5HZLB

Secreted internalin-like protein lmo2445 from listeria monocytogenes
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
288
structure length
280
Chain Sequence
DTVPLPAPIIEAFPVEAIAEAIAGELDKDSVNDTITQADLDTMTAIPLPSLGLTGEDLSVLNNEVFTNAIELAIWSNNIGELPDLSEALPALENIEANGANITVFPDANYPNLTNVDLSQNNFGFNIPKFVGMEGLVSINMENAGLSGYIAEDIWMNMPNLDSLILNENHLISIPEDIFLSQQLGTHSFANQTATYPPTTIKQGENLKVFVPFIYQALDFIAPLIIIKDNGRTLYEPPYPTYDGSYMYTIETAGLQPGEHLLEISLGYYTGWYDFPVTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2445 protein
publication title Secreted Internalin-like protein Lmo2445 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes egd-e
molecule tags Unknown function
total genus 76
structure length 280
sequence length 288
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5hzlB01
4MN8B 4FD0A 2UZYA 4BV4R 2OMTA 5IYXC 5AWCA 4QXEA 4QBZA 4U08A 3M19A 2ASSB 5B0NA 5GMGA 2O6SA 4G8AA 3WN4A 3E4GA 1K5GC 3M18A 4L3AA 3WPFA 4LSXC 2P1QB 3E3ZA 3C6NB 1OGQA 2WQVA 4M7EA 4XOSA 1KOOA 2R9UA 3KJ4A 4GLPA 3VQ2A 3RW7A 2WFHA 2Z66A 4L3FA 2FT3A 3ZYJA 5LFNA 4R07A 4U7LA 2OMXA 1JL5A 1OTMA 1DS9A 3JB9j 2Z63A 1P8TA 4V2DA 3RIZA 3UL7A 4Q3IA 1H6UA 1A4YA 4ARNA 4R09A 1PGVA 3C6PB 3ZYNA 4V2EA 1DCEA 3OGLB 4B8CD 3E2JA 5AWDA 5AWBA 4IM6A 2BNHA 3G3BA 3W3LA 2UZXA 2P1OB 2ELLA 4C2AB 5B4PA 1D0BA 1P8VA 1Z7XW 4BSUA 4Z79A 1O6SA 1W8AA 4EZGA 2P1MB 2OMYA 2JE1A 2WQWA 3TSRE 3P72A 5GMHA 4R6AA 3WPDA 2Z82A 1KOHA 5IJCA 3DZEA 3WPCA 4PSJA 1XECA 4P8SA 2V70A 4KXFB 4C2BB 4PEQB 1FT8A 1SQ0B 4FHOA 5AZ5A 4CNCA 4LSXA 1M9LA 3A79B 1YRGA 1XEUA 3RW6A 1FQVA 3ULAA 4CC4C 4PKIG 4HQ1A 4LI2A 4CP6A 3CVRA 2V9TB 1OOKG 5IJDA 3FXIA 1M9SA 4NKGA 3RFSA 5AWAA 5CMNA 3OJAA 3OGKB 3RGZA 3G06A 1GWBA 4UFRA 1OTOA 3O6NA 4FCGA 3G39A 5HZLB 1O6VA 5GMFA 3RFEA 5A5CA 5FTTB 4Z94G 3OJAB 4WP6A 3UL8A 4Y61B 2OMZA 2OMWA 3SB4A 4BSRA 5D3IA 4YEBB 3G3AA 4V2CA 1OTNA 4K17A 4LXRA 4FMZA 2Q4GW 2P1PB 3G04C 3VQ1A 1WWLA 4XGOA 4R5CA 1O6TA 2OMVA 4LXSA 2WQUA 3WPEA 2V9SA 3WPBA 3WPIA 4RCAB 1XCDA 3RGXA 4H09A 4R58A 4I6JB 4LSAA 5IJBA 3RFJA 4Z64C 2O6QA 3ULVA 4Q62A 4QC0A 1K5DC 3UL9A 2Z7XA 5GS0A 5HDHA 1G9UA 4Q3GA 1ZIWA 1IO0A 4CC4A 4FS7A 4WYKA 4KT1A 4FDWA 3W3MA 4RWTC 5GS2B 4J4LA 3W3NA 2ASTB 1QYYA 2Z7XB 3C6OB 4Z61C 2WQXA 3OGMB 4OQTA 4U06A 3CIYA 1LTXA 1DFJI 5CMPA 1FS2A 4R08A 4U09A 2Z64A 2P1NB 2Y5QA 3UN9A 1XWDC 2BEXA 1A9NA 4Z8GA 3CIGA 4R6JA 4BSSA 4R0AA 3W3GA 3RJ0A 4R5DA 2XWTC 3REZA 4AW4A 3PMHG 2JQDA 4GT6A 2RR6A 2RA8A 3WPGA 4J0MA 2A0ZA 1H6TA 4R6GA 4M7EC 4RCWA 4AY9X 4ECOA 4R6FA 3W3KA 4KNGA 3E6JA 4ECNA 1M0ZA 2CA6A 5B0TA 3ULUA 2OMUA 4LI1A 3O53A 4PQ8A 1M10B 4NKHA 1OZNA 4TZHA 2JE0A 4XSQA 4CILA 3GOZA 2Z62A 2Z81A 1FO1A 3WPHA 1P9AG 3W3JA 4CNMA 4P91A 2Z65A 2ID5A 1XKUA 4LSCA 1U0ND 4ARRA 3BZ5A 2IFGA 3ZYIA 2XOTA 5GQRK 3ZYOA 4MQWX 2O6RA 4PERA
chains in the Genus database with same CATH superfamily
4MN8B 4FD0A 2UZYA 4BV4R 2OMTA 5IYXC 5AWCA 4QXEA 4QBZA 4U08A 3M19A 2ASSB 5B0NA 5GMGA 2O6SA 4G8AA 3WN4A 3E4GA 1K5GC 3M18A 4L3AA 3WPFA 4LSXC 2P1QB 3E3ZA 3C6NB 1OGQA 2WQVA 4M7EA 4XOSA 1KOOA 2R9UA 3KJ4A 4GLPA 3VQ2A 3RW7A 2WFHA 2Z66A 4L3FA 2FT3A 3ZYJA 5LFNA 4R07A 4U7LA 2OMXA 1JL5A 1OTMA 1DS9A 3JB9j 2Z63A 1P8TA 4V2DA 3RIZA 3UL7A 4Q3IA 1H6UA 1A4YA 4ARNA 4R09A 1PGVA 3C6PB 3ZYNA 4V2EA 1DCEA 3OGLB 4B8CD 3E2JA 5AWDA 5AWBA 4IM6A 2BNHA 3G3BA 3W3LA 2UZXA 2P1OB 2ELLA 4C2AB 5B4PA 1D0BA 1P8VA 1Z7XW 4BSUA 4Z79A 1O6SA 1W8AA 4EZGA 2P1MB 2OMYA 2JE1A 4NZRM 2WQWA 3TSRE 3P72A 5GMHA 4R6AA 3WPDA 2Z82A 1KOHA 5IJCA 3DZEA 3WPCA 4PSJA 1XECA 4P8SA 2V70A 4KXFB 4C2BB 4PEQB 1FT8A 1SQ0B 4FHOA 5AZ5A 4CNCA 4LSXA 1M9LA 3A79B 1YRGA 1XEUA 3RW6A 1FQVA 3ULAA 4CC4C 4PKIG 4HQ1A 4LI2A 4CP6A 3CVRA 2V9TB 1OOKG 5IJDA 3FXIA 1M9SA 4NKGA 3RFSA 5AWAA 5CMNA 3OJAA 3OGKB 3RGZA 3G06A 1GWBA 4UFRA 1OTOA 3O6NA 4FCGA 3G39A 5HZLB 1O6VA 5GMFA 3RFEA 5A5CA 5FTTB 4Z94G 3OJAB 4WP6A 3UL8A 4Y61B 2OMZA 2OMWA 3SB4A 4BSRA 5D3IA 4YEBB 3G3AA 4V2CA 1OTNA 4K17A 4LXRA 4FMZA 2Q4GW 2P1PB 3G04C 3VQ1A 1WWLA 4XGOA 4R5CA 1O6TA 2OMVA 4LXSA 2WQUA 3WPEA 2V9SA 3WPBA 3WPIA 4RCAB 1XCDA 3RGXA 4H09A 4R58A 4I6JB 4LSAA 5IJBA 3RFJA 4Z64C 2O6QA 3ULVA 4Q62A 4QC0A 1K5DC 3UL9A 2Z7XA 5GS0A 5HDHA 1G9UA 4Q3GA 1ZIWA 1IO0A 4CC4A 4FS7A 4WYKA 4KT1A 4FDWA 3W3MA 4RWTC 5GS2B 4J4LA 3W3NA 2ASTB 1QYYA 2Z7XB 3C6OB 4Z61C 2WQXA 4NZTM 3OGMB 4OQTA 4U06A 3CIYA 1LTXA 1DFJI 5CMPA 1FS2A 4R08A 4U09A 2Z64A 2P1NB 2Y5QA 3UN9A 1XWDC 2BEXA 1A9NA 4Z8GA 3CIGA 4R6JA 4BSSA 4R0AA 3W3GA 3RJ0A 4R5DA 2XWTC 3REZA 4AW4A 3PMHG 2JQDA 4GT6A 2RR6A 2RA8A 3WPGA 4J0MA 2A0ZA 1H6TA 4R6GA 4M7EC 4RCWA 4AY9X 4ECOA 4R6FA 3W3KA 4KNGA 3E6JA 4ECNA 1M0ZA 2CA6A 5B0TA 3ULUA 2OMUA 4LI1A 3O53A 4PQ8A 1M10B 4NKHA 1OZNA 4TZHA 2JE0A 4XSQA 4CILA 3GOZA 2Z62A 2Z81A 1FO1A 3WPHA 1P9AG 3W3JA 4CNMA 4P91A 2Z65A 2ID5A 1XKUA 4LSCA 1U0ND 4ARRA 3BZ5A 2IFGA 3ZYIA 2XOTA 5GQRK 3ZYOA 4MQWX 2O6RA 4PERA
chains in the Genus database with same CATH topology
4MN8B 4FD0A 2UZYA 4BV4R 2OMTA 5IYXC 5AWCA 4QXEA 4QBZA 4U08A 3M19A 2ASSB 5B0NA 5GMGA 2O6SA 4G8AA 3WN4A 3E4GA 1K5GC 3M18A 4L3AA 3WPFA 4LSXC 2P1QB 3E3ZA 3C6NB 1OGQA 2WQVA 4M7EA 4XOSA 1KOOA 2R9UA 3KJ4A 4GLPA 3VQ2A 3RW7A 2WFHA 2Z66A 4L3FA 2FT3A 3ZYJA 5LFNA 4R07A 4U7LA 2OMXA 1JL5A 1OTMA 1DS9A 3JB9j 2Z63A 1P8TA 4V2DA 3RIZA 3UL7A 4Q3IA 1H6UA 1A4YA 4ARNA 4R09A 1PGVA 3C6PB 3ZYNA 4V2EA 1DCEA 3OGLB 4B8CD 3E2JA 5AWDA 5AWBA 4IM6A 2BNHA 3G3BA 3W3LA 2UZXA 2P1OB 2ELLA 4C2AB 5B4PA 1D0BA 1P8VA 1Z7XW 4BSUA 4Z79A 1O6SA 1W8AA 4EZGA 2P1MB 2OMYA 2JE1A 2WQWA 3TSRE 3P72A 5GMHA 4R6AA 3WPDA 2Z82A 1KOHA 5IJCA 3DZEA 3WPCA 4PSJA 1XECA 4P8SA 2V70A 4KXFB 4C2BB 4PEQB 1FT8A 1SQ0B 4FHOA 5AZ5A 4CNCA 4LSXA 1M9LA 3A79B 1YRGA 1XEUA 3RW6A 1FQVA 3ULAA 4CC4C 4PKIG 4HQ1A 4LI2A 4CP6A 3CVRA 2V9TB 1OOKG 5IJDA 3FXIA 1M9SA 4NKGA 3RFSA 5AWAA 5CMNA 3OJAA 3OGKB 3RGZA 3G06A 1GWBA 4UFRA 1OTOA 3O6NA 4FCGA 3G39A 5HZLB 1O6VA 5GMFA 3RFEA 5A5CA 5FTTB 4Z94G 3OJAB 4WP6A 3UL8A 4Y61B 2OMZA 2OMWA 3SB4A 4BSRA 5D3IA 4YEBB 3G3AA 4V2CA 1OTNA 4K17A 4LXRA 4FMZA 2Q4GW 2P1PB 3G04C 3VQ1A 1WWLA 4XGOA 4R5CA 1O6TA 2OMVA 4LXSA 2WQUA 3WPEA 2V9SA 3WPBA 3WPIA 4RCAB 1XCDA 3RGXA 4H09A 4R58A 4I6JB 4LSAA 5IJBA 3RFJA 4Z64C 2O6QA 3ULVA 4Q62A 4QC0A 1K5DC 3UL9A 2Z7XA 5GS0A 5HDHA 1G9UA 4Q3GA 1ZIWA 1IO0A 4CC4A 4FS7A 4WYKA 4KT1A 4FDWA 3W3MA 4RWTC 5GS2B 4J4LA 3W3NA 2ASTB 1QYYA 2Z7XB 3C6OB 4Z61C 2WQXA 3OGMB 4OQTA 4U06A 3CIYA 1LTXA 1DFJI 5CMPA 1FS2A 4R08A 4U09A 2Z64A 2P1NB 2Y5QA 3UN9A 1XWDC 2BEXA 1A9NA 4Z8GA 3CIGA 4R6JA 4BSSA 4R0AA 3W3GA 3RJ0A 4R5DA 2XWTC 3REZA 4AW4A 3PMHG 2JQDA 4GT6A 2RR6A 2RA8A 3WPGA 4J0MA 2A0ZA 1H6TA 4R6GA 4M7EC 4RCWA 4AY9X 4ECOA 4R6FA 3W3KA 4KNGA 3E6JA 4ECNA 1M0ZA 2CA6A 5B0TA 3ULUA 2OMUA 4LI1A 3O53A 4PQ8A 1M10B 4NKHA 1OZNA 4TZHA 2JE0A 4XSQA 4CILA 3GOZA 2Z62A 2Z81A 1FO1A 3WPHA 1P9AG 3W3JA 4CNMA 4P91A 2Z65A 2ID5A 1XKUA 4LSCA 1U0ND 4ARRA 3BZ5A 2IFGA 3ZYIA 2XOTA 5GQRK 3ZYOA 4MQWX 2O6RA 4PERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN8 B;  4FD0 A;  2UZY A;  4BV4 R;  2OMT A;  5IYX C;  5AWC A;  4QXE A;  4QBZ A;  4U08 A;  3M19 A;  2ASS B;  5B0N A;  5GMG A;  2O6S A;  4G8A A;  3WN4 A;  3E4G A;  1K5G C;  3M18 A;  4L3A A;  3WPF A;  4LSX C;  2P1Q B;  3E3Z A;  3C6N B;  1OGQ A;  2WQV A;  4M7E A;  4XOS A;  1KOO A;  2R9U A;  3KJ4 A;  4GLP A;  3VQ2 A;  3RW7 A;  2WFH A;  2Z66 A;  4L3F A;  2FT3 A;  3ZYJ A;  5LFN A;  4R07 A;  4U7L A;  2OMX A;  1JL5 A;  1OTM A;  1DS9 A;  3JB9 j;  2Z63 A;  1P8T A;  4V2D A;  3RIZ A;  3UL7 A;  4Q3I A;  1H6U A;  1A4Y A;  4ARN A;  4R09 A;  1PGV A;  3C6P B;  3ZYN A;  4V2E A;  1DCE A;  3OGL B;  4B8C D;  3E2J A;  5AWD A;  5AWB A;  4IM6 A;  2BNH A;  3G3B A;  3W3L A;  2UZX A;  2P1O B;  2ELL A;  4C2A B;  5B4P A;  1D0B A;  1P8V A;  1Z7X W;  4BSU A;  4Z79 A;  1O6S A;  1W8A A;  4EZG A;  2P1M B;  2OMY A;  2JE1 A;  2WQW A;  3TSR E;  3P72 A;  5GMH A;  4R6A A;  3WPD A;  2Z82 A;  1KOH A;  5IJC A;  3DZE A;  3WPC A;  4PSJ A;  1XEC A;  4P8S A;  2V70 A;  4KXF B;  4C2B B;  4PEQ B;  1FT8 A;  1SQ0 B;  4FHO A;  5AZ5 A;  4CNC A;  4LSX A;  1M9L A;  3A79 B;  1YRG A;  1XEU A;  3RW6 A;  1FQV A;  3ULA A;  4CC4 C;  4PKI G;  4HQ1 A;  4LI2 A;  4CP6 A;  3CVR A;  2V9T B;  1OOK G;  5IJD A;  3FXI A;  1M9S A;  4NKG A;  3RFS A;  5AWA A;  5CMN A;  3OJA A;  3OGK B;  3RGZ A;  3G06 A;  1GWB A;  4UFR A;  1OTO A;  3O6N A;  4FCG A;  3G39 A;  5HZL B;  1O6V A;  5GMF A;  3RFE A;  5A5C A;  5FTT B;  4Z94 G;  3OJA B;  4WP6 A;  3UL8 A;  4Y61 B;  2OMZ A;  2OMW A;  3SB4 A;  4BSR A;  5D3I A;  4YEB B;  3G3A A;  4V2C A;  1OTN A;  4K17 A;  4LXR A;  4FMZ A;  2Q4G W;  2P1P B;  3G04 C;  3VQ1 A;  1WWL A;  4XGO A;  4R5C A;  1O6T A;  2OMV A;  4LXS A;  2WQU A;  3WPE A;  2V9S A;  3WPB A;  3WPI A;  4RCA B;  1XCD A;  3RGX A;  4H09 A;  4R58 A;  4I6J B;  4LSA A;  5IJB A;  3RFJ A;  4Z64 C;  2O6Q A;  3ULV A;  4Q62 A;  4QC0 A;  1K5D C;  3UL9 A;  2Z7X A;  5GS0 A;  5HDH A;  1G9U A;  4Q3G A;  1ZIW A;  1IO0 A;  4CC4 A;  4FS7 A;  4WYK A;  4KT1 A;  4FDW A;  3W3M A;  4RWT C;  5GS2 B;  4J4L A;  3W3N A;  2AST B;  1QYY A;  2Z7X B;  3C6O B;  4Z61 C;  2WQX A;  3OGM B;  4OQT A;  4U06 A;  3CIY A;  1LTX A;  1DFJ I;  5CMP A;  1FS2 A;  4R08 A;  4U09 A;  2Z64 A;  2P1N B;  2Y5Q A;  3UN9 A;  1XWD C;  2BEX A;  1A9N A;  4Z8G A;  3CIG A;  4R6J A;  4BSS A;  4R0A A;  3W3G A;  3RJ0 A;  4R5D A;  2XWT C;  3REZ A;  4AW4 A;  3PMH G;  2JQD A;  4GT6 A;  2RR6 A;  2RA8 A;  3WPG A;  4J0M A;  2A0Z A;  1H6T A;  4R6G A;  4M7E C;  4RCW A;  4AY9 X;  4ECO A;  4R6F A;  3W3K A;  4KNG A;  3E6J A;  4ECN A;  1M0Z A;  2CA6 A;  5B0T A;  3ULU A;  2OMU A;  4LI1 A;  3O53 A;  4PQ8 A;  1M10 B;  4NKH A;  1OZN A;  4TZH A;  2JE0 A;  4XSQ A;  4CIL A;  3GOZ A;  2Z62 A;  2Z81 A;  1FO1 A;  3WPH A;  1P9A G;  3W3J A;  4CNM A;  4P91 A;  2Z65 A;  2ID5 A;  1XKU A;  4LSC A;  1U0N D;  4ARR A;  3BZ5 A;  2IFG A;  3ZYI A;  2XOT A;  5GQR K;  3ZYO A;  4MQW X;  2O6R A;  4PER A; 
#chains in the Genus database with same CATH topology
 4MN8 B;  4FD0 A;  2UZY A;  4BV4 R;  2OMT A;  5IYX C;  5AWC A;  4QXE A;  4QBZ A;  4U08 A;  3M19 A;  2ASS B;  5B0N A;  5GMG A;  2O6S A;  4G8A A;  3WN4 A;  3E4G A;  1K5G C;  3M18 A;  4L3A A;  3WPF A;  4LSX C;  2P1Q B;  3E3Z A;  3C6N B;  1OGQ A;  2WQV A;  4M7E A;  4XOS A;  1KOO A;  2R9U A;  3KJ4 A;  4GLP A;  3VQ2 A;  3RW7 A;  2WFH A;  2Z66 A;  4L3F A;  2FT3 A;  3ZYJ A;  5LFN A;  4R07 A;  4U7L A;  2OMX A;  1JL5 A;  1OTM A;  1DS9 A;  3JB9 j;  2Z63 A;  1P8T A;  4V2D A;  3RIZ A;  3UL7 A;  4Q3I A;  1H6U A;  1A4Y A;  4ARN A;  4R09 A;  1PGV A;  3C6P B;  3ZYN A;  4V2E A;  1DCE A;  3OGL B;  4B8C D;  3E2J A;  5AWD A;  5AWB A;  4IM6 A;  2BNH A;  3G3B A;  3W3L A;  2UZX A;  2P1O B;  2ELL A;  4C2A B;  5B4P A;  1D0B A;  1P8V A;  1Z7X W;  4BSU A;  4Z79 A;  1O6S A;  1W8A A;  4EZG A;  2P1M B;  2OMY A;  2JE1 A;  4NZR M;  2WQW A;  3TSR E;  3P72 A;  5GMH A;  4R6A A;  3WPD A;  2Z82 A;  1KOH A;  5IJC A;  3DZE A;  3WPC A;  4PSJ A;  1XEC A;  4P8S A;  2V70 A;  4KXF B;  4C2B B;  4PEQ B;  1FT8 A;  1SQ0 B;  4FHO A;  5AZ5 A;  4CNC A;  4LSX A;  1M9L A;  3A79 B;  1YRG A;  1XEU A;  3RW6 A;  1FQV A;  3ULA A;  4CC4 C;  4PKI G;  4HQ1 A;  4LI2 A;  4CP6 A;  3CVR A;  2V9T B;  1OOK G;  5IJD A;  3FXI A;  1M9S A;  4NKG A;  3RFS A;  5AWA A;  5CMN A;  3OJA A;  3OGK B;  3RGZ A;  3G06 A;  1GWB A;  4UFR A;  1OTO A;  3O6N A;  4FCG A;  3G39 A;  5HZL B;  1O6V A;  5GMF A;  3RFE A;  5A5C A;  5FTT B;  4Z94 G;  3OJA B;  4WP6 A;  3UL8 A;  4Y61 B;  2OMZ A;  2OMW A;  3SB4 A;  4BSR A;  5D3I A;  4YEB B;  3G3A A;  4V2C A;  1OTN A;  4K17 A;  4LXR A;  4FMZ A;  2Q4G W;  2P1P B;  3G04 C;  3VQ1 A;  1WWL A;  4XGO A;  4R5C A;  1O6T A;  2OMV A;  4LXS A;  2WQU A;  3WPE A;  2V9S A;  3WPB A;  3WPI A;  4RCA B;  1XCD A;  3RGX A;  4H09 A;  4R58 A;  4I6J B;  4LSA A;  5IJB A;  3RFJ A;  4Z64 C;  2O6Q A;  3ULV A;  4Q62 A;  4QC0 A;  1K5D C;  3UL9 A;  2Z7X A;  5GS0 A;  5HDH A;  1G9U A;  4Q3G A;  1ZIW A;  1IO0 A;  4CC4 A;  4FS7 A;  4WYK A;  4KT1 A;  4FDW A;  3W3M A;  4RWT C;  5GS2 B;  4J4L A;  3W3N A;  2AST B;  1QYY A;  2Z7X B;  3C6O B;  4Z61 C;  2WQX A;  4NZT M;  3OGM B;  4OQT A;  4U06 A;  3CIY A;  1LTX A;  1DFJ I;  5CMP A;  1FS2 A;  4R08 A;  4U09 A;  2Z64 A;  2P1N B;  2Y5Q A;  3UN9 A;  1XWD C;  2BEX A;  1A9N A;  4Z8G A;  3CIG A;  4R6J A;  4BSS A;  4R0A A;  3W3G A;  3RJ0 A;  4R5D A;  2XWT C;  3REZ A;  4AW4 A;  3PMH G;  2JQD A;  4GT6 A;  2RR6 A;  2RA8 A;  3WPG A;  4J0M A;  2A0Z A;  1H6T A;  4R6G A;  4M7E C;  4RCW A;  4AY9 X;  4ECO A;  4R6F A;  3W3K A;  4KNG A;  3E6J A;  4ECN A;  1M0Z A;  2CA6 A;  5B0T A;  3ULU A;  2OMU A;  4LI1 A;  3O53 A;  4PQ8 A;  1M10 B;  4NKH A;  1OZN A;  4TZH A;  2JE0 A;  4XSQ A;  4CIL A;  3GOZ A;  2Z62 A;  2Z81 A;  1FO1 A;  3WPH A;  1P9A G;  3W3J A;  4CNM A;  4P91 A;  2Z65 A;  2ID5 A;  1XKU A;  4LSC A;  1U0N D;  4ARR A;  3BZ5 A;  2IFG A;  3ZYI A;  2XOT A;  5GQR K;  3ZYO A;  4MQW X;  2O6R A;  4PER A; 
#chains in the Genus database with same CATH homology
 4MN8 B;  4FD0 A;  2UZY A;  4BV4 R;  2OMT A;  5IYX C;  5AWC A;  4QXE A;  4QBZ A;  4U08 A;  3M19 A;  2ASS B;  5B0N A;  5GMG A;  2O6S A;  4G8A A;  3WN4 A;  3E4G A;  1K5G C;  3M18 A;  4L3A A;  3WPF A;  4LSX C;  2P1Q B;  3E3Z A;  3C6N B;  1OGQ A;  2WQV A;  4M7E A;  4XOS A;  1KOO A;  2R9U A;  3KJ4 A;  4GLP A;  3VQ2 A;  3RW7 A;  2WFH A;  2Z66 A;  4L3F A;  2FT3 A;  3ZYJ A;  5LFN A;  4R07 A;  4U7L A;  2OMX A;  1JL5 A;  1OTM A;  1DS9 A;  3JB9 j;  2Z63 A;  1P8T A;  4V2D A;  3RIZ A;  3UL7 A;  4Q3I A;  1H6U A;  1A4Y A;  4ARN A;  4R09 A;  1PGV A;  3C6P B;  3ZYN A;  4V2E A;  1DCE A;  3OGL B;  4B8C D;  3E2J A;  5AWD A;  5AWB A;  4IM6 A;  2BNH A;  3G3B A;  3W3L A;  2UZX A;  2P1O B;  2ELL A;  4C2A B;  5B4P A;  1D0B A;  1P8V A;  1Z7X W;  4BSU A;  4Z79 A;  1O6S A;  1W8A A;  4EZG A;  2P1M B;  2OMY A;  2JE1 A;  2WQW A;  3TSR E;  3P72 A;  5GMH A;  4R6A A;  3WPD A;  2Z82 A;  1KOH A;  5IJC A;  3DZE A;  3WPC A;  4PSJ A;  1XEC A;  4P8S A;  2V70 A;  4KXF B;  4C2B B;  4PEQ B;  1FT8 A;  1SQ0 B;  4FHO A;  5AZ5 A;  4CNC A;  4LSX A;  1M9L A;  3A79 B;  1YRG A;  1XEU A;  3RW6 A;  1FQV A;  3ULA A;  4CC4 C;  4PKI G;  4HQ1 A;  4LI2 A;  4CP6 A;  3CVR A;  2V9T B;  1OOK G;  5IJD A;  3FXI A;  1M9S A;  4NKG A;  3RFS A;  5AWA A;  5CMN A;  3OJA A;  3OGK B;  3RGZ A;  3G06 A;  1GWB A;  4UFR A;  1OTO A;  3O6N A;  4FCG A;  3G39 A;  5HZL B;  1O6V A;  5GMF A;  3RFE A;  5A5C A;  5FTT B;  4Z94 G;  3OJA B;  4WP6 A;  3UL8 A;  4Y61 B;  2OMZ A;  2OMW A;  3SB4 A;  4BSR A;  5D3I A;  4YEB B;  3G3A A;  4V2C A;  1OTN A;  4K17 A;  4LXR A;  4FMZ A;  2Q4G W;  2P1P B;  3G04 C;  3VQ1 A;  1WWL A;  4XGO A;  4R5C A;  1O6T A;  2OMV A;  4LXS A;  2WQU A;  3WPE A;  2V9S A;  3WPB A;  3WPI A;  4RCA B;  1XCD A;  3RGX A;  4H09 A;  4R58 A;  4I6J B;  4LSA A;  5IJB A;  3RFJ A;  4Z64 C;  2O6Q A;  3ULV A;  4Q62 A;  4QC0 A;  1K5D C;  3UL9 A;  2Z7X A;  5GS0 A;  5HDH A;  1G9U A;  4Q3G A;  1ZIW A;  1IO0 A;  4CC4 A;  4FS7 A;  4WYK A;  4KT1 A;  4FDW A;  3W3M A;  4RWT C;  5GS2 B;  4J4L A;  3W3N A;  2AST B;  1QYY A;  2Z7X B;  3C6O B;  4Z61 C;  2WQX A;  3OGM B;  4OQT A;  4U06 A;  3CIY A;  1LTX A;  1DFJ I;  5CMP A;  1FS2 A;  4R08 A;  4U09 A;  2Z64 A;  2P1N B;  2Y5Q A;  3UN9 A;  1XWD C;  2BEX A;  1A9N A;  4Z8G A;  3CIG A;  4R6J A;  4BSS A;  4R0A A;  3W3G A;  3RJ0 A;  4R5D A;  2XWT C;  3REZ A;  4AW4 A;  3PMH G;  2JQD A;  4GT6 A;  2RR6 A;  2RA8 A;  3WPG A;  4J0M A;  2A0Z A;  1H6T A;  4R6G A;  4M7E C;  4RCW A;  4AY9 X;  4ECO A;  4R6F A;  3W3K A;  4KNG A;  3E6J A;  4ECN A;  1M0Z A;  2CA6 A;  5B0T A;  3ULU A;  2OMU A;  4LI1 A;  3O53 A;  4PQ8 A;  1M10 B;  4NKH A;  1OZN A;  4TZH A;  2JE0 A;  4XSQ A;  4CIL A;  3GOZ A;  2Z62 A;  2Z81 A;  1FO1 A;  3WPH A;  1P9A G;  3W3J A;  4CNM A;  4P91 A;  2Z65 A;  2ID5 A;  1XKU A;  4LSC A;  1U0N D;  4ARR A;  3BZ5 A;  2IFG A;  3ZYI A;  2XOT A;  5GQR K;  3ZYO A;  4MQW X;  2O6R A;  4PER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...