1WWLA

Crystal structure of cd14
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
308
structure length
308
Chain Sequence
PCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monocyte differentiation antigen CD14
publication title Crystal Structure of CD14 and Its Implications for Lipopolysaccharide Signaling
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 88
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1wwlA00
2V9TB 2Z7XB 5AWDA 3E6JA 2ELLA 3W3KA 1WWLA 5GS0A 5IYXC 2WQWA 4P91A 5B0TA 2OMZA 3WN4A 1FO1A 2WFHA 4AW4A 3RGZA 4LSAA 1IO0A 3RIZA 4XGOA 4XSQA 2Z63A 4R5CA 1M9SA 4R5DA 3VQ2A 1P8VA 2R9UA 2OMUA 5B4PA 1XEUA 3WPCA 4ECOA 3PMHG 4H09A 3CIYA 4GLPA 3ZYIA 1U0ND 4TZHA 3O53A 1FQVA 4M7EA 4R0AA 4NKHA 5GQRK 3ULUA 3WPHA 3RGXA 5CMNA 2UZYA 2OMYA 1YRGA 4R08A 3WPEA 4WP6A 3E4GA 3ZYOA 2A0ZA 4BV4R 4R6AA 4FS7A 4Y61B 4C2AB 4FCGA 3E2JA 4CC4C 1ZIWA 4IM6A 4KT1A 5AWBA 2O6SA 3C6NB 1M0ZA 4B8CD 2XOTA 3UN9A 4UFRA 4V2DA 3RFJA 4LI2A 5GS2B 3OGMB 4FMZA 1SQ0B 1DS9A 3WPGA 4R6GA 3G3AA 2IFGA 3SB4A 3W3JA 3C6OB 4C2BB 5HZLB 2XWTC 1OZNA 2ID5A 2OMVA 2OMTA 1DFJI 4U08A 1O6TA 5D3IA 4BSUA 4KNGA 3G06A 3REZA 4QC0A 4PQ8A 4Z64C 5GMFA 4RWTC 4K17A 4NKGA 4J4LA 2P1OB 3RFEA 4R09A 4J0MA 4LI1A 4Z94G 4L3AA 4WYKA 1M9LA 2ASSB 2Z7XA 5IJDA 1OTNA 4R58A 4RCAB 4LXRA 1KOOA 2P1PB 1FS2A 3OJAB 3E3ZA 4V2CA 3W3NA 2P1QB 1OTMA 2OMXA 1XWDC 4PSJA 2WQXA 4LSXC 4RCWA 2UZXA 5IJCA 3OGKB 4R07A 4BSSA 2O6RA 5AZ5A 4HQ1A 3W3MA 4U7LA 4V2EA 4CNMA 4P8SA 1LTXA 4EZGA 1K5GC 1Z7XW 4Q3GA 4PEQB 4MN8B 3GOZA 2Q4GW 4MQWX 4ARNA 4QXEA 1P9AG 4R6FA 4CILA 3A79B 1A4YA 1A9NA 4Z8GA 5GMHA 1JL5A 3DZEA 4FHOA 4CC4A 3ZYJA 3UL7A 2FT3A 4AY9X 3W3LA 3FXIA 4YEBB 3M18A 4LXSA 4XOSA 5LFNA 3W3GA 3WPBA 4G8AA 3WPIA 1O6VA 1XCDA 3CVRA 3ZYNA 3JB9j 4Z79A 3G3BA 2Z65A 4PERA 1OGQA 1XKUA 2V9SA 1H6TA 5AWAA 3VQ1A 1D0BA 2Z64A 3ULAA 1G9UA 3BZ5A 1M10B 2WQVA 5AWCA 1OTOA 1K5DC 1PGVA 3O6NA 5GMGA 4Q62A 4M7EC 3RJ0A 4QBZA 4FD0A 4KXFB 2V70A 2JE1A 5B0NA 4I6JB 2RR6A 4CP6A 1W8AA 2P1NB 1OOKG 3RW7A 2OMWA 4ARRA 2Z66A 4GT6A 3OJAA 4BSRA 2Z81A 1O6SA 4FDWA 1XECA 5A5CA 3G39A 1QYYA 4ECNA 4LSXA 4U06A 5HDHA 3P72A 4U09A 5IJBA 3WPDA 2RA8A 4OQTA 4L3FA 1DCEA 1GWBA 2Y5QA 5CMPA 3RFSA 3UL8A 2BEXA 3G04C 4CNCA 2BNHA 2ASTB 2P1MB 3CIGA 2Z62A 4R6JA 5FTTB 2Z82A 1FT8A 2WQUA 3M19A 3WPFA 4LSCA 2JE0A 3C6PB 4PKIG 1P8TA 2CA6A 3RW6A 3TSRE 2JQDA 4Q3IA 3KJ4A 3OGLB 3UL9A 1KOHA 3ULVA 1H6UA 4Z61C 2O6QA
chains in the Genus database with same CATH superfamily
2V9TB 2Z7XB 5AWDA 3E6JA 2ELLA 3W3KA 1WWLA 5GS0A 5IYXC 2WQWA 4P91A 5B0TA 2OMZA 3WN4A 1FO1A 2WFHA 4AW4A 3RGZA 4LSAA 1IO0A 3RIZA 4XGOA 4XSQA 2Z63A 4R5CA 1M9SA 4R5DA 3VQ2A 1P8VA 2R9UA 2OMUA 5B4PA 1XEUA 3WPCA 4ECOA 3PMHG 4H09A 3CIYA 4GLPA 3ZYIA 1U0ND 4TZHA 3O53A 1FQVA 4M7EA 4R0AA 4NKHA 5GQRK 3ULUA 3WPHA 3RGXA 5CMNA 4NZTM 2UZYA 2OMYA 1YRGA 4R08A 3WPEA 4WP6A 3E4GA 3ZYOA 2A0ZA 4BV4R 4R6AA 4FS7A 4Y61B 4C2AB 4FCGA 3E2JA 4CC4C 1ZIWA 4IM6A 4KT1A 5AWBA 2O6SA 3C6NB 1M0ZA 4B8CD 2XOTA 3UN9A 4UFRA 4V2DA 3RFJA 4LI2A 5GS2B 3OGMB 4FMZA 1SQ0B 1DS9A 3WPGA 4R6GA 3G3AA 2IFGA 3SB4A 3W3JA 3C6OB 4C2BB 5HZLB 2XWTC 1OZNA 2ID5A 2OMVA 2OMTA 1DFJI 4U08A 1O6TA 5D3IA 4BSUA 4KNGA 3G06A 3REZA 4QC0A 4PQ8A 4Z64C 5GMFA 4NZRM 4RWTC 4K17A 4NKGA 4J4LA 2P1OB 3RFEA 4R09A 4J0MA 4LI1A 4Z94G 4L3AA 4WYKA 1M9LA 2ASSB 2Z7XA 5IJDA 1OTNA 4R58A 4RCAB 4LXRA 1KOOA 2P1PB 1FS2A 3OJAB 3E3ZA 4V2CA 3W3NA 2P1QB 1OTMA 2OMXA 1XWDC 4PSJA 2WQXA 4LSXC 4RCWA 2UZXA 5IJCA 3OGKB 4R07A 4BSSA 2O6RA 5AZ5A 4HQ1A 3W3MA 4U7LA 4V2EA 4CNMA 4P8SA 1LTXA 4EZGA 1K5GC 1Z7XW 4Q3GA 4PEQB 4MN8B 3GOZA 2Q4GW 4MQWX 4ARNA 4QXEA 1P9AG 4R6FA 4CILA 3A79B 1A4YA 1A9NA 4Z8GA 5GMHA 1JL5A 3DZEA 4FHOA 4CC4A 3ZYJA 3UL7A 2FT3A 4AY9X 3W3LA 3FXIA 4YEBB 3M18A 4LXSA 4XOSA 5LFNA 3W3GA 3WPBA 4G8AA 3WPIA 1O6VA 1XCDA 3CVRA 3ZYNA 3JB9j 4Z79A 3G3BA 2Z65A 4PERA 1OGQA 1XKUA 2V9SA 1H6TA 5AWAA 3VQ1A 1D0BA 2Z64A 3ULAA 1G9UA 3BZ5A 1M10B 2WQVA 5AWCA 1OTOA 1K5DC 1PGVA 3O6NA 5GMGA 4Q62A 4M7EC 3RJ0A 4QBZA 4FD0A 4KXFB 2V70A 2JE1A 5B0NA 4I6JB 2RR6A 4CP6A 1W8AA 2P1NB 1OOKG 3RW7A 2OMWA 4ARRA 2Z66A 4GT6A 3OJAA 4BSRA 2Z81A 1O6SA 4FDWA 1XECA 5A5CA 3G39A 1QYYA 4ECNA 4LSXA 4U06A 5HDHA 3P72A 4U09A 5IJBA 3WPDA 2RA8A 4OQTA 4L3FA 1DCEA 1GWBA 2Y5QA 5CMPA 3RFSA 3UL8A 2BEXA 3G04C 4CNCA 2BNHA 2ASTB 2P1MB 3CIGA 2Z62A 4R6JA 5FTTB 2Z82A 1FT8A 2WQUA 3M19A 3WPFA 4LSCA 2JE0A 3C6PB 4PKIG 1P8TA 2CA6A 3RW6A 3TSRE 2JQDA 4Q3IA 3KJ4A 3OGLB 3UL9A 1KOHA 3ULVA 1H6UA 4Z61C 2O6QA
chains in the Genus database with same CATH topology
2V9TB 2Z7XB 5AWDA 3E6JA 2ELLA 3W3KA 1WWLA 5GS0A 5IYXC 2WQWA 4P91A 5B0TA 2OMZA 3WN4A 1FO1A 2WFHA 4AW4A 3RGZA 4LSAA 1IO0A 3RIZA 4XGOA 4XSQA 2Z63A 4R5CA 1M9SA 4R5DA 3VQ2A 1P8VA 2R9UA 2OMUA 5B4PA 1XEUA 3WPCA 4ECOA 3PMHG 4H09A 3CIYA 4GLPA 3ZYIA 1U0ND 4TZHA 3O53A 1FQVA 4M7EA 4R0AA 4NKHA 5GQRK 3ULUA 3WPHA 3RGXA 5CMNA 2UZYA 2OMYA 1YRGA 4R08A 3WPEA 4WP6A 3E4GA 3ZYOA 2A0ZA 4BV4R 4R6AA 4FS7A 4Y61B 4C2AB 4FCGA 3E2JA 4CC4C 1ZIWA 4IM6A 4KT1A 5AWBA 2O6SA 3C6NB 1M0ZA 4B8CD 2XOTA 3UN9A 4UFRA 4V2DA 3RFJA 4LI2A 5GS2B 3OGMB 4FMZA 1SQ0B 1DS9A 3WPGA 4R6GA 3G3AA 2IFGA 3SB4A 3W3JA 3C6OB 4C2BB 5HZLB 2XWTC 1OZNA 2ID5A 2OMVA 2OMTA 1DFJI 4U08A 1O6TA 5D3IA 4BSUA 4KNGA 3G06A 3REZA 4QC0A 4PQ8A 4Z64C 5GMFA 4RWTC 4K17A 4NKGA 4J4LA 2P1OB 3RFEA 4R09A 4J0MA 4LI1A 4Z94G 4L3AA 4WYKA 1M9LA 2ASSB 2Z7XA 5IJDA 1OTNA 4R58A 4RCAB 4LXRA 1KOOA 2P1PB 1FS2A 3OJAB 3E3ZA 4V2CA 3W3NA 2P1QB 1OTMA 2OMXA 1XWDC 4PSJA 2WQXA 4LSXC 4RCWA 2UZXA 5IJCA 3OGKB 4R07A 4BSSA 2O6RA 5AZ5A 4HQ1A 3W3MA 4U7LA 4V2EA 4CNMA 4P8SA 1LTXA 4EZGA 1K5GC 1Z7XW 4Q3GA 4PEQB 4MN8B 3GOZA 2Q4GW 4MQWX 4ARNA 4QXEA 1P9AG 4R6FA 4CILA 3A79B 1A4YA 1A9NA 4Z8GA 5GMHA 1JL5A 3DZEA 4FHOA 4CC4A 3ZYJA 3UL7A 2FT3A 4AY9X 3W3LA 3FXIA 4YEBB 3M18A 4LXSA 4XOSA 5LFNA 3W3GA 3WPBA 4G8AA 3WPIA 1O6VA 1XCDA 3CVRA 3ZYNA 3JB9j 4Z79A 3G3BA 2Z65A 4PERA 1OGQA 1XKUA 2V9SA 1H6TA 5AWAA 3VQ1A 1D0BA 2Z64A 3ULAA 1G9UA 3BZ5A 1M10B 2WQVA 5AWCA 1OTOA 1K5DC 1PGVA 3O6NA 5GMGA 4Q62A 4M7EC 3RJ0A 4QBZA 4FD0A 4KXFB 2V70A 2JE1A 5B0NA 4I6JB 2RR6A 4CP6A 1W8AA 2P1NB 1OOKG 3RW7A 2OMWA 4ARRA 2Z66A 4GT6A 3OJAA 4BSRA 2Z81A 1O6SA 4FDWA 1XECA 5A5CA 3G39A 1QYYA 4ECNA 4LSXA 4U06A 5HDHA 3P72A 4U09A 5IJBA 3WPDA 2RA8A 4OQTA 4L3FA 1DCEA 1GWBA 2Y5QA 5CMPA 3RFSA 3UL8A 2BEXA 3G04C 4CNCA 2BNHA 2ASTB 2P1MB 3CIGA 2Z62A 4R6JA 5FTTB 2Z82A 1FT8A 2WQUA 3M19A 3WPFA 4LSCA 2JE0A 3C6PB 4PKIG 1P8TA 2CA6A 3RW6A 3TSRE 2JQDA 4Q3IA 3KJ4A 3OGLB 3UL9A 1KOHA 3ULVA 1H6UA 4Z61C 2O6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9T B;  2Z7X B;  5AWD A;  3E6J A;  2ELL A;  3W3K A;  1WWL A;  5GS0 A;  5IYX C;  2WQW A;  4P91 A;  5B0T A;  2OMZ A;  3WN4 A;  1FO1 A;  2WFH A;  4AW4 A;  3RGZ A;  4LSA A;  1IO0 A;  3RIZ A;  4XGO A;  4XSQ A;  2Z63 A;  4R5C A;  1M9S A;  4R5D A;  3VQ2 A;  1P8V A;  2R9U A;  2OMU A;  5B4P A;  1XEU A;  3WPC A;  4ECO A;  3PMH G;  4H09 A;  3CIY A;  4GLP A;  3ZYI A;  1U0N D;  4TZH A;  3O53 A;  1FQV A;  4M7E A;  4R0A A;  4NKH A;  5GQR K;  3ULU A;  3WPH A;  3RGX A;  5CMN A;  2UZY A;  2OMY A;  1YRG A;  4R08 A;  3WPE A;  4WP6 A;  3E4G A;  3ZYO A;  2A0Z A;  4BV4 R;  4R6A A;  4FS7 A;  4Y61 B;  4C2A B;  4FCG A;  3E2J A;  4CC4 C;  1ZIW A;  4IM6 A;  4KT1 A;  5AWB A;  2O6S A;  3C6N B;  1M0Z A;  4B8C D;  2XOT A;  3UN9 A;  4UFR A;  4V2D A;  3RFJ A;  4LI2 A;  5GS2 B;  3OGM B;  4FMZ A;  1SQ0 B;  1DS9 A;  3WPG A;  4R6G A;  3G3A A;  2IFG A;  3SB4 A;  3W3J A;  3C6O B;  4C2B B;  5HZL B;  2XWT C;  1OZN A;  2ID5 A;  2OMV A;  2OMT A;  1DFJ I;  4U08 A;  1O6T A;  5D3I A;  4BSU A;  4KNG A;  3G06 A;  3REZ A;  4QC0 A;  4PQ8 A;  4Z64 C;  5GMF A;  4RWT C;  4K17 A;  4NKG A;  4J4L A;  2P1O B;  3RFE A;  4R09 A;  4J0M A;  4LI1 A;  4Z94 G;  4L3A A;  4WYK A;  1M9L A;  2ASS B;  2Z7X A;  5IJD A;  1OTN A;  4R58 A;  4RCA B;  4LXR A;  1KOO A;  2P1P B;  1FS2 A;  3OJA B;  3E3Z A;  4V2C A;  3W3N A;  2P1Q B;  1OTM A;  2OMX A;  1XWD C;  4PSJ A;  2WQX A;  4LSX C;  4RCW A;  2UZX A;  5IJC A;  3OGK B;  4R07 A;  4BSS A;  2O6R A;  5AZ5 A;  4HQ1 A;  3W3M A;  4U7L A;  4V2E A;  4CNM A;  4P8S A;  1LTX A;  4EZG A;  1K5G C;  1Z7X W;  4Q3G A;  4PEQ B;  4MN8 B;  3GOZ A;  2Q4G W;  4MQW X;  4ARN A;  4QXE A;  1P9A G;  4R6F A;  4CIL A;  3A79 B;  1A4Y A;  1A9N A;  4Z8G A;  5GMH A;  1JL5 A;  3DZE A;  4FHO A;  4CC4 A;  3ZYJ A;  3UL7 A;  2FT3 A;  4AY9 X;  3W3L A;  3FXI A;  4YEB B;  3M18 A;  4LXS A;  4XOS A;  5LFN A;  3W3G A;  3WPB A;  4G8A A;  3WPI A;  1O6V A;  1XCD A;  3CVR A;  3ZYN A;  3JB9 j;  4Z79 A;  3G3B A;  2Z65 A;  4PER A;  1OGQ A;  1XKU A;  2V9S A;  1H6T A;  5AWA A;  3VQ1 A;  1D0B A;  2Z64 A;  3ULA A;  1G9U A;  3BZ5 A;  1M10 B;  2WQV A;  5AWC A;  1OTO A;  1K5D C;  1PGV A;  3O6N A;  5GMG A;  4Q62 A;  4M7E C;  3RJ0 A;  4QBZ A;  4FD0 A;  4KXF B;  2V70 A;  2JE1 A;  5B0N A;  4I6J B;  2RR6 A;  4CP6 A;  1W8A A;  2P1N B;  1OOK G;  3RW7 A;  2OMW A;  4ARR A;  2Z66 A;  4GT6 A;  3OJA A;  4BSR A;  2Z81 A;  1O6S A;  4FDW A;  1XEC A;  5A5C A;  3G39 A;  1QYY A;  4ECN A;  4LSX A;  4U06 A;  5HDH A;  3P72 A;  4U09 A;  5IJB A;  3WPD A;  2RA8 A;  4OQT A;  4L3F A;  1DCE A;  1GWB A;  2Y5Q A;  5CMP A;  3RFS A;  3UL8 A;  2BEX A;  3G04 C;  4CNC A;  2BNH A;  2AST B;  2P1M B;  3CIG A;  2Z62 A;  4R6J A;  5FTT B;  2Z82 A;  1FT8 A;  2WQU A;  3M19 A;  3WPF A;  4LSC A;  2JE0 A;  3C6P B;  4PKI G;  1P8T A;  2CA6 A;  3RW6 A;  3TSR E;  2JQD A;  4Q3I A;  3KJ4 A;  3OGL B;  3UL9 A;  1KOH A;  3ULV A;  1H6U A;  4Z61 C;  2O6Q A; 
#chains in the Genus database with same CATH topology
 2V9T B;  2Z7X B;  5AWD A;  3E6J A;  2ELL A;  3W3K A;  1WWL A;  5GS0 A;  5IYX C;  2WQW A;  4P91 A;  5B0T A;  2OMZ A;  3WN4 A;  1FO1 A;  2WFH A;  4AW4 A;  3RGZ A;  4LSA A;  1IO0 A;  3RIZ A;  4XGO A;  4XSQ A;  2Z63 A;  4R5C A;  1M9S A;  4R5D A;  3VQ2 A;  1P8V A;  2R9U A;  2OMU A;  5B4P A;  1XEU A;  3WPC A;  4ECO A;  3PMH G;  4H09 A;  3CIY A;  4GLP A;  3ZYI A;  1U0N D;  4TZH A;  3O53 A;  1FQV A;  4M7E A;  4R0A A;  4NKH A;  5GQR K;  3ULU A;  3WPH A;  3RGX A;  5CMN A;  4NZT M;  2UZY A;  2OMY A;  1YRG A;  4R08 A;  3WPE A;  4WP6 A;  3E4G A;  3ZYO A;  2A0Z A;  4BV4 R;  4R6A A;  4FS7 A;  4Y61 B;  4C2A B;  4FCG A;  3E2J A;  4CC4 C;  1ZIW A;  4IM6 A;  4KT1 A;  5AWB A;  2O6S A;  3C6N B;  1M0Z A;  4B8C D;  2XOT A;  3UN9 A;  4UFR A;  4V2D A;  3RFJ A;  4LI2 A;  5GS2 B;  3OGM B;  4FMZ A;  1SQ0 B;  1DS9 A;  3WPG A;  4R6G A;  3G3A A;  2IFG A;  3SB4 A;  3W3J A;  3C6O B;  4C2B B;  5HZL B;  2XWT C;  1OZN A;  2ID5 A;  2OMV A;  2OMT A;  1DFJ I;  4U08 A;  1O6T A;  5D3I A;  4BSU A;  4KNG A;  3G06 A;  3REZ A;  4QC0 A;  4PQ8 A;  4Z64 C;  5GMF A;  4NZR M;  4RWT C;  4K17 A;  4NKG A;  4J4L A;  2P1O B;  3RFE A;  4R09 A;  4J0M A;  4LI1 A;  4Z94 G;  4L3A A;  4WYK A;  1M9L A;  2ASS B;  2Z7X A;  5IJD A;  1OTN A;  4R58 A;  4RCA B;  4LXR A;  1KOO A;  2P1P B;  1FS2 A;  3OJA B;  3E3Z A;  4V2C A;  3W3N A;  2P1Q B;  1OTM A;  2OMX A;  1XWD C;  4PSJ A;  2WQX A;  4LSX C;  4RCW A;  2UZX A;  5IJC A;  3OGK B;  4R07 A;  4BSS A;  2O6R A;  5AZ5 A;  4HQ1 A;  3W3M A;  4U7L A;  4V2E A;  4CNM A;  4P8S A;  1LTX A;  4EZG A;  1K5G C;  1Z7X W;  4Q3G A;  4PEQ B;  4MN8 B;  3GOZ A;  2Q4G W;  4MQW X;  4ARN A;  4QXE A;  1P9A G;  4R6F A;  4CIL A;  3A79 B;  1A4Y A;  1A9N A;  4Z8G A;  5GMH A;  1JL5 A;  3DZE A;  4FHO A;  4CC4 A;  3ZYJ A;  3UL7 A;  2FT3 A;  4AY9 X;  3W3L A;  3FXI A;  4YEB B;  3M18 A;  4LXS A;  4XOS A;  5LFN A;  3W3G A;  3WPB A;  4G8A A;  3WPI A;  1O6V A;  1XCD A;  3CVR A;  3ZYN A;  3JB9 j;  4Z79 A;  3G3B A;  2Z65 A;  4PER A;  1OGQ A;  1XKU A;  2V9S A;  1H6T A;  5AWA A;  3VQ1 A;  1D0B A;  2Z64 A;  3ULA A;  1G9U A;  3BZ5 A;  1M10 B;  2WQV A;  5AWC A;  1OTO A;  1K5D C;  1PGV A;  3O6N A;  5GMG A;  4Q62 A;  4M7E C;  3RJ0 A;  4QBZ A;  4FD0 A;  4KXF B;  2V70 A;  2JE1 A;  5B0N A;  4I6J B;  2RR6 A;  4CP6 A;  1W8A A;  2P1N B;  1OOK G;  3RW7 A;  2OMW A;  4ARR A;  2Z66 A;  4GT6 A;  3OJA A;  4BSR A;  2Z81 A;  1O6S A;  4FDW A;  1XEC A;  5A5C A;  3G39 A;  1QYY A;  4ECN A;  4LSX A;  4U06 A;  5HDH A;  3P72 A;  4U09 A;  5IJB A;  3WPD A;  2RA8 A;  4OQT A;  4L3F A;  1DCE A;  1GWB A;  2Y5Q A;  5CMP A;  3RFS A;  3UL8 A;  2BEX A;  3G04 C;  4CNC A;  2BNH A;  2AST B;  2P1M B;  3CIG A;  2Z62 A;  4R6J A;  5FTT B;  2Z82 A;  1FT8 A;  2WQU A;  3M19 A;  3WPF A;  4LSC A;  2JE0 A;  3C6P B;  4PKI G;  1P8T A;  2CA6 A;  3RW6 A;  3TSR E;  2JQD A;  4Q3I A;  3KJ4 A;  3OGL B;  3UL9 A;  1KOH A;  3ULV A;  1H6U A;  4Z61 C;  2O6Q A; 
#chains in the Genus database with same CATH homology
 2V9T B;  2Z7X B;  5AWD A;  3E6J A;  2ELL A;  3W3K A;  1WWL A;  5GS0 A;  5IYX C;  2WQW A;  4P91 A;  5B0T A;  2OMZ A;  3WN4 A;  1FO1 A;  2WFH A;  4AW4 A;  3RGZ A;  4LSA A;  1IO0 A;  3RIZ A;  4XGO A;  4XSQ A;  2Z63 A;  4R5C A;  1M9S A;  4R5D A;  3VQ2 A;  1P8V A;  2R9U A;  2OMU A;  5B4P A;  1XEU A;  3WPC A;  4ECO A;  3PMH G;  4H09 A;  3CIY A;  4GLP A;  3ZYI A;  1U0N D;  4TZH A;  3O53 A;  1FQV A;  4M7E A;  4R0A A;  4NKH A;  5GQR K;  3ULU A;  3WPH A;  3RGX A;  5CMN A;  2UZY A;  2OMY A;  1YRG A;  4R08 A;  3WPE A;  4WP6 A;  3E4G A;  3ZYO A;  2A0Z A;  4BV4 R;  4R6A A;  4FS7 A;  4Y61 B;  4C2A B;  4FCG A;  3E2J A;  4CC4 C;  1ZIW A;  4IM6 A;  4KT1 A;  5AWB A;  2O6S A;  3C6N B;  1M0Z A;  4B8C D;  2XOT A;  3UN9 A;  4UFR A;  4V2D A;  3RFJ A;  4LI2 A;  5GS2 B;  3OGM B;  4FMZ A;  1SQ0 B;  1DS9 A;  3WPG A;  4R6G A;  3G3A A;  2IFG A;  3SB4 A;  3W3J A;  3C6O B;  4C2B B;  5HZL B;  2XWT C;  1OZN A;  2ID5 A;  2OMV A;  2OMT A;  1DFJ I;  4U08 A;  1O6T A;  5D3I A;  4BSU A;  4KNG A;  3G06 A;  3REZ A;  4QC0 A;  4PQ8 A;  4Z64 C;  5GMF A;  4RWT C;  4K17 A;  4NKG A;  4J4L A;  2P1O B;  3RFE A;  4R09 A;  4J0M A;  4LI1 A;  4Z94 G;  4L3A A;  4WYK A;  1M9L A;  2ASS B;  2Z7X A;  5IJD A;  1OTN A;  4R58 A;  4RCA B;  4LXR A;  1KOO A;  2P1P B;  1FS2 A;  3OJA B;  3E3Z A;  4V2C A;  3W3N A;  2P1Q B;  1OTM A;  2OMX A;  1XWD C;  4PSJ A;  2WQX A;  4LSX C;  4RCW A;  2UZX A;  5IJC A;  3OGK B;  4R07 A;  4BSS A;  2O6R A;  5AZ5 A;  4HQ1 A;  3W3M A;  4U7L A;  4V2E A;  4CNM A;  4P8S A;  1LTX A;  4EZG A;  1K5G C;  1Z7X W;  4Q3G A;  4PEQ B;  4MN8 B;  3GOZ A;  2Q4G W;  4MQW X;  4ARN A;  4QXE A;  1P9A G;  4R6F A;  4CIL A;  3A79 B;  1A4Y A;  1A9N A;  4Z8G A;  5GMH A;  1JL5 A;  3DZE A;  4FHO A;  4CC4 A;  3ZYJ A;  3UL7 A;  2FT3 A;  4AY9 X;  3W3L A;  3FXI A;  4YEB B;  3M18 A;  4LXS A;  4XOS A;  5LFN A;  3W3G A;  3WPB A;  4G8A A;  3WPI A;  1O6V A;  1XCD A;  3CVR A;  3ZYN A;  3JB9 j;  4Z79 A;  3G3B A;  2Z65 A;  4PER A;  1OGQ A;  1XKU A;  2V9S A;  1H6T A;  5AWA A;  3VQ1 A;  1D0B A;  2Z64 A;  3ULA A;  1G9U A;  3BZ5 A;  1M10 B;  2WQV A;  5AWC A;  1OTO A;  1K5D C;  1PGV A;  3O6N A;  5GMG A;  4Q62 A;  4M7E C;  3RJ0 A;  4QBZ A;  4FD0 A;  4KXF B;  2V70 A;  2JE1 A;  5B0N A;  4I6J B;  2RR6 A;  4CP6 A;  1W8A A;  2P1N B;  1OOK G;  3RW7 A;  2OMW A;  4ARR A;  2Z66 A;  4GT6 A;  3OJA A;  4BSR A;  2Z81 A;  1O6S A;  4FDW A;  1XEC A;  5A5C A;  3G39 A;  1QYY A;  4ECN A;  4LSX A;  4U06 A;  5HDH A;  3P72 A;  4U09 A;  5IJB A;  3WPD A;  2RA8 A;  4OQT A;  4L3F A;  1DCE A;  1GWB A;  2Y5Q A;  5CMP A;  3RFS A;  3UL8 A;  2BEX A;  3G04 C;  4CNC A;  2BNH A;  2AST B;  2P1M B;  3CIG A;  2Z62 A;  4R6J A;  5FTT B;  2Z82 A;  1FT8 A;  2WQU A;  3M19 A;  3WPF A;  4LSC A;  2JE0 A;  3C6P B;  4PKI G;  1P8T A;  2CA6 A;  3RW6 A;  3TSR E;  2JQD A;  4Q3I A;  3KJ4 A;  3OGL B;  3UL9 A;  1KOH A;  3ULV A;  1H6U A;  4Z61 C;  2O6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...