1WWLA

Crystal structure of cd14
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
308
structure length
308
Chain Sequence
PCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Monocyte differentiation antigen CD14
publication title Crystal Structure of CD14 and Its Implications for Lipopolysaccharide Signaling
pubmed doi rcsb
source organism Mus musculus
total genus 88
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1wwlA00
5IYXC 4QXEA 3FXIA 4LSXC 3SB4A 4FHOA 3M18A 3CVRA 5AZ5A 4B8CD 2OMYA 1FO1A 4ECNA 1DCEA 2XWTC 3RW6A 1OTMA 1FS2A 3WN4A 2Y5QA 2WFHA 5IJCA 4XGOA 3ULUA 1OOKG 3RFJA 2WQXA 5HDHA 1K5GC 4I6JB 2XOTA 2CA6A 4RCAB 3RFSA 4H09A 4CC4A 1QYYA 3RGXA 4ECOA 5AWDA 4GT6A 3WPEA 2JE0A 4MQWX 4R6AA 4V2CA 4R6FA 4GLPA 4BSUA 4FDWA 4UFRA 1XWDC 3W3MA 4R6GA 3VQ2A 1FQVA 1XKUA 4CP6A 3WPGA 1KOHA 4LI1A 4PERA 1LTXA 4AY9X 4G8AA 4ARRA 3A79B 4CNMA 3C6PB 3OGLB 2Z81A 4Z79A 5GS0A 4U08A 3E6JA 3G06A 3E2JA 4QC0A 5CMPA 1O6VA 2P1PB 4L3FA 3WPDA 3G39A 3OGMB 5D3IA 1WWLA 2O6SA 3KJ4A 3C6OB 4LSCA 4BV4R 2WQUA 3ULAA 3P72A 1M0ZA 4CNCA 3O53A 3O6NA 4PQ8A 5B0TA 2Z63A 5GQRK 4V2DA 4CC4C 2JE1A 3RFEA 1A9NA 3DZEA 2BNHA 2WQWA 4QBZA 3RW7A 1W8AA 2FT3A 3ULVA 2ASTB 2V9SA 1P9AG 4Q3GA 4P91A 3TSRE 4WYKA 3W3GA 4FD0A 3REZA 4LSAA 2V70A 2JQDA 4LSXA 2P1NB 4TZHA 3W3NA 4R09A 4V2EA 5IJDA 5A5CA 2OMUA 3W3KA 1U0ND 2P1OB 4KT1A 4NKHA 3RJ0A 3ZYOA 1GWBA 5GMHA 2R9UA 3M19A 4L3AA 4Y61B 3ZYNA 2UZYA 4U09A 2OMZA 1Z7XW 4KNGA 4U06A 4K17A 4Z64C 3WPFA 4PKIG 2O6RA 3G04C 1P8VA 4R6JA 4R5DA 5GMGA 1P8TA 4C2BB 1G9UA 4LXSA 1XEUA 4RWTC 4EZGA 2ASSB 2ID5A 4XSQA 5B4PA 3PMHG 2O6QA 5HZLB 2Z82A 2Z7XB 1FT8A 4Q3IA 3G3BA 2V9TB 4CILA 1YRGA 4NKGA 1XCDA 3WPHA 1SQ0B 5AWBA 4BSRA 4IM6A 1OGQA 4BSSA 2P1MB 4M7EA 5GMFA 4R07A 4MN8B 3RIZA 2P1QB 4HQ1A 1D0BA 3W3LA 4YEBB 4Z94G 3WPBA 3OJAB 2ELLA 4R5CA 4Z61C 2Z7XA 3W3JA 2UZXA 1DFJI 4J0MA 1H6TA 2RR6A 4P8SA 3OGKB 1OTNA 3WPCA 4LI2A 4ARNA 1M9SA 3UN9A 1K5DC 3UL8A 2IFGA 4R58A 1ZIWA 4RCWA 3RGZA 3CIYA 4PSJA 4WP6A 3OJAA 1O6TA 2BEXA 1OTOA 2Z66A 4KXFB 5IJBA 4FMZA 4J4LA 3UL9A 4C2AB 1O6SA 2Z64A 4PEQB 2WQVA 3C6NB 3G3AA 3UL7A 3WPIA 1XECA 1KOOA 5AWCA 2Z62A 4Z8GA 1M9LA 2OMTA 4AW4A 2Q4GW 1OZNA 3ZYIA 3CIGA 1DS9A 4Q62A 4R0AA 3E3ZA 1A4YA 3BZ5A 3VQ1A 2OMWA 4M7EC 2OMVA 5FTTB 5LFNA 5CMNA 4U7LA 4FCGA 2RA8A 1M10B 2A0ZA 4R08A 3GOZA 3E4GA 1H6UA 5B0NA 4FS7A 3ZYJA 2Z65A 2OMXA 5GS2B 4LXRA 5AWAA 1PGVA 3JB9j 4XOSA 1JL5A 4OQTA 1IO0A
chains in the Genus database with same CATH superfamily
5IYXC 4QXEA 3FXIA 4LSXC 3SB4A 4FHOA 3M18A 3CVRA 5AZ5A 4B8CD 2OMYA 1FO1A 4ECNA 1DCEA 2XWTC 3RW6A 1OTMA 1FS2A 3WN4A 2Y5QA 2WFHA 5IJCA 4XGOA 3ULUA 1OOKG 3RFJA 2WQXA 5HDHA 1K5GC 4I6JB 2XOTA 2CA6A 4RCAB 3RFSA 4H09A 4CC4A 1QYYA 3RGXA 4ECOA 5AWDA 4GT6A 3WPEA 2JE0A 4MQWX 4R6AA 4V2CA 4R6FA 4GLPA 4BSUA 4FDWA 4UFRA 1XWDC 3W3MA 4R6GA 3VQ2A 1FQVA 1XKUA 4CP6A 3WPGA 1KOHA 4LI1A 4PERA 1LTXA 4AY9X 4G8AA 4ARRA 3A79B 4CNMA 3C6PB 3OGLB 2Z81A 4Z79A 5GS0A 4U08A 3E6JA 3G06A 3E2JA 4QC0A 5CMPA 1O6VA 2P1PB 4L3FA 3WPDA 3G39A 3OGMB 5D3IA 1WWLA 2O6SA 3KJ4A 3C6OB 4LSCA 4BV4R 2WQUA 3ULAA 3P72A 1M0ZA 4CNCA 3O53A 3O6NA 4PQ8A 5B0TA 2Z63A 5GQRK 4V2DA 4CC4C 2JE1A 3RFEA 1A9NA 3DZEA 2BNHA 2WQWA 4QBZA 3RW7A 1W8AA 2FT3A 3ULVA 2ASTB 4NZRM 2V9SA 1P9AG 4Q3GA 4P91A 3TSRE 4WYKA 3W3GA 4FD0A 3REZA 4LSAA 2V70A 2JQDA 4LSXA 2P1NB 4TZHA 3W3NA 4R09A 4V2EA 5IJDA 5A5CA 2OMUA 3W3KA 1U0ND 2P1OB 4KT1A 4NKHA 3RJ0A 3ZYOA 1GWBA 5GMHA 2R9UA 3M19A 4L3AA 4Y61B 3ZYNA 2UZYA 4U09A 2OMZA 1Z7XW 4KNGA 4U06A 4K17A 4Z64C 3WPFA 4PKIG 2O6RA 3G04C 1P8VA 4R6JA 4R5DA 5GMGA 1P8TA 4C2BB 1G9UA 4LXSA 1XEUA 4RWTC 4EZGA 2ASSB 2ID5A 4XSQA 5B4PA 3PMHG 2O6QA 5HZLB 2Z82A 2Z7XB 1FT8A 4Q3IA 3G3BA 2V9TB 4CILA 1YRGA 4NKGA 1XCDA 3WPHA 1SQ0B 5AWBA 4BSRA 4IM6A 1OGQA 4BSSA 2P1MB 4M7EA 5GMFA 4R07A 4MN8B 3RIZA 2P1QB 4HQ1A 1D0BA 3W3LA 4YEBB 4Z94G 3WPBA 3OJAB 2ELLA 4R5CA 4Z61C 2Z7XA 3W3JA 2UZXA 1DFJI 4J0MA 1H6TA 2RR6A 4P8SA 3OGKB 1OTNA 3WPCA 4LI2A 4ARNA 1M9SA 3UN9A 1K5DC 3UL8A 2IFGA 4R58A 1ZIWA 4RCWA 3RGZA 3CIYA 4PSJA 4WP6A 3OJAA 1O6TA 2BEXA 1OTOA 2Z66A 4KXFB 5IJBA 4FMZA 4J4LA 3UL9A 4C2AB 1O6SA 2Z64A 4PEQB 2WQVA 3C6NB 3G3AA 3UL7A 3WPIA 1XECA 1KOOA 5AWCA 2Z62A 4Z8GA 1M9LA 2OMTA 4AW4A 2Q4GW 1OZNA 3ZYIA 3CIGA 1DS9A 4Q62A 4R0AA 3E3ZA 1A4YA 3BZ5A 3VQ1A 2OMWA 4M7EC 2OMVA 5FTTB 5LFNA 5CMNA 4U7LA 4FCGA 2RA8A 1M10B 2A0ZA 4R08A 4NZTM 3GOZA 3E4GA 1H6UA 5B0NA 4FS7A 3ZYJA 2Z65A 2OMXA 5GS2B 4LXRA 5AWAA 1PGVA 3JB9j 4XOSA 1JL5A 4OQTA 1IO0A
chains in the Genus database with same CATH topology
5IYXC 4QXEA 3FXIA 4LSXC 3SB4A 4FHOA 3M18A 3CVRA 5AZ5A 4B8CD 2OMYA 1FO1A 4ECNA 1DCEA 2XWTC 3RW6A 1OTMA 1FS2A 3WN4A 2Y5QA 2WFHA 5IJCA 4XGOA 3ULUA 1OOKG 3RFJA 2WQXA 5HDHA 1K5GC 4I6JB 2XOTA 2CA6A 4RCAB 3RFSA 4H09A 4CC4A 1QYYA 3RGXA 4ECOA 5AWDA 4GT6A 3WPEA 2JE0A 4MQWX 4R6AA 4V2CA 4R6FA 4GLPA 4BSUA 4FDWA 4UFRA 1XWDC 3W3MA 4R6GA 3VQ2A 1FQVA 1XKUA 4CP6A 3WPGA 1KOHA 4LI1A 4PERA 1LTXA 4AY9X 4G8AA 4ARRA 3A79B 4CNMA 3C6PB 3OGLB 2Z81A 4Z79A 5GS0A 4U08A 3E6JA 3G06A 3E2JA 4QC0A 5CMPA 1O6VA 2P1PB 4L3FA 3WPDA 3G39A 3OGMB 5D3IA 1WWLA 2O6SA 3KJ4A 3C6OB 4LSCA 4BV4R 2WQUA 3ULAA 3P72A 1M0ZA 4CNCA 3O53A 3O6NA 4PQ8A 5B0TA 2Z63A 5GQRK 4V2DA 4CC4C 2JE1A 3RFEA 1A9NA 3DZEA 2BNHA 2WQWA 4QBZA 3RW7A 1W8AA 2FT3A 3ULVA 2ASTB 2V9SA 1P9AG 4Q3GA 4P91A 3TSRE 4WYKA 3W3GA 4FD0A 3REZA 4LSAA 2V70A 2JQDA 4LSXA 2P1NB 4TZHA 3W3NA 4R09A 4V2EA 5IJDA 5A5CA 2OMUA 3W3KA 1U0ND 2P1OB 4KT1A 4NKHA 3RJ0A 3ZYOA 1GWBA 5GMHA 2R9UA 3M19A 4L3AA 4Y61B 3ZYNA 2UZYA 4U09A 2OMZA 1Z7XW 4KNGA 4U06A 4K17A 4Z64C 3WPFA 4PKIG 2O6RA 3G04C 1P8VA 4R6JA 4R5DA 5GMGA 1P8TA 4C2BB 1G9UA 4LXSA 1XEUA 4RWTC 4EZGA 2ASSB 2ID5A 4XSQA 5B4PA 3PMHG 2O6QA 5HZLB 2Z82A 2Z7XB 1FT8A 4Q3IA 3G3BA 2V9TB 4CILA 1YRGA 4NKGA 1XCDA 3WPHA 1SQ0B 5AWBA 4BSRA 4IM6A 1OGQA 4BSSA 2P1MB 4M7EA 5GMFA 4R07A 4MN8B 3RIZA 2P1QB 4HQ1A 1D0BA 3W3LA 4YEBB 4Z94G 3WPBA 3OJAB 2ELLA 4R5CA 4Z61C 2Z7XA 3W3JA 2UZXA 1DFJI 4J0MA 1H6TA 2RR6A 4P8SA 3OGKB 1OTNA 3WPCA 4LI2A 4ARNA 1M9SA 3UN9A 1K5DC 3UL8A 2IFGA 4R58A 1ZIWA 4RCWA 3RGZA 3CIYA 4PSJA 4WP6A 3OJAA 1O6TA 2BEXA 1OTOA 2Z66A 4KXFB 5IJBA 4FMZA 4J4LA 3UL9A 4C2AB 1O6SA 2Z64A 4PEQB 2WQVA 3C6NB 3G3AA 3UL7A 3WPIA 1XECA 1KOOA 5AWCA 2Z62A 4Z8GA 1M9LA 2OMTA 4AW4A 2Q4GW 1OZNA 3ZYIA 3CIGA 1DS9A 4Q62A 4R0AA 3E3ZA 1A4YA 3BZ5A 3VQ1A 2OMWA 4M7EC 2OMVA 5FTTB 5LFNA 5CMNA 4U7LA 4FCGA 2RA8A 1M10B 2A0ZA 4R08A 3GOZA 3E4GA 1H6UA 5B0NA 4FS7A 3ZYJA 2Z65A 2OMXA 5GS2B 4LXRA 5AWAA 1PGVA 3JB9j 4XOSA 1JL5A 4OQTA 1IO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYX C;  4QXE A;  3FXI A;  4LSX C;  3SB4 A;  4FHO A;  3M18 A;  3CVR A;  5AZ5 A;  4B8C D;  2OMY A;  1FO1 A;  4ECN A;  1DCE A;  2XWT C;  3RW6 A;  1OTM A;  1FS2 A;  3WN4 A;  2Y5Q A;  2WFH A;  5IJC A;  4XGO A;  3ULU A;  1OOK G;  3RFJ A;  2WQX A;  5HDH A;  1K5G C;  4I6J B;  2XOT A;  2CA6 A;  4RCA B;  3RFS A;  4H09 A;  4CC4 A;  1QYY A;  3RGX A;  4ECO A;  5AWD A;  4GT6 A;  3WPE A;  2JE0 A;  4MQW X;  4R6A A;  4V2C A;  4R6F A;  4GLP A;  4BSU A;  4FDW A;  4UFR A;  1XWD C;  3W3M A;  4R6G A;  3VQ2 A;  1FQV A;  1XKU A;  4CP6 A;  3WPG A;  1KOH A;  4LI1 A;  4PER A;  1LTX A;  4AY9 X;  4G8A A;  4ARR A;  3A79 B;  4CNM A;  3C6P B;  3OGL B;  2Z81 A;  4Z79 A;  5GS0 A;  4U08 A;  3E6J A;  3G06 A;  3E2J A;  4QC0 A;  5CMP A;  1O6V A;  2P1P B;  4L3F A;  3WPD A;  3G39 A;  3OGM B;  5D3I A;  1WWL A;  2O6S A;  3KJ4 A;  3C6O B;  4LSC A;  4BV4 R;  2WQU A;  3ULA A;  3P72 A;  1M0Z A;  4CNC A;  3O53 A;  3O6N A;  4PQ8 A;  5B0T A;  2Z63 A;  5GQR K;  4V2D A;  4CC4 C;  2JE1 A;  3RFE A;  1A9N A;  3DZE A;  2BNH A;  2WQW A;  4QBZ A;  3RW7 A;  1W8A A;  2FT3 A;  3ULV A;  2AST B;  2V9S A;  1P9A G;  4Q3G A;  4P91 A;  3TSR E;  4WYK A;  3W3G A;  4FD0 A;  3REZ A;  4LSA A;  2V70 A;  2JQD A;  4LSX A;  2P1N B;  4TZH A;  3W3N A;  4R09 A;  4V2E A;  5IJD A;  5A5C A;  2OMU A;  3W3K A;  1U0N D;  2P1O B;  4KT1 A;  4NKH A;  3RJ0 A;  3ZYO A;  1GWB A;  5GMH A;  2R9U A;  3M19 A;  4L3A A;  4Y61 B;  3ZYN A;  2UZY A;  4U09 A;  2OMZ A;  1Z7X W;  4KNG A;  4U06 A;  4K17 A;  4Z64 C;  3WPF A;  4PKI G;  2O6R A;  3G04 C;  1P8V A;  4R6J A;  4R5D A;  5GMG A;  1P8T A;  4C2B B;  1G9U A;  4LXS A;  1XEU A;  4RWT C;  4EZG A;  2ASS B;  2ID5 A;  4XSQ A;  5B4P A;  3PMH G;  2O6Q A;  5HZL B;  2Z82 A;  2Z7X B;  1FT8 A;  4Q3I A;  3G3B A;  2V9T B;  4CIL A;  1YRG A;  4NKG A;  1XCD A;  3WPH A;  1SQ0 B;  5AWB A;  4BSR A;  4IM6 A;  1OGQ A;  4BSS A;  2P1M B;  4M7E A;  5GMF A;  4R07 A;  4MN8 B;  3RIZ A;  2P1Q B;  4HQ1 A;  1D0B A;  3W3L A;  4YEB B;  4Z94 G;  3WPB A;  3OJA B;  2ELL A;  4R5C A;  4Z61 C;  2Z7X A;  3W3J A;  2UZX A;  1DFJ I;  4J0M A;  1H6T A;  2RR6 A;  4P8S A;  3OGK B;  1OTN A;  3WPC A;  4LI2 A;  4ARN A;  1M9S A;  3UN9 A;  1K5D C;  3UL8 A;  2IFG A;  4R58 A;  1ZIW A;  4RCW A;  3RGZ A;  3CIY A;  4PSJ A;  4WP6 A;  3OJA A;  1O6T A;  2BEX A;  1OTO A;  2Z66 A;  4KXF B;  5IJB A;  4FMZ A;  4J4L A;  3UL9 A;  4C2A B;  1O6S A;  2Z64 A;  4PEQ B;  2WQV A;  3C6N B;  3G3A A;  3UL7 A;  3WPI A;  1XEC A;  1KOO A;  5AWC A;  2Z62 A;  4Z8G A;  1M9L A;  2OMT A;  4AW4 A;  2Q4G W;  1OZN A;  3ZYI A;  3CIG A;  1DS9 A;  4Q62 A;  4R0A A;  3E3Z A;  1A4Y A;  3BZ5 A;  3VQ1 A;  2OMW A;  4M7E C;  2OMV A;  5FTT B;  5LFN A;  5CMN A;  4U7L A;  4FCG A;  2RA8 A;  1M10 B;  2A0Z A;  4R08 A;  3GOZ A;  3E4G A;  1H6U A;  5B0N A;  4FS7 A;  3ZYJ A;  2Z65 A;  2OMX A;  5GS2 B;  4LXR A;  5AWA A;  1PGV A;  3JB9 j;  4XOS A;  1JL5 A;  4OQT A;  1IO0 A; 
#chains in the Genus database with same CATH topology
 5IYX C;  4QXE A;  3FXI A;  4LSX C;  3SB4 A;  4FHO A;  3M18 A;  3CVR A;  5AZ5 A;  4B8C D;  2OMY A;  1FO1 A;  4ECN A;  1DCE A;  2XWT C;  3RW6 A;  1OTM A;  1FS2 A;  3WN4 A;  2Y5Q A;  2WFH A;  5IJC A;  4XGO A;  3ULU A;  1OOK G;  3RFJ A;  2WQX A;  5HDH A;  1K5G C;  4I6J B;  2XOT A;  2CA6 A;  4RCA B;  3RFS A;  4H09 A;  4CC4 A;  1QYY A;  3RGX A;  4ECO A;  5AWD A;  4GT6 A;  3WPE A;  2JE0 A;  4MQW X;  4R6A A;  4V2C A;  4R6F A;  4GLP A;  4BSU A;  4FDW A;  4UFR A;  1XWD C;  3W3M A;  4R6G A;  3VQ2 A;  1FQV A;  1XKU A;  4CP6 A;  3WPG A;  1KOH A;  4LI1 A;  4PER A;  1LTX A;  4AY9 X;  4G8A A;  4ARR A;  3A79 B;  4CNM A;  3C6P B;  3OGL B;  2Z81 A;  4Z79 A;  5GS0 A;  4U08 A;  3E6J A;  3G06 A;  3E2J A;  4QC0 A;  5CMP A;  1O6V A;  2P1P B;  4L3F A;  3WPD A;  3G39 A;  3OGM B;  5D3I A;  1WWL A;  2O6S A;  3KJ4 A;  3C6O B;  4LSC A;  4BV4 R;  2WQU A;  3ULA A;  3P72 A;  1M0Z A;  4CNC A;  3O53 A;  3O6N A;  4PQ8 A;  5B0T A;  2Z63 A;  5GQR K;  4V2D A;  4CC4 C;  2JE1 A;  3RFE A;  1A9N A;  3DZE A;  2BNH A;  2WQW A;  4QBZ A;  3RW7 A;  1W8A A;  2FT3 A;  3ULV A;  2AST B;  4NZR M;  2V9S A;  1P9A G;  4Q3G A;  4P91 A;  3TSR E;  4WYK A;  3W3G A;  4FD0 A;  3REZ A;  4LSA A;  2V70 A;  2JQD A;  4LSX A;  2P1N B;  4TZH A;  3W3N A;  4R09 A;  4V2E A;  5IJD A;  5A5C A;  2OMU A;  3W3K A;  1U0N D;  2P1O B;  4KT1 A;  4NKH A;  3RJ0 A;  3ZYO A;  1GWB A;  5GMH A;  2R9U A;  3M19 A;  4L3A A;  4Y61 B;  3ZYN A;  2UZY A;  4U09 A;  2OMZ A;  1Z7X W;  4KNG A;  4U06 A;  4K17 A;  4Z64 C;  3WPF A;  4PKI G;  2O6R A;  3G04 C;  1P8V A;  4R6J A;  4R5D A;  5GMG A;  1P8T A;  4C2B B;  1G9U A;  4LXS A;  1XEU A;  4RWT C;  4EZG A;  2ASS B;  2ID5 A;  4XSQ A;  5B4P A;  3PMH G;  2O6Q A;  5HZL B;  2Z82 A;  2Z7X B;  1FT8 A;  4Q3I A;  3G3B A;  2V9T B;  4CIL A;  1YRG A;  4NKG A;  1XCD A;  3WPH A;  1SQ0 B;  5AWB A;  4BSR A;  4IM6 A;  1OGQ A;  4BSS A;  2P1M B;  4M7E A;  5GMF A;  4R07 A;  4MN8 B;  3RIZ A;  2P1Q B;  4HQ1 A;  1D0B A;  3W3L A;  4YEB B;  4Z94 G;  3WPB A;  3OJA B;  2ELL A;  4R5C A;  4Z61 C;  2Z7X A;  3W3J A;  2UZX A;  1DFJ I;  4J0M A;  1H6T A;  2RR6 A;  4P8S A;  3OGK B;  1OTN A;  3WPC A;  4LI2 A;  4ARN A;  1M9S A;  3UN9 A;  1K5D C;  3UL8 A;  2IFG A;  4R58 A;  1ZIW A;  4RCW A;  3RGZ A;  3CIY A;  4PSJ A;  4WP6 A;  3OJA A;  1O6T A;  2BEX A;  1OTO A;  2Z66 A;  4KXF B;  5IJB A;  4FMZ A;  4J4L A;  3UL9 A;  4C2A B;  1O6S A;  2Z64 A;  4PEQ B;  2WQV A;  3C6N B;  3G3A A;  3UL7 A;  3WPI A;  1XEC A;  1KOO A;  5AWC A;  2Z62 A;  4Z8G A;  1M9L A;  2OMT A;  4AW4 A;  2Q4G W;  1OZN A;  3ZYI A;  3CIG A;  1DS9 A;  4Q62 A;  4R0A A;  3E3Z A;  1A4Y A;  3BZ5 A;  3VQ1 A;  2OMW A;  4M7E C;  2OMV A;  5FTT B;  5LFN A;  5CMN A;  4U7L A;  4FCG A;  2RA8 A;  1M10 B;  2A0Z A;  4R08 A;  4NZT M;  3GOZ A;  3E4G A;  1H6U A;  5B0N A;  4FS7 A;  3ZYJ A;  2Z65 A;  2OMX A;  5GS2 B;  4LXR A;  5AWA A;  1PGV A;  3JB9 j;  4XOS A;  1JL5 A;  4OQT A;  1IO0 A; 
#chains in the Genus database with same CATH homology
 5IYX C;  4QXE A;  3FXI A;  4LSX C;  3SB4 A;  4FHO A;  3M18 A;  3CVR A;  5AZ5 A;  4B8C D;  2OMY A;  1FO1 A;  4ECN A;  1DCE A;  2XWT C;  3RW6 A;  1OTM A;  1FS2 A;  3WN4 A;  2Y5Q A;  2WFH A;  5IJC A;  4XGO A;  3ULU A;  1OOK G;  3RFJ A;  2WQX A;  5HDH A;  1K5G C;  4I6J B;  2XOT A;  2CA6 A;  4RCA B;  3RFS A;  4H09 A;  4CC4 A;  1QYY A;  3RGX A;  4ECO A;  5AWD A;  4GT6 A;  3WPE A;  2JE0 A;  4MQW X;  4R6A A;  4V2C A;  4R6F A;  4GLP A;  4BSU A;  4FDW A;  4UFR A;  1XWD C;  3W3M A;  4R6G A;  3VQ2 A;  1FQV A;  1XKU A;  4CP6 A;  3WPG A;  1KOH A;  4LI1 A;  4PER A;  1LTX A;  4AY9 X;  4G8A A;  4ARR A;  3A79 B;  4CNM A;  3C6P B;  3OGL B;  2Z81 A;  4Z79 A;  5GS0 A;  4U08 A;  3E6J A;  3G06 A;  3E2J A;  4QC0 A;  5CMP A;  1O6V A;  2P1P B;  4L3F A;  3WPD A;  3G39 A;  3OGM B;  5D3I A;  1WWL A;  2O6S A;  3KJ4 A;  3C6O B;  4LSC A;  4BV4 R;  2WQU A;  3ULA A;  3P72 A;  1M0Z A;  4CNC A;  3O53 A;  3O6N A;  4PQ8 A;  5B0T A;  2Z63 A;  5GQR K;  4V2D A;  4CC4 C;  2JE1 A;  3RFE A;  1A9N A;  3DZE A;  2BNH A;  2WQW A;  4QBZ A;  3RW7 A;  1W8A A;  2FT3 A;  3ULV A;  2AST B;  2V9S A;  1P9A G;  4Q3G A;  4P91 A;  3TSR E;  4WYK A;  3W3G A;  4FD0 A;  3REZ A;  4LSA A;  2V70 A;  2JQD A;  4LSX A;  2P1N B;  4TZH A;  3W3N A;  4R09 A;  4V2E A;  5IJD A;  5A5C A;  2OMU A;  3W3K A;  1U0N D;  2P1O B;  4KT1 A;  4NKH A;  3RJ0 A;  3ZYO A;  1GWB A;  5GMH A;  2R9U A;  3M19 A;  4L3A A;  4Y61 B;  3ZYN A;  2UZY A;  4U09 A;  2OMZ A;  1Z7X W;  4KNG A;  4U06 A;  4K17 A;  4Z64 C;  3WPF A;  4PKI G;  2O6R A;  3G04 C;  1P8V A;  4R6J A;  4R5D A;  5GMG A;  1P8T A;  4C2B B;  1G9U A;  4LXS A;  1XEU A;  4RWT C;  4EZG A;  2ASS B;  2ID5 A;  4XSQ A;  5B4P A;  3PMH G;  2O6Q A;  5HZL B;  2Z82 A;  2Z7X B;  1FT8 A;  4Q3I A;  3G3B A;  2V9T B;  4CIL A;  1YRG A;  4NKG A;  1XCD A;  3WPH A;  1SQ0 B;  5AWB A;  4BSR A;  4IM6 A;  1OGQ A;  4BSS A;  2P1M B;  4M7E A;  5GMF A;  4R07 A;  4MN8 B;  3RIZ A;  2P1Q B;  4HQ1 A;  1D0B A;  3W3L A;  4YEB B;  4Z94 G;  3WPB A;  3OJA B;  2ELL A;  4R5C A;  4Z61 C;  2Z7X A;  3W3J A;  2UZX A;  1DFJ I;  4J0M A;  1H6T A;  2RR6 A;  4P8S A;  3OGK B;  1OTN A;  3WPC A;  4LI2 A;  4ARN A;  1M9S A;  3UN9 A;  1K5D C;  3UL8 A;  2IFG A;  4R58 A;  1ZIW A;  4RCW A;  3RGZ A;  3CIY A;  4PSJ A;  4WP6 A;  3OJA A;  1O6T A;  2BEX A;  1OTO A;  2Z66 A;  4KXF B;  5IJB A;  4FMZ A;  4J4L A;  3UL9 A;  4C2A B;  1O6S A;  2Z64 A;  4PEQ B;  2WQV A;  3C6N B;  3G3A A;  3UL7 A;  3WPI A;  1XEC A;  1KOO A;  5AWC A;  2Z62 A;  4Z8G A;  1M9L A;  2OMT A;  4AW4 A;  2Q4G W;  1OZN A;  3ZYI A;  3CIG A;  1DS9 A;  4Q62 A;  4R0A A;  3E3Z A;  1A4Y A;  3BZ5 A;  3VQ1 A;  2OMW A;  4M7E C;  2OMV A;  5FTT B;  5LFN A;  5CMN A;  4U7L A;  4FCG A;  2RA8 A;  1M10 B;  2A0Z A;  4R08 A;  3GOZ A;  3E4G A;  1H6U A;  5B0N A;  4FS7 A;  3ZYJ A;  2Z65 A;  2OMX A;  5GS2 B;  4LXR A;  5AWA A;  1PGV A;  3JB9 j;  4XOS A;  1JL5 A;  4OQT A;  1IO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...