5HZLB

Secreted internalin-like protein lmo2445 from listeria monocytogenes
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
288
structure length
280
Chain Sequence
DTVPLPAPIIEAFPVEAIAEAIAGELDKDSVNDTITQADLDTMTAIPLPSLGLTGEDLSVLNNEVFTNAIELAIWSNNIGELPDLSEALPALENIEANGANITVFPDANYPNLTNVDLSQNNFGFNIPKFVGMEGLVSINMENAGLSGYIAEDIWMNMPNLDSLILNENHLISIPEDIFLSQQLGTHSFANQTATYPPTTIKQGENLKVFVPFIYQALDFIAPLIIIKDNGRTLYEPPYPTYDGSYMYTIETAGLQPGEHLLEISLGYYTGWYDFPVTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Lmo2445 protein
publication title Secreted Internalin-like protein Lmo2445 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes egd-e
total genus 76
structure length 280
sequence length 288
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5hzlB01
4GLPA 4CC4A 3C6PB 4J0MA 3O6NA 2O6QA 1M10B 3M19A 4BSUA 4R6AA 4R07A 2Z64A 3G3AA 3E4GA 2UZXA 3UL8A 4TZHA 2Z81A 4B8CD 4R5DA 3W3KA 3RGZA 4LSAA 2OMZA 3E3ZA 4Z8GA 2OMTA 5FTTB 5AZ5A 3VQ1A 3RGXA 5GMHA 4Z94G 4H09A 1H6TA 3TSRE 2ID5A 4C2AB 2WQXA 4WYKA 1W8AA 3OGMB 2XWTC 1OZNA 4L3FA 3RIZA 3CIGA 3WPBA 5CMNA 4M7EC 2Z65A 1A9NA 3SB4A 4PQ8A 5AWCA 4CILA 4ARNA 4KXFB 3GOZA 4R6GA 3OJAA 5HDHA 4LSXA 3WPGA 2WQUA 2Y5QA 1M9LA 2Z63A 2Z62A 4CP6A 2RR6A 5GS0A 3ULVA 4NKGA 1O6VA 1YRGA 2BNHA 3OGKB 3UL7A 4U08A 4IM6A 4WP6A 3RW6A 3P72A 3UN9A 3OGLB 3RW7A 1P8TA 4ECNA 1QYYA 4R6FA 5AWAA 4FCGA 4KNGA 4R0AA 3WPFA 4LSCA 2P1OB 4LI2A 4BSSA 1PGVA 3ULAA 4CNCA 4ARRA 3A79B 4R08A 2RA8A 2R9UA 1FS2A 4LXSA 5GMFA 4RCWA 4BSRA 2V9SA 3G3BA 4Q3GA 4UFRA 5IJDA 1A4YA 4PKIG 3W3MA 4R6JA 4V2CA 4R58A 4V2EA 4K17A 3WN4A 1FO1A 2UZYA 4Z61C 1O6SA 4KT1A 3G06A 4P8SA 2P1PB 4YEBB 1OTMA 4M7EA 1M0ZA 4RWTC 2ELLA 5IJCA 2Z82A 2P1MB 1Z7XW 3O53A 4PSJA 3RFJA 3WPCA 3ZYOA 5AWBA 4L3AA 1WWLA 5B0TA 4GT6A 1K5GC 3RFSA 1D0BA 2ASTB 4C2BB 3WPDA 3RFEA 1XEUA 4XSQA 5GMGA 3CVRA 3UL9A 2OMYA 1U0ND 2O6SA 1M9SA 4Y61B 4AW4A 1DCEA 5CMPA 2OMUA 3VQ2A 2XOTA 4U09A 5IYXC 3RJ0A 1XWDC 3W3GA 4QC0A 4G8AA 1OOKG 4AY9X 4LXRA 4Z64C 1DFJI 3WPEA 3C6OB 1XECA 4XGOA 5LFNA 4I6JB 4R5CA 4FS7A 1IO0A 1GWBA 1SQ0B 1KOHA 5HZLB 4QXEA 4P91A 4MN8B 5A5CA 1OGQA 3WPIA 4U06A 3E2JA 4OQTA 3REZA 4CC4C 4FDWA 4J4LA 3CIYA 1XKUA 2OMWA 1FQVA 4U7LA 4LI1A 3ZYNA 2OMXA 3M18A 2P1QB 1OTNA 4EZGA 4QBZA 2Z7XB 3OJAB 3ULUA 2JE0A 3DZEA 1K5DC 2V9TB 2WQVA 5GS2B 3W3LA 4MQWX 4PERA 5GQRK 4FHOA 4NKHA 1OTOA 3G04C 2IFGA 3KJ4A 4V2DA 4Q62A 2CA6A 1XCDA 1FT8A 2WFHA 3ZYIA 4XOSA 3ZYJA 4FMZA 3W3NA 3W3JA 2P1NB 5B0NA 2ASSB 2Z7XA 1DS9A 4HQ1A 5D3IA 4BV4R 4FD0A 5AWDA 2BEXA 2FT3A 2O6RA 1JL5A 3FXIA 2JE1A 1H6UA 4LSXC 1LTXA 1O6TA 2OMVA 1G9UA 3PMHG 2V70A 1KOOA 4Q3IA 3WPHA 2JQDA 4CNMA 1P8VA 2A0ZA 3JB9j 4ECOA 3E6JA 4RCAB 2Z66A 3BZ5A 2WQWA 2Q4GW 1P9AG 5B4PA 4PEQB 4Z79A 3C6NB 1ZIWA 4R09A 5IJBA 3G39A
chains in the Genus database with same CATH superfamily
4GLPA 4CC4A 3C6PB 4J0MA 3O6NA 2O6QA 1M10B 3M19A 4BSUA 4R6AA 4R07A 2Z64A 3G3AA 3E4GA 2UZXA 3UL8A 4TZHA 2Z81A 4B8CD 4R5DA 3W3KA 3RGZA 4LSAA 2OMZA 3E3ZA 4Z8GA 2OMTA 5FTTB 5AZ5A 3VQ1A 3RGXA 5GMHA 4Z94G 4H09A 1H6TA 3TSRE 2ID5A 4C2AB 2WQXA 4WYKA 1W8AA 3OGMB 2XWTC 1OZNA 4L3FA 3RIZA 3CIGA 3WPBA 5CMNA 4M7EC 2Z65A 1A9NA 3SB4A 4PQ8A 5AWCA 4CILA 4ARNA 4KXFB 3GOZA 4R6GA 3OJAA 5HDHA 4LSXA 3WPGA 2WQUA 2Y5QA 1M9LA 2Z63A 2Z62A 4CP6A 2RR6A 5GS0A 3ULVA 4NKGA 1O6VA 1YRGA 2BNHA 3OGKB 3UL7A 4U08A 4IM6A 4WP6A 3RW6A 3P72A 3UN9A 3OGLB 3RW7A 1P8TA 4ECNA 1QYYA 4R6FA 5AWAA 4FCGA 4KNGA 4R0AA 3WPFA 4LSCA 2P1OB 4LI2A 4BSSA 1PGVA 3ULAA 4CNCA 4ARRA 3A79B 4R08A 2RA8A 2R9UA 1FS2A 4LXSA 5GMFA 4RCWA 4BSRA 2V9SA 3G3BA 4Q3GA 4UFRA 5IJDA 1A4YA 4PKIG 3W3MA 4R6JA 4V2CA 4R58A 4V2EA 4K17A 3WN4A 1FO1A 2UZYA 4Z61C 1O6SA 4KT1A 3G06A 4P8SA 2P1PB 4YEBB 1OTMA 4M7EA 1M0ZA 4RWTC 2ELLA 5IJCA 2Z82A 2P1MB 1Z7XW 3O53A 4PSJA 3RFJA 3WPCA 3ZYOA 5AWBA 4L3AA 1WWLA 5B0TA 4GT6A 1K5GC 3RFSA 1D0BA 2ASTB 4C2BB 3WPDA 3RFEA 1XEUA 4XSQA 4NZTM 5GMGA 3CVRA 3UL9A 2OMYA 1U0ND 2O6SA 1M9SA 4Y61B 4AW4A 1DCEA 5CMPA 2OMUA 3VQ2A 2XOTA 4U09A 5IYXC 3RJ0A 1XWDC 3W3GA 4QC0A 4G8AA 1OOKG 4AY9X 4LXRA 4Z64C 1DFJI 3WPEA 3C6OB 1XECA 4XGOA 5LFNA 4I6JB 4R5CA 4FS7A 1IO0A 1GWBA 1SQ0B 1KOHA 5HZLB 4QXEA 4P91A 4MN8B 5A5CA 1OGQA 3WPIA 4U06A 3E2JA 4OQTA 3REZA 4CC4C 4FDWA 4J4LA 3CIYA 1XKUA 2OMWA 1FQVA 4U7LA 4LI1A 3ZYNA 2OMXA 3M18A 2P1QB 1OTNA 4EZGA 4QBZA 2Z7XB 3OJAB 3ULUA 2JE0A 3DZEA 1K5DC 2V9TB 2WQVA 5GS2B 3W3LA 4MQWX 4PERA 5GQRK 4FHOA 4NKHA 1OTOA 3G04C 2IFGA 3KJ4A 4V2DA 4Q62A 2CA6A 1XCDA 1FT8A 2WFHA 3ZYIA 4XOSA 3ZYJA 4FMZA 3W3NA 3W3JA 2P1NB 5B0NA 2ASSB 2Z7XA 1DS9A 4HQ1A 5D3IA 4BV4R 4FD0A 5AWDA 2BEXA 2FT3A 2O6RA 4NZRM 1JL5A 3FXIA 2JE1A 1H6UA 4LSXC 1LTXA 1O6TA 2OMVA 1G9UA 3PMHG 2V70A 1KOOA 4Q3IA 3WPHA 2JQDA 4CNMA 1P8VA 2A0ZA 3JB9j 4ECOA 3E6JA 4RCAB 2Z66A 3BZ5A 2WQWA 2Q4GW 1P9AG 5B4PA 4PEQB 4Z79A 3C6NB 1ZIWA 4R09A 5IJBA 3G39A
chains in the Genus database with same CATH topology
4GLPA 4CC4A 3C6PB 4J0MA 3O6NA 2O6QA 1M10B 3M19A 4BSUA 4R6AA 4R07A 2Z64A 3G3AA 3E4GA 2UZXA 3UL8A 4TZHA 2Z81A 4B8CD 4R5DA 3W3KA 3RGZA 4LSAA 2OMZA 3E3ZA 4Z8GA 2OMTA 5FTTB 5AZ5A 3VQ1A 3RGXA 5GMHA 4Z94G 4H09A 1H6TA 3TSRE 2ID5A 4C2AB 2WQXA 4WYKA 1W8AA 3OGMB 2XWTC 1OZNA 4L3FA 3RIZA 3CIGA 3WPBA 5CMNA 4M7EC 2Z65A 1A9NA 3SB4A 4PQ8A 5AWCA 4CILA 4ARNA 4KXFB 3GOZA 4R6GA 3OJAA 5HDHA 4LSXA 3WPGA 2WQUA 2Y5QA 1M9LA 2Z63A 2Z62A 4CP6A 2RR6A 5GS0A 3ULVA 4NKGA 1O6VA 1YRGA 2BNHA 3OGKB 3UL7A 4U08A 4IM6A 4WP6A 3RW6A 3P72A 3UN9A 3OGLB 3RW7A 1P8TA 4ECNA 1QYYA 4R6FA 5AWAA 4FCGA 4KNGA 4R0AA 3WPFA 4LSCA 2P1OB 4LI2A 4BSSA 1PGVA 3ULAA 4CNCA 4ARRA 3A79B 4R08A 2RA8A 2R9UA 1FS2A 4LXSA 5GMFA 4RCWA 4BSRA 2V9SA 3G3BA 4Q3GA 4UFRA 5IJDA 1A4YA 4PKIG 3W3MA 4R6JA 4V2CA 4R58A 4V2EA 4K17A 3WN4A 1FO1A 2UZYA 4Z61C 1O6SA 4KT1A 3G06A 4P8SA 2P1PB 4YEBB 1OTMA 4M7EA 1M0ZA 4RWTC 2ELLA 5IJCA 2Z82A 2P1MB 1Z7XW 3O53A 4PSJA 3RFJA 3WPCA 3ZYOA 5AWBA 4L3AA 1WWLA 5B0TA 4GT6A 1K5GC 3RFSA 1D0BA 2ASTB 4C2BB 3WPDA 3RFEA 1XEUA 4XSQA 5GMGA 3CVRA 3UL9A 2OMYA 1U0ND 2O6SA 1M9SA 4Y61B 4AW4A 1DCEA 5CMPA 2OMUA 3VQ2A 2XOTA 4U09A 5IYXC 3RJ0A 1XWDC 3W3GA 4QC0A 4G8AA 1OOKG 4AY9X 4LXRA 4Z64C 1DFJI 3WPEA 3C6OB 1XECA 4XGOA 5LFNA 4I6JB 4R5CA 4FS7A 1IO0A 1GWBA 1SQ0B 1KOHA 5HZLB 4QXEA 4P91A 4MN8B 5A5CA 1OGQA 3WPIA 4U06A 3E2JA 4OQTA 3REZA 4CC4C 4FDWA 4J4LA 3CIYA 1XKUA 2OMWA 1FQVA 4U7LA 4LI1A 3ZYNA 2OMXA 3M18A 2P1QB 1OTNA 4EZGA 4QBZA 2Z7XB 3OJAB 3ULUA 2JE0A 3DZEA 1K5DC 2V9TB 2WQVA 5GS2B 3W3LA 4MQWX 4PERA 5GQRK 4FHOA 4NKHA 1OTOA 3G04C 2IFGA 3KJ4A 4V2DA 4Q62A 2CA6A 1XCDA 1FT8A 2WFHA 3ZYIA 4XOSA 3ZYJA 4FMZA 3W3NA 3W3JA 2P1NB 5B0NA 2ASSB 2Z7XA 1DS9A 4HQ1A 5D3IA 4BV4R 4FD0A 5AWDA 2BEXA 2FT3A 2O6RA 1JL5A 3FXIA 2JE1A 1H6UA 4LSXC 1LTXA 1O6TA 2OMVA 1G9UA 3PMHG 2V70A 1KOOA 4Q3IA 3WPHA 2JQDA 4CNMA 1P8VA 2A0ZA 3JB9j 4ECOA 3E6JA 4RCAB 2Z66A 3BZ5A 2WQWA 2Q4GW 1P9AG 5B4PA 4PEQB 4Z79A 3C6NB 1ZIWA 4R09A 5IJBA 3G39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLP A;  4CC4 A;  3C6P B;  4J0M A;  3O6N A;  2O6Q A;  1M10 B;  3M19 A;  4BSU A;  4R6A A;  4R07 A;  2Z64 A;  3G3A A;  3E4G A;  2UZX A;  3UL8 A;  4TZH A;  2Z81 A;  4B8C D;  4R5D A;  3W3K A;  3RGZ A;  4LSA A;  2OMZ A;  3E3Z A;  4Z8G A;  2OMT A;  5FTT B;  5AZ5 A;  3VQ1 A;  3RGX A;  5GMH A;  4Z94 G;  4H09 A;  1H6T A;  3TSR E;  2ID5 A;  4C2A B;  2WQX A;  4WYK A;  1W8A A;  3OGM B;  2XWT C;  1OZN A;  4L3F A;  3RIZ A;  3CIG A;  3WPB A;  5CMN A;  4M7E C;  2Z65 A;  1A9N A;  3SB4 A;  4PQ8 A;  5AWC A;  4CIL A;  4ARN A;  4KXF B;  3GOZ A;  4R6G A;  3OJA A;  5HDH A;  4LSX A;  3WPG A;  2WQU A;  2Y5Q A;  1M9L A;  2Z63 A;  2Z62 A;  4CP6 A;  2RR6 A;  5GS0 A;  3ULV A;  4NKG A;  1O6V A;  1YRG A;  2BNH A;  3OGK B;  3UL7 A;  4U08 A;  4IM6 A;  4WP6 A;  3RW6 A;  3P72 A;  3UN9 A;  3OGL B;  3RW7 A;  1P8T A;  4ECN A;  1QYY A;  4R6F A;  5AWA A;  4FCG A;  4KNG A;  4R0A A;  3WPF A;  4LSC A;  2P1O B;  4LI2 A;  4BSS A;  1PGV A;  3ULA A;  4CNC A;  4ARR A;  3A79 B;  4R08 A;  2RA8 A;  2R9U A;  1FS2 A;  4LXS A;  5GMF A;  4RCW A;  4BSR A;  2V9S A;  3G3B A;  4Q3G A;  4UFR A;  5IJD A;  1A4Y A;  4PKI G;  3W3M A;  4R6J A;  4V2C A;  4R58 A;  4V2E A;  4K17 A;  3WN4 A;  1FO1 A;  2UZY A;  4Z61 C;  1O6S A;  4KT1 A;  3G06 A;  4P8S A;  2P1P B;  4YEB B;  1OTM A;  4M7E A;  1M0Z A;  4RWT C;  2ELL A;  5IJC A;  2Z82 A;  2P1M B;  1Z7X W;  3O53 A;  4PSJ A;  3RFJ A;  3WPC A;  3ZYO A;  5AWB A;  4L3A A;  1WWL A;  5B0T A;  4GT6 A;  1K5G C;  3RFS A;  1D0B A;  2AST B;  4C2B B;  3WPD A;  3RFE A;  1XEU A;  4XSQ A;  5GMG A;  3CVR A;  3UL9 A;  2OMY A;  1U0N D;  2O6S A;  1M9S A;  4Y61 B;  4AW4 A;  1DCE A;  5CMP A;  2OMU A;  3VQ2 A;  2XOT A;  4U09 A;  5IYX C;  3RJ0 A;  1XWD C;  3W3G A;  4QC0 A;  4G8A A;  1OOK G;  4AY9 X;  4LXR A;  4Z64 C;  1DFJ I;  3WPE A;  3C6O B;  1XEC A;  4XGO A;  5LFN A;  4I6J B;  4R5C A;  4FS7 A;  1IO0 A;  1GWB A;  1SQ0 B;  1KOH A;  5HZL B;  4QXE A;  4P91 A;  4MN8 B;  5A5C A;  1OGQ A;  3WPI A;  4U06 A;  3E2J A;  4OQT A;  3REZ A;  4CC4 C;  4FDW A;  4J4L A;  3CIY A;  1XKU A;  2OMW A;  1FQV A;  4U7L A;  4LI1 A;  3ZYN A;  2OMX A;  3M18 A;  2P1Q B;  1OTN A;  4EZG A;  4QBZ A;  2Z7X B;  3OJA B;  3ULU A;  2JE0 A;  3DZE A;  1K5D C;  2V9T B;  2WQV A;  5GS2 B;  3W3L A;  4MQW X;  4PER A;  5GQR K;  4FHO A;  4NKH A;  1OTO A;  3G04 C;  2IFG A;  3KJ4 A;  4V2D A;  4Q62 A;  2CA6 A;  1XCD A;  1FT8 A;  2WFH A;  3ZYI A;  4XOS A;  3ZYJ A;  4FMZ A;  3W3N A;  3W3J A;  2P1N B;  5B0N A;  2ASS B;  2Z7X A;  1DS9 A;  4HQ1 A;  5D3I A;  4BV4 R;  4FD0 A;  5AWD A;  2BEX A;  2FT3 A;  2O6R A;  1JL5 A;  3FXI A;  2JE1 A;  1H6U A;  4LSX C;  1LTX A;  1O6T A;  2OMV A;  1G9U A;  3PMH G;  2V70 A;  1KOO A;  4Q3I A;  3WPH A;  2JQD A;  4CNM A;  1P8V A;  2A0Z A;  3JB9 j;  4ECO A;  3E6J A;  4RCA B;  2Z66 A;  3BZ5 A;  2WQW A;  2Q4G W;  1P9A G;  5B4P A;  4PEQ B;  4Z79 A;  3C6N B;  1ZIW A;  4R09 A;  5IJB A;  3G39 A; 
#chains in the Genus database with same CATH topology
 4GLP A;  4CC4 A;  3C6P B;  4J0M A;  3O6N A;  2O6Q A;  1M10 B;  3M19 A;  4BSU A;  4R6A A;  4R07 A;  2Z64 A;  3G3A A;  3E4G A;  2UZX A;  3UL8 A;  4TZH A;  2Z81 A;  4B8C D;  4R5D A;  3W3K A;  3RGZ A;  4LSA A;  2OMZ A;  3E3Z A;  4Z8G A;  2OMT A;  5FTT B;  5AZ5 A;  3VQ1 A;  3RGX A;  5GMH A;  4Z94 G;  4H09 A;  1H6T A;  3TSR E;  2ID5 A;  4C2A B;  2WQX A;  4WYK A;  1W8A A;  3OGM B;  2XWT C;  1OZN A;  4L3F A;  3RIZ A;  3CIG A;  3WPB A;  5CMN A;  4M7E C;  2Z65 A;  1A9N A;  3SB4 A;  4PQ8 A;  5AWC A;  4CIL A;  4ARN A;  4KXF B;  3GOZ A;  4R6G A;  3OJA A;  5HDH A;  4LSX A;  3WPG A;  2WQU A;  2Y5Q A;  1M9L A;  2Z63 A;  2Z62 A;  4CP6 A;  2RR6 A;  5GS0 A;  3ULV A;  4NKG A;  1O6V A;  1YRG A;  2BNH A;  3OGK B;  3UL7 A;  4U08 A;  4IM6 A;  4WP6 A;  3RW6 A;  3P72 A;  3UN9 A;  3OGL B;  3RW7 A;  1P8T A;  4ECN A;  1QYY A;  4R6F A;  5AWA A;  4FCG A;  4KNG A;  4R0A A;  3WPF A;  4LSC A;  2P1O B;  4LI2 A;  4BSS A;  1PGV A;  3ULA A;  4CNC A;  4ARR A;  3A79 B;  4R08 A;  2RA8 A;  2R9U A;  1FS2 A;  4LXS A;  5GMF A;  4RCW A;  4BSR A;  2V9S A;  3G3B A;  4Q3G A;  4UFR A;  5IJD A;  1A4Y A;  4PKI G;  3W3M A;  4R6J A;  4V2C A;  4R58 A;  4V2E A;  4K17 A;  3WN4 A;  1FO1 A;  2UZY A;  4Z61 C;  1O6S A;  4KT1 A;  3G06 A;  4P8S A;  2P1P B;  4YEB B;  1OTM A;  4M7E A;  1M0Z A;  4RWT C;  2ELL A;  5IJC A;  2Z82 A;  2P1M B;  1Z7X W;  3O53 A;  4PSJ A;  3RFJ A;  3WPC A;  3ZYO A;  5AWB A;  4L3A A;  1WWL A;  5B0T A;  4GT6 A;  1K5G C;  3RFS A;  1D0B A;  2AST B;  4C2B B;  3WPD A;  3RFE A;  1XEU A;  4XSQ A;  4NZT M;  5GMG A;  3CVR A;  3UL9 A;  2OMY A;  1U0N D;  2O6S A;  1M9S A;  4Y61 B;  4AW4 A;  1DCE A;  5CMP A;  2OMU A;  3VQ2 A;  2XOT A;  4U09 A;  5IYX C;  3RJ0 A;  1XWD C;  3W3G A;  4QC0 A;  4G8A A;  1OOK G;  4AY9 X;  4LXR A;  4Z64 C;  1DFJ I;  3WPE A;  3C6O B;  1XEC A;  4XGO A;  5LFN A;  4I6J B;  4R5C A;  4FS7 A;  1IO0 A;  1GWB A;  1SQ0 B;  1KOH A;  5HZL B;  4QXE A;  4P91 A;  4MN8 B;  5A5C A;  1OGQ A;  3WPI A;  4U06 A;  3E2J A;  4OQT A;  3REZ A;  4CC4 C;  4FDW A;  4J4L A;  3CIY A;  1XKU A;  2OMW A;  1FQV A;  4U7L A;  4LI1 A;  3ZYN A;  2OMX A;  3M18 A;  2P1Q B;  1OTN A;  4EZG A;  4QBZ A;  2Z7X B;  3OJA B;  3ULU A;  2JE0 A;  3DZE A;  1K5D C;  2V9T B;  2WQV A;  5GS2 B;  3W3L A;  4MQW X;  4PER A;  5GQR K;  4FHO A;  4NKH A;  1OTO A;  3G04 C;  2IFG A;  3KJ4 A;  4V2D A;  4Q62 A;  2CA6 A;  1XCD A;  1FT8 A;  2WFH A;  3ZYI A;  4XOS A;  3ZYJ A;  4FMZ A;  3W3N A;  3W3J A;  2P1N B;  5B0N A;  2ASS B;  2Z7X A;  1DS9 A;  4HQ1 A;  5D3I A;  4BV4 R;  4FD0 A;  5AWD A;  2BEX A;  2FT3 A;  2O6R A;  4NZR M;  1JL5 A;  3FXI A;  2JE1 A;  1H6U A;  4LSX C;  1LTX A;  1O6T A;  2OMV A;  1G9U A;  3PMH G;  2V70 A;  1KOO A;  4Q3I A;  3WPH A;  2JQD A;  4CNM A;  1P8V A;  2A0Z A;  3JB9 j;  4ECO A;  3E6J A;  4RCA B;  2Z66 A;  3BZ5 A;  2WQW A;  2Q4G W;  1P9A G;  5B4P A;  4PEQ B;  4Z79 A;  3C6N B;  1ZIW A;  4R09 A;  5IJB A;  3G39 A; 
#chains in the Genus database with same CATH homology
 4GLP A;  4CC4 A;  3C6P B;  4J0M A;  3O6N A;  2O6Q A;  1M10 B;  3M19 A;  4BSU A;  4R6A A;  4R07 A;  2Z64 A;  3G3A A;  3E4G A;  2UZX A;  3UL8 A;  4TZH A;  2Z81 A;  4B8C D;  4R5D A;  3W3K A;  3RGZ A;  4LSA A;  2OMZ A;  3E3Z A;  4Z8G A;  2OMT A;  5FTT B;  5AZ5 A;  3VQ1 A;  3RGX A;  5GMH A;  4Z94 G;  4H09 A;  1H6T A;  3TSR E;  2ID5 A;  4C2A B;  2WQX A;  4WYK A;  1W8A A;  3OGM B;  2XWT C;  1OZN A;  4L3F A;  3RIZ A;  3CIG A;  3WPB A;  5CMN A;  4M7E C;  2Z65 A;  1A9N A;  3SB4 A;  4PQ8 A;  5AWC A;  4CIL A;  4ARN A;  4KXF B;  3GOZ A;  4R6G A;  3OJA A;  5HDH A;  4LSX A;  3WPG A;  2WQU A;  2Y5Q A;  1M9L A;  2Z63 A;  2Z62 A;  4CP6 A;  2RR6 A;  5GS0 A;  3ULV A;  4NKG A;  1O6V A;  1YRG A;  2BNH A;  3OGK B;  3UL7 A;  4U08 A;  4IM6 A;  4WP6 A;  3RW6 A;  3P72 A;  3UN9 A;  3OGL B;  3RW7 A;  1P8T A;  4ECN A;  1QYY A;  4R6F A;  5AWA A;  4FCG A;  4KNG A;  4R0A A;  3WPF A;  4LSC A;  2P1O B;  4LI2 A;  4BSS A;  1PGV A;  3ULA A;  4CNC A;  4ARR A;  3A79 B;  4R08 A;  2RA8 A;  2R9U A;  1FS2 A;  4LXS A;  5GMF A;  4RCW A;  4BSR A;  2V9S A;  3G3B A;  4Q3G A;  4UFR A;  5IJD A;  1A4Y A;  4PKI G;  3W3M A;  4R6J A;  4V2C A;  4R58 A;  4V2E A;  4K17 A;  3WN4 A;  1FO1 A;  2UZY A;  4Z61 C;  1O6S A;  4KT1 A;  3G06 A;  4P8S A;  2P1P B;  4YEB B;  1OTM A;  4M7E A;  1M0Z A;  4RWT C;  2ELL A;  5IJC A;  2Z82 A;  2P1M B;  1Z7X W;  3O53 A;  4PSJ A;  3RFJ A;  3WPC A;  3ZYO A;  5AWB A;  4L3A A;  1WWL A;  5B0T A;  4GT6 A;  1K5G C;  3RFS A;  1D0B A;  2AST B;  4C2B B;  3WPD A;  3RFE A;  1XEU A;  4XSQ A;  5GMG A;  3CVR A;  3UL9 A;  2OMY A;  1U0N D;  2O6S A;  1M9S A;  4Y61 B;  4AW4 A;  1DCE A;  5CMP A;  2OMU A;  3VQ2 A;  2XOT A;  4U09 A;  5IYX C;  3RJ0 A;  1XWD C;  3W3G A;  4QC0 A;  4G8A A;  1OOK G;  4AY9 X;  4LXR A;  4Z64 C;  1DFJ I;  3WPE A;  3C6O B;  1XEC A;  4XGO A;  5LFN A;  4I6J B;  4R5C A;  4FS7 A;  1IO0 A;  1GWB A;  1SQ0 B;  1KOH A;  5HZL B;  4QXE A;  4P91 A;  4MN8 B;  5A5C A;  1OGQ A;  3WPI A;  4U06 A;  3E2J A;  4OQT A;  3REZ A;  4CC4 C;  4FDW A;  4J4L A;  3CIY A;  1XKU A;  2OMW A;  1FQV A;  4U7L A;  4LI1 A;  3ZYN A;  2OMX A;  3M18 A;  2P1Q B;  1OTN A;  4EZG A;  4QBZ A;  2Z7X B;  3OJA B;  3ULU A;  2JE0 A;  3DZE A;  1K5D C;  2V9T B;  2WQV A;  5GS2 B;  3W3L A;  4MQW X;  4PER A;  5GQR K;  4FHO A;  4NKH A;  1OTO A;  3G04 C;  2IFG A;  3KJ4 A;  4V2D A;  4Q62 A;  2CA6 A;  1XCD A;  1FT8 A;  2WFH A;  3ZYI A;  4XOS A;  3ZYJ A;  4FMZ A;  3W3N A;  3W3J A;  2P1N B;  5B0N A;  2ASS B;  2Z7X A;  1DS9 A;  4HQ1 A;  5D3I A;  4BV4 R;  4FD0 A;  5AWD A;  2BEX A;  2FT3 A;  2O6R A;  1JL5 A;  3FXI A;  2JE1 A;  1H6U A;  4LSX C;  1LTX A;  1O6T A;  2OMV A;  1G9U A;  3PMH G;  2V70 A;  1KOO A;  4Q3I A;  3WPH A;  2JQD A;  4CNM A;  1P8V A;  2A0Z A;  3JB9 j;  4ECO A;  3E6J A;  4RCA B;  2Z66 A;  3BZ5 A;  2WQW A;  2Q4G W;  1P9A G;  5B4P A;  4PEQ B;  4Z79 A;  3C6N B;  1ZIW A;  4R09 A;  5IJB A;  3G39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...