3JB9j

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
160
Chain Sequence
MRLNAEFLSQVPSFISPLKETELDLRQIPIIENLGVLRDVHDAIDFTDNDIRYLGNFPRMKRLQTLLCGNNRITAIAPDIGKVLPNLKTLSLAQNHLQEIADLDPLASCPQLTNLSCIDNPVAQKQYYRLYLIWRIPSLHILDFERVRRNERLRAEEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
total genus 47
structure length 160
sequence length 162
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3jb9j00
4FD0A 5IJBA 1QYYA 3OGMB 4G8AA 4U7LA 3W3LA 1P9AG 4WYKA 4AY9X 4MN8B 2ASSB 4U09A 4P91A 4LI1A 1LTXA 4Z64C 5AWCA 1P8VA 4XGOA 4M7EA 1U0ND 4RWTC 3WPIA 3REZA 4Y61B 2RR6A 3WPBA 2ELLA 5HZLB 4V2CA 4BV4R 2BNHA 2O6SA 4QXEA 4Z79A 1ZIWA 5AWBA 1W8AA 5GS2B 4GLPA 5B4PA 4M7EC 2V9TB 1O6TA 3O6NA 2WFHA 3RIZA 4LSAA 1M9SA 2P1PB 5IJCA 2P1QB 2Z82A 2IFGA 2BEXA 3TSRE 1XCDA 3OJAA 2ASTB 5B0TA 4R0AA 2OMTA 3G39A 4PERA 4KT1A 4R08A 3ULVA 2P1MB 2Y5QA 1IO0A 2V70A 5GQRK 1FO1A 3VQ2A 5GMGA 2A0ZA 3A79B 1OGQA 3WPGA 1H6TA 3CVRA 2Z7XB 1YRGA 4CNCA 1DS9A 4Z94G 4TZHA 4P8SA 5AZ5A 1O6SA 5B0NA 3SB4A 2Z63A 4U06A 3E6JA 2OMZA 2UZYA 5AWAA 2OMWA 2P1OB 4KNGA 3ZYOA 1Z7XW 3W3NA 5FTTB 2Z62A 4LI2A 3ZYNA 3RGXA 2JE0A 2XOTA 4AW4A 3G3AA 4QC0A 2R9UA 1DCEA 3DZEA 1GWBA 2ID5A 4YEBB 4Q3IA 4R5CA 4GT6A 1A4YA 1SQ0B 4Q3GA 5HDHA 3G06A 4RCWA 2UZXA 4OQTA 4KXFB 1M10B 4Z8GA 3WPCA 3ZYJA 4PSJA 1WWLA 2WQXA 3CIGA 1XKUA 4CNMA 1OTOA 5CMPA 1DFJI 2Z81A 2Z65A 4R5DA 1P8TA 2OMVA 3RJ0A 3WN4A 4R6AA 3C6NB 3VQ1A 3E4GA 4J4LA 2WQVA 4WP6A 4U08A 5GMFA 4V2EA 5D3IA 4C2AB 4EZGA 2OMXA 3E2JA 3P72A 1K5GC 1JL5A 4FDWA 2Z7XA 5LFNA 4PQ8A 4NKHA 4PEQB 1FT8A 3UN9A 3CIYA 2JQDA 1FS2A 1H6UA 1O6VA 1M9LA 3WPEA 3M18A 2CA6A 1M0ZA 4PKIG 2XWTC 3C6PB 3OJAB 3WPDA 3WPHA 5IYXC 1FQVA 1XECA 2Q4GW 4LSXA 4LXRA 3RW6A 3KJ4A 2O6RA 5AWDA 3ULUA 3RFSA 4XOSA 2JE1A 4R6GA 2OMUA 5CMNA 3RW7A 3UL8A 3W3JA 3G04C 3W3MA 3PMHG 1XWDC 4K17A 4BSRA 4LSXC 4V2DA 4MQWX 4UFRA 4LSCA 3UL9A 2RA8A 1OTMA 1K5DC 4R09A 3W3GA 4RCAB 3OGKB 4H09A 2V9SA 1KOHA 1A9NA 3ZYIA 4NKGA 4L3AA 4ARRA 3W3KA 4BSUA 4QBZA 3M19A 4BSSA 3O53A 2Z66A 4R58A 3UL7A 4FMZA 3RFJA 3BZ5A 4B8CD 4CC4A 2Z64A 5GMHA 4FHOA 3ULAA 3E3ZA 4I6JB 2O6QA 1OZNA 3WPFA 4ARNA 3RFEA 4C2BB 1G9UA 4ECOA 1PGVA 2WQWA 2P1NB 4J0MA 2FT3A 3C6OB 4Q62A 4Z61C 4FS7A 3FXIA 3GOZA 1D0BA 3OGLB 4CC4C 5GS0A 1OTNA 1KOOA 4LXSA 1OOKG 3JB9j 4HQ1A 4R6JA 4ECNA 3RGZA 2OMYA 4FCGA 1XEUA 3G3BA 4CILA 4L3FA 4R6FA 4CP6A 5IJDA 2WQUA 4XSQA 5A5CA 4IM6A 4R07A
chains in the Genus database with same CATH superfamily
4FD0A 5IJBA 1QYYA 3OGMB 4G8AA 4U7LA 3W3LA 1P9AG 4WYKA 4AY9X 4MN8B 2ASSB 4U09A 4P91A 4LI1A 1LTXA 4Z64C 5AWCA 1P8VA 4XGOA 4M7EA 1U0ND 4RWTC 3WPIA 3REZA 4Y61B 2RR6A 3WPBA 2ELLA 5HZLB 4V2CA 4BV4R 2BNHA 2O6SA 4QXEA 4Z79A 1ZIWA 5AWBA 1W8AA 5GS2B 4GLPA 5B4PA 4M7EC 2V9TB 1O6TA 3O6NA 2WFHA 3RIZA 4LSAA 1M9SA 2P1PB 5IJCA 2P1QB 2Z82A 2IFGA 2BEXA 3TSRE 1XCDA 3OJAA 2ASTB 5B0TA 4R0AA 2OMTA 3G39A 4PERA 4KT1A 4R08A 3ULVA 2P1MB 2Y5QA 1IO0A 2V70A 5GQRK 1FO1A 3VQ2A 5GMGA 2A0ZA 3A79B 1OGQA 3WPGA 1H6TA 3CVRA 2Z7XB 1YRGA 4CNCA 1DS9A 4Z94G 4TZHA 4P8SA 5AZ5A 1O6SA 5B0NA 3SB4A 2Z63A 4U06A 3E6JA 2OMZA 2UZYA 5AWAA 2OMWA 2P1OB 4KNGA 3ZYOA 1Z7XW 3W3NA 5FTTB 2Z62A 4LI2A 3ZYNA 3RGXA 2JE0A 2XOTA 4AW4A 3G3AA 4QC0A 2R9UA 1DCEA 3DZEA 1GWBA 2ID5A 4YEBB 4Q3IA 4R5CA 4GT6A 1A4YA 1SQ0B 4Q3GA 5HDHA 3G06A 4RCWA 2UZXA 4OQTA 4KXFB 1M10B 4Z8GA 3WPCA 3ZYJA 4PSJA 1WWLA 2WQXA 3CIGA 1XKUA 4CNMA 1OTOA 5CMPA 1DFJI 2Z81A 2Z65A 4R5DA 1P8TA 2OMVA 3RJ0A 3WN4A 4R6AA 3C6NB 3VQ1A 3E4GA 4J4LA 2WQVA 4WP6A 4U08A 5GMFA 4V2EA 5D3IA 4C2AB 4EZGA 2OMXA 3E2JA 3P72A 1K5GC 1JL5A 4FDWA 2Z7XA 5LFNA 4PQ8A 4NKHA 4PEQB 1FT8A 3UN9A 3CIYA 2JQDA 1FS2A 4NZTM 1H6UA 1O6VA 1M9LA 3WPEA 3M18A 2CA6A 4NZRM 1M0ZA 4PKIG 2XWTC 3C6PB 3OJAB 3WPDA 3WPHA 5IYXC 1FQVA 1XECA 2Q4GW 4LSXA 4LXRA 3RW6A 3KJ4A 2O6RA 5AWDA 3ULUA 3RFSA 4XOSA 2JE1A 4R6GA 2OMUA 5CMNA 3RW7A 3UL8A 3W3JA 3G04C 3W3MA 3PMHG 1XWDC 4K17A 4BSRA 4LSXC 4V2DA 4MQWX 4UFRA 4LSCA 3UL9A 2RA8A 1OTMA 1K5DC 4R09A 3W3GA 4RCAB 3OGKB 4H09A 2V9SA 1KOHA 1A9NA 3ZYIA 4NKGA 4L3AA 4ARRA 3W3KA 4BSUA 4QBZA 3M19A 4BSSA 3O53A 2Z66A 4R58A 3UL7A 4FMZA 3RFJA 3BZ5A 4B8CD 4CC4A 2Z64A 5GMHA 4FHOA 3ULAA 3E3ZA 4I6JB 2O6QA 1OZNA 3WPFA 4ARNA 3RFEA 4C2BB 1G9UA 4ECOA 1PGVA 2WQWA 2P1NB 4J0MA 2FT3A 3C6OB 4Q62A 4Z61C 4FS7A 3FXIA 3GOZA 1D0BA 3OGLB 4CC4C 5GS0A 1OTNA 1KOOA 4LXSA 1OOKG 3JB9j 4HQ1A 4R6JA 4ECNA 3RGZA 2OMYA 4FCGA 1XEUA 3G3BA 4CILA 4L3FA 4R6FA 4CP6A 5IJDA 2WQUA 4XSQA 5A5CA 4IM6A 4R07A
chains in the Genus database with same CATH topology
4FD0A 5IJBA 1QYYA 3OGMB 4G8AA 4U7LA 3W3LA 1P9AG 4WYKA 4AY9X 4MN8B 2ASSB 4U09A 4P91A 4LI1A 1LTXA 4Z64C 5AWCA 1P8VA 4XGOA 4M7EA 1U0ND 4RWTC 3WPIA 3REZA 4Y61B 2RR6A 3WPBA 2ELLA 5HZLB 4V2CA 4BV4R 2BNHA 2O6SA 4QXEA 4Z79A 1ZIWA 5AWBA 1W8AA 5GS2B 4GLPA 5B4PA 4M7EC 2V9TB 1O6TA 3O6NA 2WFHA 3RIZA 4LSAA 1M9SA 2P1PB 5IJCA 2P1QB 2Z82A 2IFGA 2BEXA 3TSRE 1XCDA 3OJAA 2ASTB 5B0TA 4R0AA 2OMTA 3G39A 4PERA 4KT1A 4R08A 3ULVA 2P1MB 2Y5QA 1IO0A 2V70A 5GQRK 1FO1A 3VQ2A 5GMGA 2A0ZA 3A79B 1OGQA 3WPGA 1H6TA 3CVRA 2Z7XB 1YRGA 4CNCA 1DS9A 4Z94G 4TZHA 4P8SA 5AZ5A 1O6SA 5B0NA 3SB4A 2Z63A 4U06A 3E6JA 2OMZA 2UZYA 5AWAA 2OMWA 2P1OB 4KNGA 3ZYOA 1Z7XW 3W3NA 5FTTB 2Z62A 4LI2A 3ZYNA 3RGXA 2JE0A 2XOTA 4AW4A 3G3AA 4QC0A 2R9UA 1DCEA 3DZEA 1GWBA 2ID5A 4YEBB 4Q3IA 4R5CA 4GT6A 1A4YA 1SQ0B 4Q3GA 5HDHA 3G06A 4RCWA 2UZXA 4OQTA 4KXFB 1M10B 4Z8GA 3WPCA 3ZYJA 4PSJA 1WWLA 2WQXA 3CIGA 1XKUA 4CNMA 1OTOA 5CMPA 1DFJI 2Z81A 2Z65A 4R5DA 1P8TA 2OMVA 3RJ0A 3WN4A 4R6AA 3C6NB 3VQ1A 3E4GA 4J4LA 2WQVA 4WP6A 4U08A 5GMFA 4V2EA 5D3IA 4C2AB 4EZGA 2OMXA 3E2JA 3P72A 1K5GC 1JL5A 4FDWA 2Z7XA 5LFNA 4PQ8A 4NKHA 4PEQB 1FT8A 3UN9A 3CIYA 2JQDA 1FS2A 1H6UA 1O6VA 1M9LA 3WPEA 3M18A 2CA6A 1M0ZA 4PKIG 2XWTC 3C6PB 3OJAB 3WPDA 3WPHA 5IYXC 1FQVA 1XECA 2Q4GW 4LSXA 4LXRA 3RW6A 3KJ4A 2O6RA 5AWDA 3ULUA 3RFSA 4XOSA 2JE1A 4R6GA 2OMUA 5CMNA 3RW7A 3UL8A 3W3JA 3G04C 3W3MA 3PMHG 1XWDC 4K17A 4BSRA 4LSXC 4V2DA 4MQWX 4UFRA 4LSCA 3UL9A 2RA8A 1OTMA 1K5DC 4R09A 3W3GA 4RCAB 3OGKB 4H09A 2V9SA 1KOHA 1A9NA 3ZYIA 4NKGA 4L3AA 4ARRA 3W3KA 4BSUA 4QBZA 3M19A 4BSSA 3O53A 2Z66A 4R58A 3UL7A 4FMZA 3RFJA 3BZ5A 4B8CD 4CC4A 2Z64A 5GMHA 4FHOA 3ULAA 3E3ZA 4I6JB 2O6QA 1OZNA 3WPFA 4ARNA 3RFEA 4C2BB 1G9UA 4ECOA 1PGVA 2WQWA 2P1NB 4J0MA 2FT3A 3C6OB 4Q62A 4Z61C 4FS7A 3FXIA 3GOZA 1D0BA 3OGLB 4CC4C 5GS0A 1OTNA 1KOOA 4LXSA 1OOKG 3JB9j 4HQ1A 4R6JA 4ECNA 3RGZA 2OMYA 4FCGA 1XEUA 3G3BA 4CILA 4L3FA 4R6FA 4CP6A 5IJDA 2WQUA 4XSQA 5A5CA 4IM6A 4R07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FD0 A;  5IJB A;  1QYY A;  3OGM B;  4G8A A;  4U7L A;  3W3L A;  1P9A G;  4WYK A;  4AY9 X;  4MN8 B;  2ASS B;  4U09 A;  4P91 A;  4LI1 A;  1LTX A;  4Z64 C;  5AWC A;  1P8V A;  4XGO A;  4M7E A;  1U0N D;  4RWT C;  3WPI A;  3REZ A;  4Y61 B;  2RR6 A;  3WPB A;  2ELL A;  5HZL B;  4V2C A;  4BV4 R;  2BNH A;  2O6S A;  4QXE A;  4Z79 A;  1ZIW A;  5AWB A;  1W8A A;  5GS2 B;  4GLP A;  5B4P A;  4M7E C;  2V9T B;  1O6T A;  3O6N A;  2WFH A;  3RIZ A;  4LSA A;  1M9S A;  2P1P B;  5IJC A;  2P1Q B;  2Z82 A;  2IFG A;  2BEX A;  3TSR E;  1XCD A;  3OJA A;  2AST B;  5B0T A;  4R0A A;  2OMT A;  3G39 A;  4PER A;  4KT1 A;  4R08 A;  3ULV A;  2P1M B;  2Y5Q A;  1IO0 A;  2V70 A;  5GQR K;  1FO1 A;  3VQ2 A;  5GMG A;  2A0Z A;  3A79 B;  1OGQ A;  3WPG A;  1H6T A;  3CVR A;  2Z7X B;  1YRG A;  4CNC A;  1DS9 A;  4Z94 G;  4TZH A;  4P8S A;  5AZ5 A;  1O6S A;  5B0N A;  3SB4 A;  2Z63 A;  4U06 A;  3E6J A;  2OMZ A;  2UZY A;  5AWA A;  2OMW A;  2P1O B;  4KNG A;  3ZYO A;  1Z7X W;  3W3N A;  5FTT B;  2Z62 A;  4LI2 A;  3ZYN A;  3RGX A;  2JE0 A;  2XOT A;  4AW4 A;  3G3A A;  4QC0 A;  2R9U A;  1DCE A;  3DZE A;  1GWB A;  2ID5 A;  4YEB B;  4Q3I A;  4R5C A;  4GT6 A;  1A4Y A;  1SQ0 B;  4Q3G A;  5HDH A;  3G06 A;  4RCW A;  2UZX A;  4OQT A;  4KXF B;  1M10 B;  4Z8G A;  3WPC A;  3ZYJ A;  4PSJ A;  1WWL A;  2WQX A;  3CIG A;  1XKU A;  4CNM A;  1OTO A;  5CMP A;  1DFJ I;  2Z81 A;  2Z65 A;  4R5D A;  1P8T A;  2OMV A;  3RJ0 A;  3WN4 A;  4R6A A;  3C6N B;  3VQ1 A;  3E4G A;  4J4L A;  2WQV A;  4WP6 A;  4U08 A;  5GMF A;  4V2E A;  5D3I A;  4C2A B;  4EZG A;  2OMX A;  3E2J A;  3P72 A;  1K5G C;  1JL5 A;  4FDW A;  2Z7X A;  5LFN A;  4PQ8 A;  4NKH A;  4PEQ B;  1FT8 A;  3UN9 A;  3CIY A;  2JQD A;  1FS2 A;  1H6U A;  1O6V A;  1M9L A;  3WPE A;  3M18 A;  2CA6 A;  1M0Z A;  4PKI G;  2XWT C;  3C6P B;  3OJA B;  3WPD A;  3WPH A;  5IYX C;  1FQV A;  1XEC A;  2Q4G W;  4LSX A;  4LXR A;  3RW6 A;  3KJ4 A;  2O6R A;  5AWD A;  3ULU A;  3RFS A;  4XOS A;  2JE1 A;  4R6G A;  2OMU A;  5CMN A;  3RW7 A;  3UL8 A;  3W3J A;  3G04 C;  3W3M A;  3PMH G;  1XWD C;  4K17 A;  4BSR A;  4LSX C;  4V2D A;  4MQW X;  4UFR A;  4LSC A;  3UL9 A;  2RA8 A;  1OTM A;  1K5D C;  4R09 A;  3W3G A;  4RCA B;  3OGK B;  4H09 A;  2V9S A;  1KOH A;  1A9N A;  3ZYI A;  4NKG A;  4L3A A;  4ARR A;  3W3K A;  4BSU A;  4QBZ A;  3M19 A;  4BSS A;  3O53 A;  2Z66 A;  4R58 A;  3UL7 A;  4FMZ A;  3RFJ A;  3BZ5 A;  4B8C D;  4CC4 A;  2Z64 A;  5GMH A;  4FHO A;  3ULA A;  3E3Z A;  4I6J B;  2O6Q A;  1OZN A;  3WPF A;  4ARN A;  3RFE A;  4C2B B;  1G9U A;  4ECO A;  1PGV A;  2WQW A;  2P1N B;  4J0M A;  2FT3 A;  3C6O B;  4Q62 A;  4Z61 C;  4FS7 A;  3FXI A;  3GOZ A;  1D0B A;  3OGL B;  4CC4 C;  5GS0 A;  1OTN A;  1KOO A;  4LXS A;  1OOK G;  3JB9 j;  4HQ1 A;  4R6J A;  4ECN A;  3RGZ A;  2OMY A;  4FCG A;  1XEU A;  3G3B A;  4CIL A;  4L3F A;  4R6F A;  4CP6 A;  5IJD A;  2WQU A;  4XSQ A;  5A5C A;  4IM6 A;  4R07 A; 
#chains in the Genus database with same CATH topology
 4FD0 A;  5IJB A;  1QYY A;  3OGM B;  4G8A A;  4U7L A;  3W3L A;  1P9A G;  4WYK A;  4AY9 X;  4MN8 B;  2ASS B;  4U09 A;  4P91 A;  4LI1 A;  1LTX A;  4Z64 C;  5AWC A;  1P8V A;  4XGO A;  4M7E A;  1U0N D;  4RWT C;  3WPI A;  3REZ A;  4Y61 B;  2RR6 A;  3WPB A;  2ELL A;  5HZL B;  4V2C A;  4BV4 R;  2BNH A;  2O6S A;  4QXE A;  4Z79 A;  1ZIW A;  5AWB A;  1W8A A;  5GS2 B;  4GLP A;  5B4P A;  4M7E C;  2V9T B;  1O6T A;  3O6N A;  2WFH A;  3RIZ A;  4LSA A;  1M9S A;  2P1P B;  5IJC A;  2P1Q B;  2Z82 A;  2IFG A;  2BEX A;  3TSR E;  1XCD A;  3OJA A;  2AST B;  5B0T A;  4R0A A;  2OMT A;  3G39 A;  4PER A;  4KT1 A;  4R08 A;  3ULV A;  2P1M B;  2Y5Q A;  1IO0 A;  2V70 A;  5GQR K;  1FO1 A;  3VQ2 A;  5GMG A;  2A0Z A;  3A79 B;  1OGQ A;  3WPG A;  1H6T A;  3CVR A;  2Z7X B;  1YRG A;  4CNC A;  1DS9 A;  4Z94 G;  4TZH A;  4P8S A;  5AZ5 A;  1O6S A;  5B0N A;  3SB4 A;  2Z63 A;  4U06 A;  3E6J A;  2OMZ A;  2UZY A;  5AWA A;  2OMW A;  2P1O B;  4KNG A;  3ZYO A;  1Z7X W;  3W3N A;  5FTT B;  2Z62 A;  4LI2 A;  3ZYN A;  3RGX A;  2JE0 A;  2XOT A;  4AW4 A;  3G3A A;  4QC0 A;  2R9U A;  1DCE A;  3DZE A;  1GWB A;  2ID5 A;  4YEB B;  4Q3I A;  4R5C A;  4GT6 A;  1A4Y A;  1SQ0 B;  4Q3G A;  5HDH A;  3G06 A;  4RCW A;  2UZX A;  4OQT A;  4KXF B;  1M10 B;  4Z8G A;  3WPC A;  3ZYJ A;  4PSJ A;  1WWL A;  2WQX A;  3CIG A;  1XKU A;  4CNM A;  1OTO A;  5CMP A;  1DFJ I;  2Z81 A;  2Z65 A;  4R5D A;  1P8T A;  2OMV A;  3RJ0 A;  3WN4 A;  4R6A A;  3C6N B;  3VQ1 A;  3E4G A;  4J4L A;  2WQV A;  4WP6 A;  4U08 A;  5GMF A;  4V2E A;  5D3I A;  4C2A B;  4EZG A;  2OMX A;  3E2J A;  3P72 A;  1K5G C;  1JL5 A;  4FDW A;  2Z7X A;  5LFN A;  4PQ8 A;  4NKH A;  4PEQ B;  1FT8 A;  3UN9 A;  3CIY A;  2JQD A;  1FS2 A;  4NZT M;  1H6U A;  1O6V A;  1M9L A;  3WPE A;  3M18 A;  2CA6 A;  4NZR M;  1M0Z A;  4PKI G;  2XWT C;  3C6P B;  3OJA B;  3WPD A;  3WPH A;  5IYX C;  1FQV A;  1XEC A;  2Q4G W;  4LSX A;  4LXR A;  3RW6 A;  3KJ4 A;  2O6R A;  5AWD A;  3ULU A;  3RFS A;  4XOS A;  2JE1 A;  4R6G A;  2OMU A;  5CMN A;  3RW7 A;  3UL8 A;  3W3J A;  3G04 C;  3W3M A;  3PMH G;  1XWD C;  4K17 A;  4BSR A;  4LSX C;  4V2D A;  4MQW X;  4UFR A;  4LSC A;  3UL9 A;  2RA8 A;  1OTM A;  1K5D C;  4R09 A;  3W3G A;  4RCA B;  3OGK B;  4H09 A;  2V9S A;  1KOH A;  1A9N A;  3ZYI A;  4NKG A;  4L3A A;  4ARR A;  3W3K A;  4BSU A;  4QBZ A;  3M19 A;  4BSS A;  3O53 A;  2Z66 A;  4R58 A;  3UL7 A;  4FMZ A;  3RFJ A;  3BZ5 A;  4B8C D;  4CC4 A;  2Z64 A;  5GMH A;  4FHO A;  3ULA A;  3E3Z A;  4I6J B;  2O6Q A;  1OZN A;  3WPF A;  4ARN A;  3RFE A;  4C2B B;  1G9U A;  4ECO A;  1PGV A;  2WQW A;  2P1N B;  4J0M A;  2FT3 A;  3C6O B;  4Q62 A;  4Z61 C;  4FS7 A;  3FXI A;  3GOZ A;  1D0B A;  3OGL B;  4CC4 C;  5GS0 A;  1OTN A;  1KOO A;  4LXS A;  1OOK G;  3JB9 j;  4HQ1 A;  4R6J A;  4ECN A;  3RGZ A;  2OMY A;  4FCG A;  1XEU A;  3G3B A;  4CIL A;  4L3F A;  4R6F A;  4CP6 A;  5IJD A;  2WQU A;  4XSQ A;  5A5C A;  4IM6 A;  4R07 A; 
#chains in the Genus database with same CATH homology
 4FD0 A;  5IJB A;  1QYY A;  3OGM B;  4G8A A;  4U7L A;  3W3L A;  1P9A G;  4WYK A;  4AY9 X;  4MN8 B;  2ASS B;  4U09 A;  4P91 A;  4LI1 A;  1LTX A;  4Z64 C;  5AWC A;  1P8V A;  4XGO A;  4M7E A;  1U0N D;  4RWT C;  3WPI A;  3REZ A;  4Y61 B;  2RR6 A;  3WPB A;  2ELL A;  5HZL B;  4V2C A;  4BV4 R;  2BNH A;  2O6S A;  4QXE A;  4Z79 A;  1ZIW A;  5AWB A;  1W8A A;  5GS2 B;  4GLP A;  5B4P A;  4M7E C;  2V9T B;  1O6T A;  3O6N A;  2WFH A;  3RIZ A;  4LSA A;  1M9S A;  2P1P B;  5IJC A;  2P1Q B;  2Z82 A;  2IFG A;  2BEX A;  3TSR E;  1XCD A;  3OJA A;  2AST B;  5B0T A;  4R0A A;  2OMT A;  3G39 A;  4PER A;  4KT1 A;  4R08 A;  3ULV A;  2P1M B;  2Y5Q A;  1IO0 A;  2V70 A;  5GQR K;  1FO1 A;  3VQ2 A;  5GMG A;  2A0Z A;  3A79 B;  1OGQ A;  3WPG A;  1H6T A;  3CVR A;  2Z7X B;  1YRG A;  4CNC A;  1DS9 A;  4Z94 G;  4TZH A;  4P8S A;  5AZ5 A;  1O6S A;  5B0N A;  3SB4 A;  2Z63 A;  4U06 A;  3E6J A;  2OMZ A;  2UZY A;  5AWA A;  2OMW A;  2P1O B;  4KNG A;  3ZYO A;  1Z7X W;  3W3N A;  5FTT B;  2Z62 A;  4LI2 A;  3ZYN A;  3RGX A;  2JE0 A;  2XOT A;  4AW4 A;  3G3A A;  4QC0 A;  2R9U A;  1DCE A;  3DZE A;  1GWB A;  2ID5 A;  4YEB B;  4Q3I A;  4R5C A;  4GT6 A;  1A4Y A;  1SQ0 B;  4Q3G A;  5HDH A;  3G06 A;  4RCW A;  2UZX A;  4OQT A;  4KXF B;  1M10 B;  4Z8G A;  3WPC A;  3ZYJ A;  4PSJ A;  1WWL A;  2WQX A;  3CIG A;  1XKU A;  4CNM A;  1OTO A;  5CMP A;  1DFJ I;  2Z81 A;  2Z65 A;  4R5D A;  1P8T A;  2OMV A;  3RJ0 A;  3WN4 A;  4R6A A;  3C6N B;  3VQ1 A;  3E4G A;  4J4L A;  2WQV A;  4WP6 A;  4U08 A;  5GMF A;  4V2E A;  5D3I A;  4C2A B;  4EZG A;  2OMX A;  3E2J A;  3P72 A;  1K5G C;  1JL5 A;  4FDW A;  2Z7X A;  5LFN A;  4PQ8 A;  4NKH A;  4PEQ B;  1FT8 A;  3UN9 A;  3CIY A;  2JQD A;  1FS2 A;  1H6U A;  1O6V A;  1M9L A;  3WPE A;  3M18 A;  2CA6 A;  1M0Z A;  4PKI G;  2XWT C;  3C6P B;  3OJA B;  3WPD A;  3WPH A;  5IYX C;  1FQV A;  1XEC A;  2Q4G W;  4LSX A;  4LXR A;  3RW6 A;  3KJ4 A;  2O6R A;  5AWD A;  3ULU A;  3RFS A;  4XOS A;  2JE1 A;  4R6G A;  2OMU A;  5CMN A;  3RW7 A;  3UL8 A;  3W3J A;  3G04 C;  3W3M A;  3PMH G;  1XWD C;  4K17 A;  4BSR A;  4LSX C;  4V2D A;  4MQW X;  4UFR A;  4LSC A;  3UL9 A;  2RA8 A;  1OTM A;  1K5D C;  4R09 A;  3W3G A;  4RCA B;  3OGK B;  4H09 A;  2V9S A;  1KOH A;  1A9N A;  3ZYI A;  4NKG A;  4L3A A;  4ARR A;  3W3K A;  4BSU A;  4QBZ A;  3M19 A;  4BSS A;  3O53 A;  2Z66 A;  4R58 A;  3UL7 A;  4FMZ A;  3RFJ A;  3BZ5 A;  4B8C D;  4CC4 A;  2Z64 A;  5GMH A;  4FHO A;  3ULA A;  3E3Z A;  4I6J B;  2O6Q A;  1OZN A;  3WPF A;  4ARN A;  3RFE A;  4C2B B;  1G9U A;  4ECO A;  1PGV A;  2WQW A;  2P1N B;  4J0M A;  2FT3 A;  3C6O B;  4Q62 A;  4Z61 C;  4FS7 A;  3FXI A;  3GOZ A;  1D0B A;  3OGL B;  4CC4 C;  5GS0 A;  1OTN A;  1KOO A;  4LXS A;  1OOK G;  3JB9 j;  4HQ1 A;  4R6J A;  4ECN A;  3RGZ A;  2OMY A;  4FCG A;  1XEU A;  3G3B A;  4CIL A;  4L3F A;  4R6F A;  4CP6 A;  5IJD A;  2WQU A;  4XSQ A;  5A5C A;  4IM6 A;  4R07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...