4V2EA

Flrt3 lrr domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
321
structure length
321
Chain Sequence
SCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN LEUCINE RICH TRANSMEMBRANE PROTEIN 3
publication title Flrt Structure: Balancing Repulsion and Cell Adhesion in Cortical and Vascular Development.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 70
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4v2eA00
3W3LA 1D0BA 3WPHA 3G39A 4FCGA 3O53A 3G3AA 3UL7A 4CC4A 2ASSB 3WPGA 3OGMB 4KT1A 4V2EA 2A0ZA 5B4PA 3C6NB 3RGZA 4XOSA 3RJ0A 5IYXC 1XWDC 2WQUA 5B0NA 2P1MB 5FTTB 4L3AA 5CMNA 2ASTB 5AZ5A 3P72A 2Y5QA 4B8CD 5HZLB 3REZA 5GS0A 4TZHA 4L3FA 4CP6A 3DZEA 4Z61C 3E6JA 1M9SA 2P1OB 1OOKG 1OTMA 5GQRK 4R0AA 1OGQA 1QYYA 4P8SA 3G06A 4PQ8A 4R6GA 2OMWA 4R09A 4V2DA 5HDHA 3ULVA 3E3ZA 1DS9A 2P1NB 4C2BB 3UN9A 5IJDA 4BSSA 4R5DA 4Z79A 4CNCA 2Z66A 1OZNA 3O6NA 3M18A 1YRGA 4KNGA 4BSRA 3G04C 5GMFA 4KXFB 1GWBA 4FMZA 3RFJA 2IFGA 1O6TA 4GLPA 3KJ4A 3W3NA 4HQ1A 3E2JA 3W3GA 4M7EC 4Q3GA 1FS2A 2Z81A 2Q4GW 4RWTC 1FO1A 1IO0A 4QC0A 3ULUA 4UFRA 1H6UA 3UL9A 4FHOA 5GMGA 1LTXA 2Z65A 4LSXA 2R9UA 2ID5A 1ZIWA 1H6TA 1XCDA 2OMYA 2O6RA 4CNMA 2WQVA 2XWTC 2V9TB 4C2AB 1K5DC 1FT8A 4U06A 4U09A 3A79B 1A4YA 4I6JB 5GS2B 4Z64C 3JB9j 1O6SA 3ZYIA 5B0TA 3E4GA 4R58A 4EZGA 3RFEA 1KOOA 5AWCA 1OTOA 3C6OB 3TSRE 5AWAA 4R07A 4U7LA 4PEQB 4ARNA 1XEUA 3OJAB 2XOTA 4RCWA 3VQ2A 1M10B 4PSJA 3OGKB 1PGVA 5IJCA 1P8TA 2Z63A 2OMVA 1WWLA 3RW6A 2O6QA 4WP6A 5GMHA 4IM6A 2BNHA 4BV4R 4Z94G 4H09A 1P9AG 3WPFA 2P1PB 4LSCA 4MN8B 4MQWX 3W3KA 3WPCA 1XKUA 1OTNA 1K5GC 3FXIA 3OGLB 1G9UA 5AWBA 3UL8A 4LSAA 4V2CA 3ZYNA 4NKGA 1JL5A 4ARRA 2OMTA 2Z64A 4QBZA 3VQ1A 3RFSA 2JE1A 4RCAB 2WQWA 1DCEA 4G8AA 4J4LA 4M7EA 3ULAA 2RA8A 2ELLA 4PKIG 2BEXA 4NKHA 2UZXA 4ECNA 4BSUA 4R6AA 4CC4C 3W3MA 4CILA 3PMHG 3BZ5A 4R08A 1SQ0B 1W8AA 1Z7XW 1P8VA 2O6SA 4J0MA 2UZYA 4XGOA 4LXRA 4AW4A 3RIZA 2JE0A 5D3IA 3CIGA 4PERA 4WYKA 4R6JA 1A9NA 3CIYA 4OQTA 4ECOA 5IJBA 3OJAA 3WPDA 2OMZA 3G3BA 2Z82A 3WPBA 4LXSA 5CMPA 3C6PB 2V70A 4FDWA 4GT6A 4P91A 4Q62A 1U0ND 4Q3IA 4FD0A 1XECA 2V9SA 2P1QB 1DFJI 2WFHA 3W3JA 1KOHA 5AWDA 4U08A 5LFNA 1M0ZA 4YEBB 2CA6A 3RW7A 2Z62A 4XSQA 2OMXA 4LI2A 4QXEA 3ZYOA 3WN4A 3CVRA 5A5CA 4AY9X 2FT3A 2WQXA 3WPEA 4LI1A 2RR6A 4R6FA 4Z8GA 3ZYJA 4FS7A 2Z7XA 2Z7XB 1O6VA 4R5CA 3GOZA 3M19A 1M9LA 2JQDA 2OMUA 3SB4A 1FQVA 3RGXA 3WPIA 4K17A 4Y61B 4LSXC
chains in the Genus database with same CATH superfamily
3W3LA 1D0BA 3WPHA 3G39A 4FCGA 3O53A 3G3AA 3UL7A 4CC4A 2ASSB 3WPGA 3OGMB 4KT1A 4V2EA 2A0ZA 5B4PA 3C6NB 3RGZA 4XOSA 3RJ0A 5IYXC 1XWDC 2WQUA 5B0NA 2P1MB 5FTTB 4L3AA 5CMNA 2ASTB 5AZ5A 3P72A 2Y5QA 4B8CD 5HZLB 3REZA 5GS0A 4TZHA 4L3FA 4CP6A 3DZEA 4Z61C 3E6JA 1M9SA 2P1OB 1OOKG 1OTMA 5GQRK 4R0AA 1OGQA 1QYYA 4P8SA 3G06A 4PQ8A 4R6GA 2OMWA 4R09A 4V2DA 5HDHA 3ULVA 3E3ZA 1DS9A 2P1NB 4C2BB 3UN9A 5IJDA 4BSSA 4R5DA 4Z79A 4CNCA 2Z66A 4NZRM 1OZNA 3O6NA 3M18A 1YRGA 4KNGA 4BSRA 3G04C 5GMFA 4KXFB 1GWBA 4FMZA 3RFJA 2IFGA 1O6TA 4GLPA 3KJ4A 3W3NA 4HQ1A 3E2JA 3W3GA 4M7EC 4Q3GA 1FS2A 2Z81A 2Q4GW 4RWTC 1FO1A 1IO0A 4QC0A 3ULUA 4UFRA 1H6UA 3UL9A 4FHOA 5GMGA 1LTXA 2Z65A 4LSXA 2R9UA 2ID5A 1ZIWA 1H6TA 1XCDA 2OMYA 2O6RA 4CNMA 2WQVA 2XWTC 2V9TB 4C2AB 1K5DC 1FT8A 4U06A 4U09A 3A79B 1A4YA 4I6JB 5GS2B 4Z64C 3JB9j 1O6SA 3ZYIA 5B0TA 3E4GA 4R58A 4EZGA 3RFEA 1KOOA 5AWCA 1OTOA 3C6OB 3TSRE 5AWAA 4R07A 4U7LA 4PEQB 4ARNA 1XEUA 3OJAB 2XOTA 4RCWA 3VQ2A 1M10B 4PSJA 3OGKB 1PGVA 5IJCA 1P8TA 2Z63A 2OMVA 1WWLA 2O6QA 3RW6A 4WP6A 5GMHA 4IM6A 2BNHA 4BV4R 4Z94G 4H09A 1P9AG 3WPFA 2P1PB 4LSCA 4MN8B 4MQWX 3W3KA 3WPCA 1XKUA 1OTNA 1K5GC 3FXIA 3OGLB 1G9UA 5AWBA 3UL8A 4LSAA 4V2CA 3ZYNA 4NKGA 1JL5A 4ARRA 2OMTA 2Z64A 4QBZA 3VQ1A 3RFSA 2JE1A 4RCAB 2WQWA 1DCEA 4G8AA 4J4LA 4M7EA 3ULAA 2RA8A 2ELLA 4PKIG 2BEXA 4NKHA 2UZXA 4ECNA 4BSUA 4R6AA 4CC4C 3W3MA 4CILA 3PMHG 3BZ5A 4R08A 1SQ0B 1W8AA 1Z7XW 1P8VA 2O6SA 4J0MA 2UZYA 4XGOA 4LXRA 4AW4A 3RIZA 2JE0A 5D3IA 4NZTM 3CIGA 4PERA 4WYKA 4R6JA 1A9NA 3CIYA 4OQTA 4ECOA 5IJBA 3OJAA 3WPDA 2OMZA 3G3BA 2Z82A 3WPBA 4LXSA 5CMPA 3C6PB 2V70A 4FDWA 4GT6A 4P91A 4Q62A 1U0ND 4Q3IA 4FD0A 1XECA 2V9SA 2P1QB 1DFJI 2WFHA 3W3JA 1KOHA 5AWDA 4U08A 5LFNA 1M0ZA 4YEBB 2CA6A 3RW7A 2Z62A 4XSQA 2OMXA 4LI2A 4QXEA 3ZYOA 3WN4A 3CVRA 5A5CA 4AY9X 2FT3A 2WQXA 3WPEA 4LI1A 2RR6A 4R6FA 4Z8GA 3ZYJA 4FS7A 2Z7XA 2Z7XB 1O6VA 4R5CA 3GOZA 3M19A 1M9LA 2JQDA 2OMUA 3SB4A 1FQVA 3RGXA 3WPIA 4K17A 4Y61B 4LSXC
chains in the Genus database with same CATH topology
3W3LA 1D0BA 3WPHA 3G39A 4FCGA 3O53A 3G3AA 3UL7A 4CC4A 2ASSB 3WPGA 3OGMB 4KT1A 4V2EA 2A0ZA 5B4PA 3C6NB 3RGZA 4XOSA 3RJ0A 5IYXC 1XWDC 2WQUA 5B0NA 2P1MB 5FTTB 4L3AA 5CMNA 2ASTB 5AZ5A 3P72A 2Y5QA 4B8CD 5HZLB 3REZA 5GS0A 4TZHA 4L3FA 4CP6A 3DZEA 4Z61C 3E6JA 1M9SA 2P1OB 1OOKG 1OTMA 5GQRK 4R0AA 1OGQA 1QYYA 4P8SA 3G06A 4PQ8A 4R6GA 2OMWA 4R09A 4V2DA 5HDHA 3ULVA 3E3ZA 1DS9A 2P1NB 4C2BB 3UN9A 5IJDA 4BSSA 4R5DA 4Z79A 4CNCA 2Z66A 1OZNA 3O6NA 3M18A 1YRGA 4KNGA 4BSRA 3G04C 5GMFA 4KXFB 1GWBA 4FMZA 3RFJA 2IFGA 1O6TA 4GLPA 3KJ4A 3W3NA 4HQ1A 3E2JA 3W3GA 4M7EC 4Q3GA 1FS2A 2Z81A 2Q4GW 4RWTC 1FO1A 1IO0A 4QC0A 3ULUA 4UFRA 1H6UA 3UL9A 4FHOA 5GMGA 1LTXA 2Z65A 4LSXA 2R9UA 2ID5A 1ZIWA 1H6TA 1XCDA 2OMYA 2O6RA 4CNMA 2WQVA 2XWTC 2V9TB 4C2AB 1K5DC 1FT8A 4U06A 4U09A 3A79B 1A4YA 4I6JB 5GS2B 4Z64C 3JB9j 1O6SA 3ZYIA 5B0TA 3E4GA 4R58A 4EZGA 3RFEA 1KOOA 5AWCA 1OTOA 3C6OB 3TSRE 5AWAA 4R07A 4U7LA 4PEQB 4ARNA 1XEUA 3OJAB 2XOTA 4RCWA 3VQ2A 1M10B 4PSJA 3OGKB 1PGVA 5IJCA 1P8TA 2Z63A 2OMVA 1WWLA 3RW6A 2O6QA 4WP6A 5GMHA 4IM6A 2BNHA 4BV4R 4Z94G 4H09A 1P9AG 3WPFA 2P1PB 4LSCA 4MN8B 4MQWX 3W3KA 3WPCA 1XKUA 1OTNA 1K5GC 3FXIA 3OGLB 1G9UA 5AWBA 3UL8A 4LSAA 4V2CA 3ZYNA 4NKGA 1JL5A 4ARRA 2OMTA 2Z64A 4QBZA 3VQ1A 3RFSA 2JE1A 4RCAB 2WQWA 1DCEA 4G8AA 4J4LA 4M7EA 3ULAA 2RA8A 2ELLA 4PKIG 2BEXA 4NKHA 2UZXA 4ECNA 4BSUA 4R6AA 4CC4C 3W3MA 4CILA 3PMHG 3BZ5A 4R08A 1SQ0B 1W8AA 1Z7XW 1P8VA 2O6SA 4J0MA 2UZYA 4XGOA 4LXRA 4AW4A 3RIZA 2JE0A 5D3IA 3CIGA 4PERA 4WYKA 4R6JA 1A9NA 3CIYA 4OQTA 4ECOA 5IJBA 3OJAA 3WPDA 2OMZA 3G3BA 2Z82A 3WPBA 4LXSA 5CMPA 3C6PB 2V70A 4FDWA 4GT6A 4P91A 4Q62A 1U0ND 4Q3IA 4FD0A 1XECA 2V9SA 2P1QB 1DFJI 2WFHA 3W3JA 1KOHA 5AWDA 4U08A 5LFNA 1M0ZA 4YEBB 2CA6A 3RW7A 2Z62A 4XSQA 2OMXA 4LI2A 4QXEA 3ZYOA 3WN4A 3CVRA 5A5CA 4AY9X 2FT3A 2WQXA 3WPEA 4LI1A 2RR6A 4R6FA 4Z8GA 3ZYJA 4FS7A 2Z7XA 2Z7XB 1O6VA 4R5CA 3GOZA 3M19A 1M9LA 2JQDA 2OMUA 3SB4A 1FQVA 3RGXA 3WPIA 4K17A 4Y61B 4LSXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W3L A;  1D0B A;  3WPH A;  3G39 A;  4FCG A;  3O53 A;  3G3A A;  3UL7 A;  4CC4 A;  2ASS B;  3WPG A;  3OGM B;  4KT1 A;  4V2E A;  2A0Z A;  5B4P A;  3C6N B;  3RGZ A;  4XOS A;  3RJ0 A;  5IYX C;  1XWD C;  2WQU A;  5B0N A;  2P1M B;  5FTT B;  4L3A A;  5CMN A;  2AST B;  5AZ5 A;  3P72 A;  2Y5Q A;  4B8C D;  5HZL B;  3REZ A;  5GS0 A;  4TZH A;  4L3F A;  4CP6 A;  3DZE A;  4Z61 C;  3E6J A;  1M9S A;  2P1O B;  1OOK G;  1OTM A;  5GQR K;  4R0A A;  1OGQ A;  1QYY A;  4P8S A;  3G06 A;  4PQ8 A;  4R6G A;  2OMW A;  4R09 A;  4V2D A;  5HDH A;  3ULV A;  3E3Z A;  1DS9 A;  2P1N B;  4C2B B;  3UN9 A;  5IJD A;  4BSS A;  4R5D A;  4Z79 A;  4CNC A;  2Z66 A;  1OZN A;  3O6N A;  3M18 A;  1YRG A;  4KNG A;  4BSR A;  3G04 C;  5GMF A;  4KXF B;  1GWB A;  4FMZ A;  3RFJ A;  2IFG A;  1O6T A;  4GLP A;  3KJ4 A;  3W3N A;  4HQ1 A;  3E2J A;  3W3G A;  4M7E C;  4Q3G A;  1FS2 A;  2Z81 A;  2Q4G W;  4RWT C;  1FO1 A;  1IO0 A;  4QC0 A;  3ULU A;  4UFR A;  1H6U A;  3UL9 A;  4FHO A;  5GMG A;  1LTX A;  2Z65 A;  4LSX A;  2R9U A;  2ID5 A;  1ZIW A;  1H6T A;  1XCD A;  2OMY A;  2O6R A;  4CNM A;  2WQV A;  2XWT C;  2V9T B;  4C2A B;  1K5D C;  1FT8 A;  4U06 A;  4U09 A;  3A79 B;  1A4Y A;  4I6J B;  5GS2 B;  4Z64 C;  3JB9 j;  1O6S A;  3ZYI A;  5B0T A;  3E4G A;  4R58 A;  4EZG A;  3RFE A;  1KOO A;  5AWC A;  1OTO A;  3C6O B;  3TSR E;  5AWA A;  4R07 A;  4U7L A;  4PEQ B;  4ARN A;  1XEU A;  3OJA B;  2XOT A;  4RCW A;  3VQ2 A;  1M10 B;  4PSJ A;  3OGK B;  1PGV A;  5IJC A;  1P8T A;  2Z63 A;  2OMV A;  1WWL A;  3RW6 A;  2O6Q A;  4WP6 A;  5GMH A;  4IM6 A;  2BNH A;  4BV4 R;  4Z94 G;  4H09 A;  1P9A G;  3WPF A;  2P1P B;  4LSC A;  4MN8 B;  4MQW X;  3W3K A;  3WPC A;  1XKU A;  1OTN A;  1K5G C;  3FXI A;  3OGL B;  1G9U A;  5AWB A;  3UL8 A;  4LSA A;  4V2C A;  3ZYN A;  4NKG A;  1JL5 A;  4ARR A;  2OMT A;  2Z64 A;  4QBZ A;  3VQ1 A;  3RFS A;  2JE1 A;  4RCA B;  2WQW A;  1DCE A;  4G8A A;  4J4L A;  4M7E A;  3ULA A;  2RA8 A;  2ELL A;  4PKI G;  2BEX A;  4NKH A;  2UZX A;  4ECN A;  4BSU A;  4R6A A;  4CC4 C;  3W3M A;  4CIL A;  3PMH G;  3BZ5 A;  4R08 A;  1SQ0 B;  1W8A A;  1Z7X W;  1P8V A;  2O6S A;  4J0M A;  2UZY A;  4XGO A;  4LXR A;  4AW4 A;  3RIZ A;  2JE0 A;  5D3I A;  3CIG A;  4PER A;  4WYK A;  4R6J A;  1A9N A;  3CIY A;  4OQT A;  4ECO A;  5IJB A;  3OJA A;  3WPD A;  2OMZ A;  3G3B A;  2Z82 A;  3WPB A;  4LXS A;  5CMP A;  3C6P B;  2V70 A;  4FDW A;  4GT6 A;  4P91 A;  4Q62 A;  1U0N D;  4Q3I A;  4FD0 A;  1XEC A;  2V9S A;  2P1Q B;  1DFJ I;  2WFH A;  3W3J A;  1KOH A;  5AWD A;  4U08 A;  5LFN A;  1M0Z A;  4YEB B;  2CA6 A;  3RW7 A;  2Z62 A;  4XSQ A;  2OMX A;  4LI2 A;  4QXE A;  3ZYO A;  3WN4 A;  3CVR A;  5A5C A;  4AY9 X;  2FT3 A;  2WQX A;  3WPE A;  4LI1 A;  2RR6 A;  4R6F A;  4Z8G A;  3ZYJ A;  4FS7 A;  2Z7X A;  2Z7X B;  1O6V A;  4R5C A;  3GOZ A;  3M19 A;  1M9L A;  2JQD A;  2OMU A;  3SB4 A;  1FQV A;  3RGX A;  3WPI A;  4K17 A;  4Y61 B;  4LSX C; 
#chains in the Genus database with same CATH topology
 3W3L A;  1D0B A;  3WPH A;  3G39 A;  4FCG A;  3O53 A;  3G3A A;  3UL7 A;  4CC4 A;  2ASS B;  3WPG A;  3OGM B;  4KT1 A;  4V2E A;  2A0Z A;  5B4P A;  3C6N B;  3RGZ A;  4XOS A;  3RJ0 A;  5IYX C;  1XWD C;  2WQU A;  5B0N A;  2P1M B;  5FTT B;  4L3A A;  5CMN A;  2AST B;  5AZ5 A;  3P72 A;  2Y5Q A;  4B8C D;  5HZL B;  3REZ A;  5GS0 A;  4TZH A;  4L3F A;  4CP6 A;  3DZE A;  4Z61 C;  3E6J A;  1M9S A;  2P1O B;  1OOK G;  1OTM A;  5GQR K;  4R0A A;  1OGQ A;  1QYY A;  4P8S A;  3G06 A;  4PQ8 A;  4R6G A;  2OMW A;  4R09 A;  4V2D A;  5HDH A;  3ULV A;  3E3Z A;  1DS9 A;  2P1N B;  4C2B B;  3UN9 A;  5IJD A;  4BSS A;  4R5D A;  4Z79 A;  4CNC A;  2Z66 A;  4NZR M;  1OZN A;  3O6N A;  3M18 A;  1YRG A;  4KNG A;  4BSR A;  3G04 C;  5GMF A;  4KXF B;  1GWB A;  4FMZ A;  3RFJ A;  2IFG A;  1O6T A;  4GLP A;  3KJ4 A;  3W3N A;  4HQ1 A;  3E2J A;  3W3G A;  4M7E C;  4Q3G A;  1FS2 A;  2Z81 A;  2Q4G W;  4RWT C;  1FO1 A;  1IO0 A;  4QC0 A;  3ULU A;  4UFR A;  1H6U A;  3UL9 A;  4FHO A;  5GMG A;  1LTX A;  2Z65 A;  4LSX A;  2R9U A;  2ID5 A;  1ZIW A;  1H6T A;  1XCD A;  2OMY A;  2O6R A;  4CNM A;  2WQV A;  2XWT C;  2V9T B;  4C2A B;  1K5D C;  1FT8 A;  4U06 A;  4U09 A;  3A79 B;  1A4Y A;  4I6J B;  5GS2 B;  4Z64 C;  3JB9 j;  1O6S A;  3ZYI A;  5B0T A;  3E4G A;  4R58 A;  4EZG A;  3RFE A;  1KOO A;  5AWC A;  1OTO A;  3C6O B;  3TSR E;  5AWA A;  4R07 A;  4U7L A;  4PEQ B;  4ARN A;  1XEU A;  3OJA B;  2XOT A;  4RCW A;  3VQ2 A;  1M10 B;  4PSJ A;  3OGK B;  1PGV A;  5IJC A;  1P8T A;  2Z63 A;  2OMV A;  1WWL A;  2O6Q A;  3RW6 A;  4WP6 A;  5GMH A;  4IM6 A;  2BNH A;  4BV4 R;  4Z94 G;  4H09 A;  1P9A G;  3WPF A;  2P1P B;  4LSC A;  4MN8 B;  4MQW X;  3W3K A;  3WPC A;  1XKU A;  1OTN A;  1K5G C;  3FXI A;  3OGL B;  1G9U A;  5AWB A;  3UL8 A;  4LSA A;  4V2C A;  3ZYN A;  4NKG A;  1JL5 A;  4ARR A;  2OMT A;  2Z64 A;  4QBZ A;  3VQ1 A;  3RFS A;  2JE1 A;  4RCA B;  2WQW A;  1DCE A;  4G8A A;  4J4L A;  4M7E A;  3ULA A;  2RA8 A;  2ELL A;  4PKI G;  2BEX A;  4NKH A;  2UZX A;  4ECN A;  4BSU A;  4R6A A;  4CC4 C;  3W3M A;  4CIL A;  3PMH G;  3BZ5 A;  4R08 A;  1SQ0 B;  1W8A A;  1Z7X W;  1P8V A;  2O6S A;  4J0M A;  2UZY A;  4XGO A;  4LXR A;  4AW4 A;  3RIZ A;  2JE0 A;  5D3I A;  4NZT M;  3CIG A;  4PER A;  4WYK A;  4R6J A;  1A9N A;  3CIY A;  4OQT A;  4ECO A;  5IJB A;  3OJA A;  3WPD A;  2OMZ A;  3G3B A;  2Z82 A;  3WPB A;  4LXS A;  5CMP A;  3C6P B;  2V70 A;  4FDW A;  4GT6 A;  4P91 A;  4Q62 A;  1U0N D;  4Q3I A;  4FD0 A;  1XEC A;  2V9S A;  2P1Q B;  1DFJ I;  2WFH A;  3W3J A;  1KOH A;  5AWD A;  4U08 A;  5LFN A;  1M0Z A;  4YEB B;  2CA6 A;  3RW7 A;  2Z62 A;  4XSQ A;  2OMX A;  4LI2 A;  4QXE A;  3ZYO A;  3WN4 A;  3CVR A;  5A5C A;  4AY9 X;  2FT3 A;  2WQX A;  3WPE A;  4LI1 A;  2RR6 A;  4R6F A;  4Z8G A;  3ZYJ A;  4FS7 A;  2Z7X A;  2Z7X B;  1O6V A;  4R5C A;  3GOZ A;  3M19 A;  1M9L A;  2JQD A;  2OMU A;  3SB4 A;  1FQV A;  3RGX A;  3WPI A;  4K17 A;  4Y61 B;  4LSX C; 
#chains in the Genus database with same CATH homology
 3W3L A;  1D0B A;  3WPH A;  3G39 A;  4FCG A;  3O53 A;  3G3A A;  3UL7 A;  4CC4 A;  2ASS B;  3WPG A;  3OGM B;  4KT1 A;  4V2E A;  2A0Z A;  5B4P A;  3C6N B;  3RGZ A;  4XOS A;  3RJ0 A;  5IYX C;  1XWD C;  2WQU A;  5B0N A;  2P1M B;  5FTT B;  4L3A A;  5CMN A;  2AST B;  5AZ5 A;  3P72 A;  2Y5Q A;  4B8C D;  5HZL B;  3REZ A;  5GS0 A;  4TZH A;  4L3F A;  4CP6 A;  3DZE A;  4Z61 C;  3E6J A;  1M9S A;  2P1O B;  1OOK G;  1OTM A;  5GQR K;  4R0A A;  1OGQ A;  1QYY A;  4P8S A;  3G06 A;  4PQ8 A;  4R6G A;  2OMW A;  4R09 A;  4V2D A;  5HDH A;  3ULV A;  3E3Z A;  1DS9 A;  2P1N B;  4C2B B;  3UN9 A;  5IJD A;  4BSS A;  4R5D A;  4Z79 A;  4CNC A;  2Z66 A;  1OZN A;  3O6N A;  3M18 A;  1YRG A;  4KNG A;  4BSR A;  3G04 C;  5GMF A;  4KXF B;  1GWB A;  4FMZ A;  3RFJ A;  2IFG A;  1O6T A;  4GLP A;  3KJ4 A;  3W3N A;  4HQ1 A;  3E2J A;  3W3G A;  4M7E C;  4Q3G A;  1FS2 A;  2Z81 A;  2Q4G W;  4RWT C;  1FO1 A;  1IO0 A;  4QC0 A;  3ULU A;  4UFR A;  1H6U A;  3UL9 A;  4FHO A;  5GMG A;  1LTX A;  2Z65 A;  4LSX A;  2R9U A;  2ID5 A;  1ZIW A;  1H6T A;  1XCD A;  2OMY A;  2O6R A;  4CNM A;  2WQV A;  2XWT C;  2V9T B;  4C2A B;  1K5D C;  1FT8 A;  4U06 A;  4U09 A;  3A79 B;  1A4Y A;  4I6J B;  5GS2 B;  4Z64 C;  3JB9 j;  1O6S A;  3ZYI A;  5B0T A;  3E4G A;  4R58 A;  4EZG A;  3RFE A;  1KOO A;  5AWC A;  1OTO A;  3C6O B;  3TSR E;  5AWA A;  4R07 A;  4U7L A;  4PEQ B;  4ARN A;  1XEU A;  3OJA B;  2XOT A;  4RCW A;  3VQ2 A;  1M10 B;  4PSJ A;  3OGK B;  1PGV A;  5IJC A;  1P8T A;  2Z63 A;  2OMV A;  1WWL A;  3RW6 A;  2O6Q A;  4WP6 A;  5GMH A;  4IM6 A;  2BNH A;  4BV4 R;  4Z94 G;  4H09 A;  1P9A G;  3WPF A;  2P1P B;  4LSC A;  4MN8 B;  4MQW X;  3W3K A;  3WPC A;  1XKU A;  1OTN A;  1K5G C;  3FXI A;  3OGL B;  1G9U A;  5AWB A;  3UL8 A;  4LSA A;  4V2C A;  3ZYN A;  4NKG A;  1JL5 A;  4ARR A;  2OMT A;  2Z64 A;  4QBZ A;  3VQ1 A;  3RFS A;  2JE1 A;  4RCA B;  2WQW A;  1DCE A;  4G8A A;  4J4L A;  4M7E A;  3ULA A;  2RA8 A;  2ELL A;  4PKI G;  2BEX A;  4NKH A;  2UZX A;  4ECN A;  4BSU A;  4R6A A;  4CC4 C;  3W3M A;  4CIL A;  3PMH G;  3BZ5 A;  4R08 A;  1SQ0 B;  1W8A A;  1Z7X W;  1P8V A;  2O6S A;  4J0M A;  2UZY A;  4XGO A;  4LXR A;  4AW4 A;  3RIZ A;  2JE0 A;  5D3I A;  3CIG A;  4PER A;  4WYK A;  4R6J A;  1A9N A;  3CIY A;  4OQT A;  4ECO A;  5IJB A;  3OJA A;  3WPD A;  2OMZ A;  3G3B A;  2Z82 A;  3WPB A;  4LXS A;  5CMP A;  3C6P B;  2V70 A;  4FDW A;  4GT6 A;  4P91 A;  4Q62 A;  1U0N D;  4Q3I A;  4FD0 A;  1XEC A;  2V9S A;  2P1Q B;  1DFJ I;  2WFH A;  3W3J A;  1KOH A;  5AWD A;  4U08 A;  5LFN A;  1M0Z A;  4YEB B;  2CA6 A;  3RW7 A;  2Z62 A;  4XSQ A;  2OMX A;  4LI2 A;  4QXE A;  3ZYO A;  3WN4 A;  3CVR A;  5A5C A;  4AY9 X;  2FT3 A;  2WQX A;  3WPE A;  4LI1 A;  2RR6 A;  4R6F A;  4Z8G A;  3ZYJ A;  4FS7 A;  2Z7X A;  2Z7X B;  1O6V A;  4R5C A;  3GOZ A;  3M19 A;  1M9L A;  2JQD A;  2OMU A;  3SB4 A;  1FQV A;  3RGX A;  3WPI A;  4K17 A;  4Y61 B;  4LSX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...