4V2EA

Flrt3 lrr domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
321
structure length
321
Chain Sequence
SCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords FIBRONECTIN LEUCINE RICH TRANSMEMBRANE PROTEIN 3
publication title Flrt Structure: Balancing Repulsion and Cell Adhesion in Cortical and Vascular Development.
pubmed doi rcsb
source organism Mus musculus
total genus 70
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4v2eA00
4C2BB 1FO1A 3C6PB 1XKUA 5HDHA 3P72A 3WPFA 4R08A 4BSRA 2JE0A 4Z61C 4U7LA 4Z64C 1OTOA 4P91A 3C6OB 2Q4GW 4L3FA 3WPCA 4IM6A 4YEBB 2FT3A 4FS7A 4FMZA 1FQVA 5IYXC 4B8CD 2UZYA 1OTMA 3RGZA 3A79B 1P8TA 3RJ0A 2OMYA 3JB9j 4WP6A 2Z82A 4R0AA 1K5DC 3ZYIA 5LFNA 1OTNA 1FS2A 1XECA 4KNGA 2OMTA 4V2DA 4XOSA 4FCGA 4Q3IA 4R6GA 4PSJA 1OZNA 1QYYA 2JQDA 2O6SA 2Y5QA 2UZXA 1DFJI 4Q62A 3TSRE 4AY9X 4K17A 3OJAB 3VQ1A 4XSQA 1H6UA 5AWAA 4PERA 3C6NB 1DCEA 3RIZA 2JE1A 1P8VA 1XEUA 5B0NA 4QC0A 2O6QA 2RR6A 4Z94G 1A4YA 2Z66A 4I6JB 1G9UA 1XWDC 1M9SA 1H6TA 3M18A 4U09A 5GS0A 4OQTA 2P1PB 2V70A 4V2CA 4M7EC 4BV4R 4EZGA 3E2JA 1O6SA 3W3MA 4R5DA 4PQ8A 5FTTB 4CC4C 4AW4A 3ZYNA 2P1NB 4Y61B 4TZHA 4ECOA 3ZYOA 4C2AB 3WPHA 4PEQB 3OGKB 3UN9A 5GMGA 4LI2A 2ASTB 5GS2B 4R07A 4FD0A 2OMXA 1M9LA 5AWBA 4PKIG 5GMFA 4U08A 4R6AA 4ARNA 3RGXA 2ID5A 4FHOA 2BNHA 5A5CA 1O6VA 4KT1A 4CP6A 1OOKG 2P1QB 3RFJA 3WPBA 3WN4A 3DZEA 3FXIA 3CIYA 3WPIA 3REZA 1A9NA 2ELLA 3BZ5A 3WPEA 4M7EA 1ZIWA 2WQUA 2R9UA 1FT8A 3RFEA 1SQ0B 4LXRA 3E6JA 4Z8GA 1GWBA 4R5CA 3GOZA 3ZYJA 4CC4A 4H09A 4R58A 3UL8A 3RW6A 2OMUA 4Q3GA 4LSXC 2WQXA 5IJCA 5AZ5A 4CILA 3G04C 4ECNA 2WFHA 3KJ4A 5B4PA 5GQRK 3O53A 3UL9A 2Z62A 4RCWA 3RFSA 2IFGA 4CNMA 4ARRA 3VQ2A 4XGOA 4FDWA 2WQWA 1M0ZA 2O6RA 5B0TA 3RW7A 1U0ND 4LSCA 2ASSB 4WYKA 3ULUA 4G8AA 5IJBA 3W3LA 3WPGA 5AWCA 4RWTC 4R6FA 1JL5A 4MQWX 1P9AG 4MN8B 3OGMB 1IO0A 1KOHA 4GLPA 4P8SA 1PGVA 2RA8A 1XCDA 4L3AA 3E3ZA 4LXSA 1M10B 3ULVA 4LSXA 1WWLA 1W8AA 2OMVA 2V9SA 2A0ZA 4NKHA 3UL7A 3O6NA 4CNCA 3CVRA 1DS9A 3PMHG 2OMZA 5HZLB 1K5GC 4KXFB 3WPDA 4J0MA 5D3IA 4BSSA 2CA6A 2XOTA 4R6JA 4NKGA 3G3AA 4HQ1A 3G06A 3W3GA 4R09A 3W3KA 4LI1A 3E4GA 4V2EA 5GMHA 5CMPA 4QXEA 1LTXA 2P1MB 3OJAA 3M19A 2XWTC 2Z7XA 2BEXA 4J4LA 4UFRA 3G3BA 5AWDA 2Z81A 5CMNA 2Z7XB 3OGLB 5IJDA 3SB4A 2Z65A 3W3JA 1YRGA 2Z64A 1Z7XW 1O6TA 2WQVA 4Z79A 2Z63A 4BSUA 1D0BA 3ULAA 4QBZA 4GT6A 3G39A 2P1OB 4LSAA 3CIGA 3W3NA 2OMWA 4RCAB 1KOOA 4U06A 1OGQA 2V9TB
chains in the Genus database with same CATH superfamily
4C2BB 1FO1A 3C6PB 1XKUA 5HDHA 3P72A 3WPFA 4R08A 4BSRA 2JE0A 4Z61C 4U7LA 4Z64C 1OTOA 4P91A 3C6OB 2Q4GW 4L3FA 3WPCA 4IM6A 4YEBB 2FT3A 4FS7A 4FMZA 1FQVA 5IYXC 4B8CD 2UZYA 1OTMA 3RGZA 3A79B 1P8TA 3RJ0A 2OMYA 3JB9j 4WP6A 2Z82A 4R0AA 1K5DC 3ZYIA 5LFNA 1OTNA 1FS2A 1XECA 4KNGA 2OMTA 4V2DA 4XOSA 4FCGA 4Q3IA 4R6GA 4PSJA 1OZNA 1QYYA 2JQDA 2O6SA 2Y5QA 2UZXA 1DFJI 4Q62A 3TSRE 4AY9X 4K17A 3OJAB 3VQ1A 4XSQA 1H6UA 5AWAA 4PERA 3C6NB 1DCEA 3RIZA 2JE1A 1P8VA 1XEUA 5B0NA 4QC0A 2O6QA 2RR6A 4Z94G 1A4YA 2Z66A 4I6JB 1G9UA 1XWDC 1M9SA 1H6TA 3M18A 4U09A 5GS0A 4OQTA 2P1PB 2V70A 4V2CA 4M7EC 4BV4R 4EZGA 3E2JA 1O6SA 3W3MA 4R5DA 4PQ8A 5FTTB 4CC4C 4AW4A 3ZYNA 2P1NB 4Y61B 4TZHA 4ECOA 3ZYOA 4C2AB 3WPHA 4PEQB 3OGKB 3UN9A 5GMGA 4LI2A 2ASTB 5GS2B 4R07A 4FD0A 2OMXA 1M9LA 5AWBA 4PKIG 5GMFA 4U08A 4R6AA 4ARNA 3RGXA 2ID5A 4FHOA 2BNHA 5A5CA 1O6VA 4KT1A 4CP6A 1OOKG 2P1QB 3RFJA 3WPBA 3WN4A 3DZEA 3FXIA 3CIYA 3WPIA 3REZA 1A9NA 2ELLA 3BZ5A 3WPEA 4M7EA 1ZIWA 2WQUA 2R9UA 1FT8A 3RFEA 1SQ0B 4LXRA 3E6JA 4Z8GA 1GWBA 4R5CA 3GOZA 3ZYJA 4CC4A 4H09A 4R58A 3UL8A 3RW6A 2OMUA 4Q3GA 4LSXC 2WQXA 5IJCA 5AZ5A 4CILA 3G04C 4ECNA 2WFHA 3KJ4A 5B4PA 5GQRK 3O53A 3UL9A 2Z62A 4RCWA 3RFSA 2IFGA 4CNMA 4ARRA 3VQ2A 4XGOA 4FDWA 2WQWA 1M0ZA 2O6RA 5B0TA 3RW7A 1U0ND 4LSCA 2ASSB 4WYKA 3ULUA 4G8AA 5IJBA 3W3LA 3WPGA 5AWCA 4RWTC 4R6FA 1JL5A 4MQWX 1P9AG 4MN8B 3OGMB 1IO0A 1KOHA 4GLPA 4P8SA 1PGVA 2RA8A 1XCDA 4L3AA 3E3ZA 4LXSA 1M10B 3ULVA 4LSXA 1WWLA 1W8AA 2OMVA 2V9SA 2A0ZA 4NKHA 3UL7A 3O6NA 4CNCA 3CVRA 1DS9A 3PMHG 2OMZA 5HZLB 1K5GC 4KXFB 3WPDA 4J0MA 5D3IA 4BSSA 2CA6A 2XOTA 4R6JA 4NKGA 3G3AA 4HQ1A 3G06A 3W3GA 4R09A 3W3KA 4NZRM 4LI1A 3E4GA 4V2EA 5GMHA 4NZTM 5CMPA 4QXEA 1LTXA 2P1MB 3OJAA 3M19A 2XWTC 2Z7XA 2BEXA 4J4LA 4UFRA 3G3BA 5AWDA 2Z81A 5CMNA 2Z7XB 3OGLB 5IJDA 3SB4A 2Z65A 3W3JA 1YRGA 2Z64A 1Z7XW 1O6TA 2WQVA 4Z79A 2Z63A 4BSUA 1D0BA 3ULAA 4QBZA 4GT6A 3G39A 2P1OB 4LSAA 3CIGA 3W3NA 2OMWA 4RCAB 1KOOA 4U06A 1OGQA 2V9TB
chains in the Genus database with same CATH topology
4C2BB 1FO1A 3C6PB 1XKUA 5HDHA 3P72A 3WPFA 4R08A 4BSRA 2JE0A 4Z61C 4U7LA 4Z64C 1OTOA 4P91A 3C6OB 2Q4GW 4L3FA 3WPCA 4IM6A 4YEBB 2FT3A 4FS7A 4FMZA 1FQVA 5IYXC 4B8CD 2UZYA 1OTMA 3RGZA 3A79B 1P8TA 3RJ0A 2OMYA 3JB9j 4WP6A 2Z82A 4R0AA 1K5DC 3ZYIA 5LFNA 1OTNA 1FS2A 1XECA 4KNGA 2OMTA 4V2DA 4XOSA 4FCGA 4Q3IA 4R6GA 4PSJA 1OZNA 1QYYA 2JQDA 2O6SA 2Y5QA 2UZXA 1DFJI 4Q62A 3TSRE 4AY9X 4K17A 3OJAB 3VQ1A 4XSQA 1H6UA 5AWAA 4PERA 3C6NB 1DCEA 3RIZA 2JE1A 1P8VA 1XEUA 5B0NA 4QC0A 2O6QA 2RR6A 4Z94G 1A4YA 2Z66A 4I6JB 1G9UA 1XWDC 1M9SA 1H6TA 3M18A 4U09A 5GS0A 4OQTA 2P1PB 2V70A 4V2CA 4M7EC 4BV4R 4EZGA 3E2JA 1O6SA 3W3MA 4R5DA 4PQ8A 5FTTB 4CC4C 4AW4A 3ZYNA 2P1NB 4Y61B 4TZHA 4ECOA 3ZYOA 4C2AB 3WPHA 4PEQB 3OGKB 3UN9A 5GMGA 4LI2A 2ASTB 5GS2B 4R07A 4FD0A 2OMXA 1M9LA 5AWBA 4PKIG 5GMFA 4U08A 4R6AA 4ARNA 3RGXA 2ID5A 4FHOA 2BNHA 5A5CA 1O6VA 4KT1A 4CP6A 1OOKG 2P1QB 3RFJA 3WPBA 3WN4A 3DZEA 3FXIA 3CIYA 3WPIA 3REZA 1A9NA 2ELLA 3BZ5A 3WPEA 4M7EA 1ZIWA 2WQUA 2R9UA 1FT8A 3RFEA 1SQ0B 4LXRA 3E6JA 4Z8GA 1GWBA 4R5CA 3GOZA 3ZYJA 4CC4A 4H09A 4R58A 3UL8A 3RW6A 2OMUA 4Q3GA 4LSXC 2WQXA 5IJCA 5AZ5A 4CILA 3G04C 4ECNA 2WFHA 3KJ4A 5B4PA 5GQRK 3O53A 3UL9A 2Z62A 4RCWA 3RFSA 2IFGA 4CNMA 4ARRA 3VQ2A 4XGOA 4FDWA 2WQWA 1M0ZA 2O6RA 5B0TA 3RW7A 1U0ND 4LSCA 2ASSB 4WYKA 3ULUA 4G8AA 5IJBA 3W3LA 3WPGA 5AWCA 4RWTC 4R6FA 1JL5A 4MQWX 1P9AG 4MN8B 3OGMB 1IO0A 1KOHA 4GLPA 4P8SA 1PGVA 2RA8A 1XCDA 4L3AA 3E3ZA 4LXSA 1M10B 3ULVA 4LSXA 1WWLA 1W8AA 2OMVA 2V9SA 2A0ZA 4NKHA 3UL7A 3O6NA 4CNCA 3CVRA 1DS9A 3PMHG 2OMZA 5HZLB 1K5GC 4KXFB 3WPDA 4J0MA 5D3IA 4BSSA 2CA6A 2XOTA 4R6JA 4NKGA 3G3AA 4HQ1A 3G06A 3W3GA 4R09A 3W3KA 4LI1A 3E4GA 4V2EA 5GMHA 5CMPA 4QXEA 1LTXA 2P1MB 3OJAA 3M19A 2XWTC 2Z7XA 2BEXA 4J4LA 4UFRA 3G3BA 5AWDA 2Z81A 5CMNA 2Z7XB 3OGLB 5IJDA 3SB4A 2Z65A 3W3JA 1YRGA 2Z64A 1Z7XW 1O6TA 2WQVA 4Z79A 2Z63A 4BSUA 1D0BA 3ULAA 4QBZA 4GT6A 3G39A 2P1OB 4LSAA 3CIGA 3W3NA 2OMWA 4RCAB 1KOOA 4U06A 1OGQA 2V9TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2B B;  1FO1 A;  3C6P B;  1XKU A;  5HDH A;  3P72 A;  3WPF A;  4R08 A;  4BSR A;  2JE0 A;  4Z61 C;  4U7L A;  4Z64 C;  1OTO A;  4P91 A;  3C6O B;  2Q4G W;  4L3F A;  3WPC A;  4IM6 A;  4YEB B;  2FT3 A;  4FS7 A;  4FMZ A;  1FQV A;  5IYX C;  4B8C D;  2UZY A;  1OTM A;  3RGZ A;  3A79 B;  1P8T A;  3RJ0 A;  2OMY A;  3JB9 j;  4WP6 A;  2Z82 A;  4R0A A;  1K5D C;  3ZYI A;  5LFN A;  1OTN A;  1FS2 A;  1XEC A;  4KNG A;  2OMT A;  4V2D A;  4XOS A;  4FCG A;  4Q3I A;  4R6G A;  4PSJ A;  1OZN A;  1QYY A;  2JQD A;  2O6S A;  2Y5Q A;  2UZX A;  1DFJ I;  4Q62 A;  3TSR E;  4AY9 X;  4K17 A;  3OJA B;  3VQ1 A;  4XSQ A;  1H6U A;  5AWA A;  4PER A;  3C6N B;  1DCE A;  3RIZ A;  2JE1 A;  1P8V A;  1XEU A;  5B0N A;  4QC0 A;  2O6Q A;  2RR6 A;  4Z94 G;  1A4Y A;  2Z66 A;  4I6J B;  1G9U A;  1XWD C;  1M9S A;  1H6T A;  3M18 A;  4U09 A;  5GS0 A;  4OQT A;  2P1P B;  2V70 A;  4V2C A;  4M7E C;  4BV4 R;  4EZG A;  3E2J A;  1O6S A;  3W3M A;  4R5D A;  4PQ8 A;  5FTT B;  4CC4 C;  4AW4 A;  3ZYN A;  2P1N B;  4Y61 B;  4TZH A;  4ECO A;  3ZYO A;  4C2A B;  3WPH A;  4PEQ B;  3OGK B;  3UN9 A;  5GMG A;  4LI2 A;  2AST B;  5GS2 B;  4R07 A;  4FD0 A;  2OMX A;  1M9L A;  5AWB A;  4PKI G;  5GMF A;  4U08 A;  4R6A A;  4ARN A;  3RGX A;  2ID5 A;  4FHO A;  2BNH A;  5A5C A;  1O6V A;  4KT1 A;  4CP6 A;  1OOK G;  2P1Q B;  3RFJ A;  3WPB A;  3WN4 A;  3DZE A;  3FXI A;  3CIY A;  3WPI A;  3REZ A;  1A9N A;  2ELL A;  3BZ5 A;  3WPE A;  4M7E A;  1ZIW A;  2WQU A;  2R9U A;  1FT8 A;  3RFE A;  1SQ0 B;  4LXR A;  3E6J A;  4Z8G A;  1GWB A;  4R5C A;  3GOZ A;  3ZYJ A;  4CC4 A;  4H09 A;  4R58 A;  3UL8 A;  3RW6 A;  2OMU A;  4Q3G A;  4LSX C;  2WQX A;  5IJC A;  5AZ5 A;  4CIL A;  3G04 C;  4ECN A;  2WFH A;  3KJ4 A;  5B4P A;  5GQR K;  3O53 A;  3UL9 A;  2Z62 A;  4RCW A;  3RFS A;  2IFG A;  4CNM A;  4ARR A;  3VQ2 A;  4XGO A;  4FDW A;  2WQW A;  1M0Z A;  2O6R A;  5B0T A;  3RW7 A;  1U0N D;  4LSC A;  2ASS B;  4WYK A;  3ULU A;  4G8A A;  5IJB A;  3W3L A;  3WPG A;  5AWC A;  4RWT C;  4R6F A;  1JL5 A;  4MQW X;  1P9A G;  4MN8 B;  3OGM B;  1IO0 A;  1KOH A;  4GLP A;  4P8S A;  1PGV A;  2RA8 A;  1XCD A;  4L3A A;  3E3Z A;  4LXS A;  1M10 B;  3ULV A;  4LSX A;  1WWL A;  1W8A A;  2OMV A;  2V9S A;  2A0Z A;  4NKH A;  3UL7 A;  3O6N A;  4CNC A;  3CVR A;  1DS9 A;  3PMH G;  2OMZ A;  5HZL B;  1K5G C;  4KXF B;  3WPD A;  4J0M A;  5D3I A;  4BSS A;  2CA6 A;  2XOT A;  4R6J A;  4NKG A;  3G3A A;  4HQ1 A;  3G06 A;  3W3G A;  4R09 A;  3W3K A;  4LI1 A;  3E4G A;  4V2E A;  5GMH A;  5CMP A;  4QXE A;  1LTX A;  2P1M B;  3OJA A;  3M19 A;  2XWT C;  2Z7X A;  2BEX A;  4J4L A;  4UFR A;  3G3B A;  5AWD A;  2Z81 A;  5CMN A;  2Z7X B;  3OGL B;  5IJD A;  3SB4 A;  2Z65 A;  3W3J A;  1YRG A;  2Z64 A;  1Z7X W;  1O6T A;  2WQV A;  4Z79 A;  2Z63 A;  4BSU A;  1D0B A;  3ULA A;  4QBZ A;  4GT6 A;  3G39 A;  2P1O B;  4LSA A;  3CIG A;  3W3N A;  2OMW A;  4RCA B;  1KOO A;  4U06 A;  1OGQ A;  2V9T B; 
#chains in the Genus database with same CATH topology
 4C2B B;  1FO1 A;  3C6P B;  1XKU A;  5HDH A;  3P72 A;  3WPF A;  4R08 A;  4BSR A;  2JE0 A;  4Z61 C;  4U7L A;  4Z64 C;  1OTO A;  4P91 A;  3C6O B;  2Q4G W;  4L3F A;  3WPC A;  4IM6 A;  4YEB B;  2FT3 A;  4FS7 A;  4FMZ A;  1FQV A;  5IYX C;  4B8C D;  2UZY A;  1OTM A;  3RGZ A;  3A79 B;  1P8T A;  3RJ0 A;  2OMY A;  3JB9 j;  4WP6 A;  2Z82 A;  4R0A A;  1K5D C;  3ZYI A;  5LFN A;  1OTN A;  1FS2 A;  1XEC A;  4KNG A;  2OMT A;  4V2D A;  4XOS A;  4FCG A;  4Q3I A;  4R6G A;  4PSJ A;  1OZN A;  1QYY A;  2JQD A;  2O6S A;  2Y5Q A;  2UZX A;  1DFJ I;  4Q62 A;  3TSR E;  4AY9 X;  4K17 A;  3OJA B;  3VQ1 A;  4XSQ A;  1H6U A;  5AWA A;  4PER A;  3C6N B;  1DCE A;  3RIZ A;  2JE1 A;  1P8V A;  1XEU A;  5B0N A;  4QC0 A;  2O6Q A;  2RR6 A;  4Z94 G;  1A4Y A;  2Z66 A;  4I6J B;  1G9U A;  1XWD C;  1M9S A;  1H6T A;  3M18 A;  4U09 A;  5GS0 A;  4OQT A;  2P1P B;  2V70 A;  4V2C A;  4M7E C;  4BV4 R;  4EZG A;  3E2J A;  1O6S A;  3W3M A;  4R5D A;  4PQ8 A;  5FTT B;  4CC4 C;  4AW4 A;  3ZYN A;  2P1N B;  4Y61 B;  4TZH A;  4ECO A;  3ZYO A;  4C2A B;  3WPH A;  4PEQ B;  3OGK B;  3UN9 A;  5GMG A;  4LI2 A;  2AST B;  5GS2 B;  4R07 A;  4FD0 A;  2OMX A;  1M9L A;  5AWB A;  4PKI G;  5GMF A;  4U08 A;  4R6A A;  4ARN A;  3RGX A;  2ID5 A;  4FHO A;  2BNH A;  5A5C A;  1O6V A;  4KT1 A;  4CP6 A;  1OOK G;  2P1Q B;  3RFJ A;  3WPB A;  3WN4 A;  3DZE A;  3FXI A;  3CIY A;  3WPI A;  3REZ A;  1A9N A;  2ELL A;  3BZ5 A;  3WPE A;  4M7E A;  1ZIW A;  2WQU A;  2R9U A;  1FT8 A;  3RFE A;  1SQ0 B;  4LXR A;  3E6J A;  4Z8G A;  1GWB A;  4R5C A;  3GOZ A;  3ZYJ A;  4CC4 A;  4H09 A;  4R58 A;  3UL8 A;  3RW6 A;  2OMU A;  4Q3G A;  4LSX C;  2WQX A;  5IJC A;  5AZ5 A;  4CIL A;  3G04 C;  4ECN A;  2WFH A;  3KJ4 A;  5B4P A;  5GQR K;  3O53 A;  3UL9 A;  2Z62 A;  4RCW A;  3RFS A;  2IFG A;  4CNM A;  4ARR A;  3VQ2 A;  4XGO A;  4FDW A;  2WQW A;  1M0Z A;  2O6R A;  5B0T A;  3RW7 A;  1U0N D;  4LSC A;  2ASS B;  4WYK A;  3ULU A;  4G8A A;  5IJB A;  3W3L A;  3WPG A;  5AWC A;  4RWT C;  4R6F A;  1JL5 A;  4MQW X;  1P9A G;  4MN8 B;  3OGM B;  1IO0 A;  1KOH A;  4GLP A;  4P8S A;  1PGV A;  2RA8 A;  1XCD A;  4L3A A;  3E3Z A;  4LXS A;  1M10 B;  3ULV A;  4LSX A;  1WWL A;  1W8A A;  2OMV A;  2V9S A;  2A0Z A;  4NKH A;  3UL7 A;  3O6N A;  4CNC A;  3CVR A;  1DS9 A;  3PMH G;  2OMZ A;  5HZL B;  1K5G C;  4KXF B;  3WPD A;  4J0M A;  5D3I A;  4BSS A;  2CA6 A;  2XOT A;  4R6J A;  4NKG A;  3G3A A;  4HQ1 A;  3G06 A;  3W3G A;  4R09 A;  3W3K A;  4NZR M;  4LI1 A;  3E4G A;  4V2E A;  5GMH A;  4NZT M;  5CMP A;  4QXE A;  1LTX A;  2P1M B;  3OJA A;  3M19 A;  2XWT C;  2Z7X A;  2BEX A;  4J4L A;  4UFR A;  3G3B A;  5AWD A;  2Z81 A;  5CMN A;  2Z7X B;  3OGL B;  5IJD A;  3SB4 A;  2Z65 A;  3W3J A;  1YRG A;  2Z64 A;  1Z7X W;  1O6T A;  2WQV A;  4Z79 A;  2Z63 A;  4BSU A;  1D0B A;  3ULA A;  4QBZ A;  4GT6 A;  3G39 A;  2P1O B;  4LSA A;  3CIG A;  3W3N A;  2OMW A;  4RCA B;  1KOO A;  4U06 A;  1OGQ A;  2V9T B; 
#chains in the Genus database with same CATH homology
 4C2B B;  1FO1 A;  3C6P B;  1XKU A;  5HDH A;  3P72 A;  3WPF A;  4R08 A;  4BSR A;  2JE0 A;  4Z61 C;  4U7L A;  4Z64 C;  1OTO A;  4P91 A;  3C6O B;  2Q4G W;  4L3F A;  3WPC A;  4IM6 A;  4YEB B;  2FT3 A;  4FS7 A;  4FMZ A;  1FQV A;  5IYX C;  4B8C D;  2UZY A;  1OTM A;  3RGZ A;  3A79 B;  1P8T A;  3RJ0 A;  2OMY A;  3JB9 j;  4WP6 A;  2Z82 A;  4R0A A;  1K5D C;  3ZYI A;  5LFN A;  1OTN A;  1FS2 A;  1XEC A;  4KNG A;  2OMT A;  4V2D A;  4XOS A;  4FCG A;  4Q3I A;  4R6G A;  4PSJ A;  1OZN A;  1QYY A;  2JQD A;  2O6S A;  2Y5Q A;  2UZX A;  1DFJ I;  4Q62 A;  3TSR E;  4AY9 X;  4K17 A;  3OJA B;  3VQ1 A;  4XSQ A;  1H6U A;  5AWA A;  4PER A;  3C6N B;  1DCE A;  3RIZ A;  2JE1 A;  1P8V A;  1XEU A;  5B0N A;  4QC0 A;  2O6Q A;  2RR6 A;  4Z94 G;  1A4Y A;  2Z66 A;  4I6J B;  1G9U A;  1XWD C;  1M9S A;  1H6T A;  3M18 A;  4U09 A;  5GS0 A;  4OQT A;  2P1P B;  2V70 A;  4V2C A;  4M7E C;  4BV4 R;  4EZG A;  3E2J A;  1O6S A;  3W3M A;  4R5D A;  4PQ8 A;  5FTT B;  4CC4 C;  4AW4 A;  3ZYN A;  2P1N B;  4Y61 B;  4TZH A;  4ECO A;  3ZYO A;  4C2A B;  3WPH A;  4PEQ B;  3OGK B;  3UN9 A;  5GMG A;  4LI2 A;  2AST B;  5GS2 B;  4R07 A;  4FD0 A;  2OMX A;  1M9L A;  5AWB A;  4PKI G;  5GMF A;  4U08 A;  4R6A A;  4ARN A;  3RGX A;  2ID5 A;  4FHO A;  2BNH A;  5A5C A;  1O6V A;  4KT1 A;  4CP6 A;  1OOK G;  2P1Q B;  3RFJ A;  3WPB A;  3WN4 A;  3DZE A;  3FXI A;  3CIY A;  3WPI A;  3REZ A;  1A9N A;  2ELL A;  3BZ5 A;  3WPE A;  4M7E A;  1ZIW A;  2WQU A;  2R9U A;  1FT8 A;  3RFE A;  1SQ0 B;  4LXR A;  3E6J A;  4Z8G A;  1GWB A;  4R5C A;  3GOZ A;  3ZYJ A;  4CC4 A;  4H09 A;  4R58 A;  3UL8 A;  3RW6 A;  2OMU A;  4Q3G A;  4LSX C;  2WQX A;  5IJC A;  5AZ5 A;  4CIL A;  3G04 C;  4ECN A;  2WFH A;  3KJ4 A;  5B4P A;  5GQR K;  3O53 A;  3UL9 A;  2Z62 A;  4RCW A;  3RFS A;  2IFG A;  4CNM A;  4ARR A;  3VQ2 A;  4XGO A;  4FDW A;  2WQW A;  1M0Z A;  2O6R A;  5B0T A;  3RW7 A;  1U0N D;  4LSC A;  2ASS B;  4WYK A;  3ULU A;  4G8A A;  5IJB A;  3W3L A;  3WPG A;  5AWC A;  4RWT C;  4R6F A;  1JL5 A;  4MQW X;  1P9A G;  4MN8 B;  3OGM B;  1IO0 A;  1KOH A;  4GLP A;  4P8S A;  1PGV A;  2RA8 A;  1XCD A;  4L3A A;  3E3Z A;  4LXS A;  1M10 B;  3ULV A;  4LSX A;  1WWL A;  1W8A A;  2OMV A;  2V9S A;  2A0Z A;  4NKH A;  3UL7 A;  3O6N A;  4CNC A;  3CVR A;  1DS9 A;  3PMH G;  2OMZ A;  5HZL B;  1K5G C;  4KXF B;  3WPD A;  4J0M A;  5D3I A;  4BSS A;  2CA6 A;  2XOT A;  4R6J A;  4NKG A;  3G3A A;  4HQ1 A;  3G06 A;  3W3G A;  4R09 A;  3W3K A;  4LI1 A;  3E4G A;  4V2E A;  5GMH A;  5CMP A;  4QXE A;  1LTX A;  2P1M B;  3OJA A;  3M19 A;  2XWT C;  2Z7X A;  2BEX A;  4J4L A;  4UFR A;  3G3B A;  5AWD A;  2Z81 A;  5CMN A;  2Z7X B;  3OGL B;  5IJD A;  3SB4 A;  2Z65 A;  3W3J A;  1YRG A;  2Z64 A;  1Z7X W;  1O6T A;  2WQV A;  4Z79 A;  2Z63 A;  4BSU A;  1D0B A;  3ULA A;  4QBZ A;  4GT6 A;  3G39 A;  2P1O B;  4LSA A;  3CIG A;  3W3N A;  2OMW A;  4RCA B;  1KOO A;  4U06 A;  1OGQ A;  2V9T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...