  2Y5Q A;  4PSJ A;  4LSA A;  4BSU A;  3WPE A;  1W8A A;  4R6A A;  4V2D A;  3RW7 A;  1P8V A;  2BEX A;  4PEQ B;  4BSR A;  3OGL B;  3E6J A;  4CP6 A;  2WQV A;  5IJD A;  1O6S A;  1ZIW A;  4WYK A;  4M7E C;  2Q4G W;  3ZYJ A;  4EZG A;  4FHO A;  4FCG A;  4U7L A;  4LI2 A;  4QXE A;  5AWB A;  3WPG A;  4CIL A;  3ZYI A;  3C6O B;  2P1M B;  2Z63 A;  3P72 A;  4U08 A;  4Q3G A;  4R09 A;  4WP6 A;  1OTO A;  4ECN A;  1XWD C;  1K5G C;  4QC0 A;  5AWA A;  4J0M A;  2Z82 A;  5AWC A;  3E3Z A;  3ULU A;  4R07 A;  2WFH A;  1D0B A;  3REZ A;  4XSQ A;  4U09 A;  2O6R A;  2FT3 A;  4FD0 A;  1DFJ I;  1P8T A;  4RCA B;  4OQT A;  2O6Q A;  1A4Y A;  2XOT A;  3SB4 A;  4FS7 A;  5GS2 B;  4LI1 A;  3JB9 j;  3CIY A;  4FMZ A;  3ZYN A;  1WWL A;  3WPI A;  2Z81 A;  4Z94 G;  3RGZ A;  3KJ4 A;  3OGM B;  2UZX A;  3W3K A;  1JL5 A;  2XWT C;  4B8C D;  3CIG A;  3WPF A;  3FXI A;  1YRG A;  4PQ8 A;  3RJ0 A;  4XOS A;  4K17 A;  4L3F A;  4Q62 A;  1FO1 A;  3O53 A;  4H09 A;  3OJA A;  1OOK G;  3G06 A;  4R6J A;  4KNG A;  3ZYO A;  4LSC A;  4I6J B;  3W3G A;  1GWB A;  5AWD A;  3C6P B;  1LTX A;  4ECO A;  4M7E A;  5GQR K;  4AW4 A;  4LSX C;  3M19 A;  3M18 A;  1QYY A;  4XGO A;  3RFE A;  3G3B A;  4CC4 C;  4GLP A;  3CVR A;  4R5C A;  1KOH A;  1SQ0 B;  3W3N A;  4R08 A;  4R5D A;  2WQW A;  1OTM A;  3VQ2 A;  5A5C A;  2V9S A;  4BV4 R;  3G04 C;  2OMX A;  2O6S A;  3E2J A;  4Y61 B;  4NKG A;  3ULA A;  4LXR A;  3UL9 A;  4FDW A;  4ARR A;  2OMZ A;  5CMP A;  3WPH A;  5HZL B;  4LXS A;  4NZR M;  1FT8 A;  2Z62 A;  4C2B B;  2WQU A;  3DZE A;  3G39 A;  3C6N B;  3UL7 A;  2JE1 A;  4R0A A;  1XEC A;  3WN4 A;  5IJC A;  4G8A A;  3RIZ A;  2A0Z A;  4PER A;  4IM6 A;  1M9L A;  4MQW X;  4R6G A;  1PGV A;  1XCD A;  3RGX A;  3BZ5 A;  4QBZ A;  2CA6 A;  4P8S A;  4V2E A;  1KOO A;  4MN8 B;  2ELL A;  4AY9 X;  5GMG A;  4NZT M;  4U06 A;  4J4L A;  1O6V A;  2Z66 A;  1H6U A;  2JQD A;  3OGK B;  4V2C A;  2WQX A;  3UL8 A;  4GT6 A;  4LSX A;  2P1O B;  2UZY A;  2P1N B;  1IO0 A;  1A9N A;  3VQ1 A;  2ID5 A;  4KT1 A;  2V9T B;  4CC4 A;  1P9A G;  4CNC A;  2RA8 A;  5HDH A;  1DS9 A;  4P91 A;  2AST B;  4ARN A;  4BSS A;  2OMU A;  1FQV A;  1XKU A;  3RFS A;  2R9U A;  4Z64 C;  2Z65 A;  2JE0 A;  2Z7X B;  1U0N D;  5B0N A;  5LFN A;  1M0Z A;  2BNH A;  4HQ1 A;  1XEU A;  5CMN A;  2OMV A;  3PMH G;  5IYX C;  1OGQ A;  4L3A A;  2OMY A;  1G9U A;  3UN9 A;  4CNM A;  4Z79 A;  5GS0 A;  2Z7X A;  2OMW A;  5AZ5 A;  2V70 A;  5FTT B;  4RCW A;  2OMT A;  1O6T A;  4PKI G;  2RR6 A;  3W3M A;  3WPC A;  3A79 B;  4NKH A;  1H6T A;  5GMF A;  5B0T A;  4YEB B;  4UFR A;  2P1P B;  3RW6 A;  4R6F A;  3ULV A;  5D3I A;  1Z7X W;  1FS2 A;  4Z8G A;  3WPB A;  2ASS B;  2Z64 A;  4Z61 C;  1DCE A;  3RFJ A;  5GMH A;  4C2A B;  4RWT C;  3OJA B;  4TZH A;  1M9S A;  1OTN A;  1K5D C;  4R58 A;  1OZN A;  2IFG A;  5B4P A;  5IJB A;  3W3L A;  4KXF B;  3O6N A;  3E4G A; 
#chains in the Genus database with same CATH homology
 3WPD A;  1M10 B;  2P1Q B;  3W3J A;  3TSR E;  3G3A A;  4Q3I A;  3GOZ A;  2Y5Q A;  4PSJ A;  4LSA A;  4BSU A;  3WPE A;  1W8A A;  4R6A A;  4V2D A;  3RW7 A;  1P8V A;  2BEX A;  4PEQ B;  4BSR A;  3OGL B;  3E6J A;  4CP6 A;  2WQV A;  5IJD A;  1O6S A;  1ZIW A;  4WYK A;  4M7E C;  2Q4G W;  3ZYJ A;  4EZG A;  4FHO A;  4FCG A;  4U7L A;  4LI2 A;  4QXE A;  5AWB A;  3WPG A;  4CIL A;  3ZYI A;  3C6O B;  2P1M B;  2Z63 A;  3P72 A;  4U08 A;  4Q3G A;  4R09 A;  4WP6 A;  1OTO A;  4ECN A;  1XWD C;  1K5G C;  4QC0 A;  5AWA A;  4J0M A;  2Z82 A;  5AWC A;  3E3Z A;  3ULU A;  4R07 A;  2WFH A;  1D0B A;  3REZ A;  4XSQ A;  4U09 A;  2O6R A;  2FT3 A;  4FD0 A;  1DFJ I;  1P8T A;  4RCA B;  4OQT A;  2O6Q A;  1A4Y A;  2XOT A;  3SB4 A;  4FS7 A;  5GS2 B;  4LI1 A;  3JB9 j;  3CIY A;  4FMZ A;  3ZYN A;  1WWL A;  3WPI A;  2Z81 A;  4Z94 G;  3RGZ A;  3KJ4 A;  3OGM B;  2UZX A;  3W3K A;  1JL5 A;  2XWT C;  4B8C D;  3CIG A;  3WPF A;  3FXI A;  1YRG A;  4PQ8 A;  3RJ0 A;  4XOS A;  4K17 A;  4L3F A;  4Q62 A;  1FO1 A;  3O53 A;  4H09 A;  3OJA A;  1OOK G;  3G06 A;  4R6J A;  4KNG A;  3ZYO A;  4LSC A;  4I6J B;  3W3G A;  1GWB A;  5AWD A;  3C6P B;  1LTX A;  4ECO A;  4M7E A;  5GQR K;  4AW4 A;  4LSX C;  3M19 A;  3M18 A;  1QYY A;  4XGO A;  3RFE A;  3G3B A;  4CC4 C;  4GLP A;  3CVR A;  4R5C A;  1KOH A;  1SQ0 B;  3W3N A;  4R08 A;  4R5D A;  2WQW A;  1OTM A;  3VQ2 A;  5A5C A;  2V9S A;  4BV4 R;  3G04 C;  2OMX A;  2O6S A;  3E2J A;  4Y61 B;  4NKG A;  3ULA A;  4LXR A;  3UL9 A;  4FDW A;  4ARR A;  2OMZ A;  5CMP A;  3WPH A;  5HZL B;  4LXS A;  1FT8 A;  2Z62 A;  4C2B B;  2WQU A;  3DZE A;  3G39 A;  3C6N B;  3UL7 A;  2JE1 A;  4R0A A;  1XEC A;  3WN4 A;  5IJC A;  4G8A A;  3RIZ A;  2A0Z A;  4PER A;  4IM6 A;  1M9L A;  4MQW X;  4R6G A;  1PGV A;  1XCD A;  3RGX A;  3BZ5 A;  4QBZ A;  2CA6 A;  4P8S A;  4V2E A;  1KOO A;  4MN8 B;  2ELL A;  4AY9 X;  5GMG A;  4U06 A;  4J4L A;  1O6V A;  2Z66 A;  1H6U A;  2JQD A;  3OGK B;  4V2C A;  2WQX A;  3UL8 A;  4GT6 A;  4LSX A;  2P1O B;  2UZY A;  2P1N B;  1IO0 A;  1A9N A;  3VQ1 A;  2ID5 A;  4KT1 A;  2V9T B;  4CC4 A;  1P9A G;  4CNC A;  2RA8 A;  5HDH A;  1DS9 A;  4P91 A;  2AST B;  4ARN A;  4BSS A;  2OMU A;  1FQV A;  1XKU A;  3RFS A;  2R9U A;  4Z64 C;  2Z65 A;  2JE0 A;  2Z7X B;  1U0N D;  5B0N A;  5LFN A;  1M0Z A;  2BNH A;  4HQ1 A;  1XEU A;  5CMN A;  2OMV A;  3PMH G;  5IYX C;  1OGQ A;  4L3A A;  2OMY A;  1G9U A;  3UN9 A;  4CNM A;  4Z79 A;  5GS0 A;  2Z7X A;  2OMW A;  5AZ5 A;  2V70 A;  5FTT B;  4RCW A;  2OMT A;  1O6T A;  4PKI G;  2RR6 A;  3W3M A;  3WPC A;  3A79 B;  4NKH A;  1H6T A;  5GMF A;  5B0T A;  4YEB B;  4UFR A;  2P1P B;  3RW6 A;  4R6F A;  3ULV A;  5D3I A;  1Z7X W;  1FS2 A;  4Z8G A;  3WPB A;  2ASS B;  2Z64 A;  4Z61 C;  1DCE A;  3RFJ A;  5GMH A;  4C2A B;  4RWT C;  3OJA B;  4TZH A;  1M9S A;  1OTN A;  1K5D C;  4R58 A;  1OZN A;  2IFG A;  5B4P A;  5IJB A;  3W3L A;  4KXF B;  3O6N A;  3E4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...