4V2EA

Flrt3 lrr domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
321
structure length
321
Chain Sequence
b'SCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN LEUCINE RICH TRANSMEMBRANE PROTEIN 3
publication title Flrt Structure: Balancing Repulsion and Cell Adhesion in Cortical and Vascular Development.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 70
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4v2eA00
2RR6A 3O6NA 3E3ZA 3UL8A 4LXSA 4J0MA 4LI2A 3ZYNA 4PERA 1FO1A 4R5CA 5GMGA 1JL5A 1QYYA 4XSQA 1K5GC 4C2AB 1OTMA 4Z64C 1M10B 3OGKB 4XOSA 4ARNA 3WPGA 3WPDA 4J4LA 4R0AA 5FTTB 3OJAA 4CP6A 1D0BA 4H09A 1OTNA 3WPFA 4C2BB 2P1PB 2UZXA 3A79B 2ASTB 4AW4A 1M0ZA 3OJAB 4CILA 5GS2B 4QXEA 3WN4A 3G3AA 5AWDA 1WWLA 2OMYA 4BSRA 5GS0A 2OMXA 3WPBA 4UFRA 4CNMA 4U7LA 5B0TA 1PGVA 2Z63A 4WP6A 4LSXC 3W3KA 1P8TA 3G04C 2O6RA 4R5DA 3G06A 1LTXA 5LFNA 4FCGA 2Z64A 4K17A 3M19A 2Z65A 3WPHA 3G39A 2P1NB 1W8AA 3CIGA 4ARRA 4L3FA 2ID5A 4KNGA 3RGXA 4BV4R 1OTOA 4LI1A 1IO0A 1OZNA 2RA8A 1A9NA 4NKHA 4CNCA 3ULUA 4RCAB 2JE1A 4MQWX 2V70A 2IFGA 2Z81A 3RW6A 4RWTC 4G8AA 2P1MB 5IJCA 3SB4A 4M7EC 4Z79A 4R09A 2R9UA 1KOHA 2Z7XA 3PMHG 2JE0A 1OGQA 3VQ1A 1M9SA 4I6JB 4V2CA 4Q3GA 2WQXA 2Z7XB 4WYKA 1O6TA 3REZA 4U08A 3WPEA 2XOTA 2OMTA 3RW7A 4BSUA 4FMZA 4XGOA 3W3GA 1A4YA 1FS2A 1XKUA 3RJ0A 5AWAA 4GLPA 4NKGA 3E4GA 2O6SA 1XCDA 2V9TB 3FXIA 4FD0A 4FDWA 4V2DA 3ULVA 3W3JA 5HDHA 4HQ1A 1FT8A 2WFHA 1KOOA 4QC0A 3CVRA 4QBZA 2WQUA 4R6GA 1O6SA 2OMVA 4Q3IA 5IYXC 1GWBA 4FS7A 1DS9A 2Y5QA 4LSXA 2OMUA 1OOKG 4R07A 1SQ0B 2JQDA 3W3NA 4Z8GA 4P91A 1O6VA 2Z66A 5GMFA 4PSJA 2ASSB 1XECA 3TSRE 5GMHA 4MN8B 4Q62A 4PQ8A 3KJ4A 2OMZA 2Z62A 4CC4C 4LSAA 5IJDA 3RIZA 2A0ZA 1DCEA 2ELLA 4PEQB 1M9LA 5IJBA 4BSSA 4M7EA 4EZGA 1P9AG 5CMPA 4FHOA 3GOZA 3ZYJA 4TZHA 4ECNA 1YRGA 3CIYA 1P8VA 2BNHA 2P1OB 5AZ5A 5CMNA 4Z94G 3DZEA 4YEBB 3VQ2A 2XWTC 3O53A 2WQWA 2Z82A 4Y61B 4OQTA 5AWCA 4KT1A 3C6NB 3UN9A 4U06A 4PKIG 5AWBA 1FQVA 4B8CD 3C6OB 5B0NA 3ZYIA 1XEUA 3OGLB 3W3MA 4ECOA 3W3LA 3UL9A 4R6JA 4L3AA 3ZYOA 4RCWA 3JB9j 2CA6A 4LXRA 1H6UA 1G9UA 3P72A 3RGZA 3C6PB 3RFEA 5GQRK 3M18A 1XWDC 4IM6A 4P8SA 4Z61C 3E6JA 2Q4GW 4V2EA 3WPIA 4R6AA 2V9SA 5HZLB 1DFJI 2UZYA 4R08A 4LSCA 2FT3A 4R58A 4AY9X 3WPCA 4KXFB 5D3IA 3OGMB 2OMWA 5B4PA 3E2JA 2P1QB 1K5DC 5A5CA 4CC4A 3BZ5A 3ULAA 1ZIWA 3RFJA 3RFSA 4R6FA 4U09A 1U0ND 4GT6A 3G3BA 3UL7A 2WQVA 1Z7XW 2O6QA 1H6TA 2BEXA
chains in the Genus database with same CATH superfamily
2RR6A 3O6NA 3E3ZA 3UL8A 4LXSA 4J0MA 4LI2A 3ZYNA 4PERA 1FO1A 4R5CA 5GMGA 1JL5A 1QYYA 4XSQA 1K5GC 4C2AB 1OTMA 4Z64C 1M10B 3OGKB 4XOSA 4ARNA 3WPGA 3WPDA 4J4LA 4R0AA 5FTTB 3OJAA 4CP6A 1D0BA 4H09A 1OTNA 3WPFA 4C2BB 2P1PB 2UZXA 3A79B 2ASTB 4AW4A 1M0ZA 3OJAB 4CILA 5GS2B 4QXEA 3WN4A 3G3AA 5AWDA 1WWLA 2OMYA 4BSRA 5GS0A 2OMXA 3WPBA 4UFRA 4CNMA 4U7LA 5B0TA 1PGVA 2Z63A 4WP6A 4LSXC 3W3KA 1P8TA 3G04C 2O6RA 4R5DA 3G06A 1LTXA 5LFNA 4FCGA 2Z64A 4K17A 3M19A 2Z65A 3WPHA 3G39A 2P1NB 1W8AA 3CIGA 4ARRA 4L3FA 2ID5A 4KNGA 3RGXA 4BV4R 1OTOA 4LI1A 1IO0A 1OZNA 2RA8A 1A9NA 4NKHA 4CNCA 3ULUA 4RCAB 2JE1A 4MQWX 2V70A 2IFGA 2Z81A 3RW6A 4RWTC 4G8AA 2P1MB 5IJCA 3SB4A 4M7EC 4Z79A 4R09A 2R9UA 1KOHA 2Z7XA 3PMHG 2JE0A 1OGQA 3VQ1A 1M9SA 4I6JB 4V2CA 4Q3GA 2WQXA 2Z7XB 4WYKA 1O6TA 3REZA 4U08A 3WPEA 2XOTA 2OMTA 3RW7A 4NZRM 4BSUA 4FMZA 4XGOA 3W3GA 1A4YA 1FS2A 1XKUA 3RJ0A 5AWAA 4GLPA 4NKGA 3E4GA 2O6SA 1XCDA 2V9TB 3FXIA 4FD0A 4FDWA 4V2DA 3ULVA 3W3JA 5HDHA 4HQ1A 1FT8A 2WFHA 1KOOA 4QC0A 3CVRA 4QBZA 2WQUA 4R6GA 1O6SA 2OMVA 4Q3IA 5IYXC 1GWBA 4FS7A 1DS9A 2Y5QA 4LSXA 2OMUA 1OOKG 4R07A 1SQ0B 2JQDA 3W3NA 4Z8GA 4P91A 1O6VA 2Z66A 5GMFA 4PSJA 2ASSB 1XECA 3TSRE 5GMHA 4MN8B 4Q62A 4PQ8A 3KJ4A 2OMZA 2Z62A 4CC4C 4LSAA 5IJDA 3RIZA 2A0ZA 1DCEA 2ELLA 4PEQB 1M9LA 5IJBA 4BSSA 4M7EA 4EZGA 1P9AG 5CMPA 4FHOA 3GOZA 3ZYJA 4TZHA 4ECNA 1YRGA 3CIYA 1P8VA 2BNHA 2P1OB 5AZ5A 5CMNA 4Z94G 3DZEA 4YEBB 3VQ2A 2XWTC 3O53A 2WQWA 2Z82A 4Y61B 4OQTA 5AWCA 4KT1A 3C6NB 3UN9A 4U06A 4PKIG 5AWBA 1FQVA 4B8CD 3C6OB 5B0NA 4NZTM 3ZYIA 1XEUA 3OGLB 3W3MA 4ECOA 3W3LA 3UL9A 4R6JA 4L3AA 3ZYOA 4RCWA 3JB9j 2CA6A 4LXRA 1H6UA 1G9UA 3P72A 3RGZA 3C6PB 3RFEA 5GQRK 3M18A 1XWDC 4IM6A 4P8SA 4Z61C 3E6JA 2Q4GW 4V2EA 3WPIA 4R6AA 2V9SA 5HZLB 1DFJI 2UZYA 4R08A 4LSCA 2FT3A 4R58A 4AY9X 3WPCA 4KXFB 5D3IA 3OGMB 2OMWA 5B4PA 3E2JA 2P1QB 1K5DC 5A5CA 4CC4A 3BZ5A 3ULAA 1ZIWA 3RFJA 3RFSA 4R6FA 4U09A 1U0ND 4GT6A 3G3BA 3UL7A 2WQVA 1Z7XW 2O6QA 1H6TA 2BEXA
chains in the Genus database with same CATH topology
2RR6A 3O6NA 3E3ZA 3UL8A 4LXSA 4J0MA 4LI2A 3ZYNA 4PERA 1FO1A 4R5CA 5GMGA 1JL5A 1QYYA 4XSQA 1K5GC 4C2AB 1OTMA 4Z64C 1M10B 3OGKB 4XOSA 4ARNA 3WPGA 3WPDA 4J4LA 4R0AA 5FTTB 3OJAA 4CP6A 1D0BA 4H09A 1OTNA 3WPFA 4C2BB 2P1PB 2UZXA 3A79B 2ASTB 4AW4A 1M0ZA 3OJAB 4CILA 5GS2B 4QXEA 3WN4A 3G3AA 5AWDA 1WWLA 2OMYA 4BSRA 5GS0A 2OMXA 3WPBA 4UFRA 4CNMA 4U7LA 5B0TA 1PGVA 2Z63A 4WP6A 4LSXC 3W3KA 1P8TA 3G04C 2O6RA 4R5DA 3G06A 1LTXA 5LFNA 4FCGA 2Z64A 4K17A 3M19A 2Z65A 3WPHA 3G39A 2P1NB 1W8AA 3CIGA 4ARRA 4L3FA 2ID5A 4KNGA 3RGXA 4BV4R 1OTOA 4LI1A 1IO0A 1OZNA 2RA8A 1A9NA 4NKHA 4CNCA 3ULUA 4RCAB 2JE1A 4MQWX 2V70A 2IFGA 2Z81A 3RW6A 4RWTC 4G8AA 2P1MB 5IJCA 3SB4A 4M7EC 4Z79A 4R09A 2R9UA 1KOHA 2Z7XA 3PMHG 2JE0A 1OGQA 3VQ1A 1M9SA 4I6JB 4V2CA 4Q3GA 2WQXA 2Z7XB 4WYKA 1O6TA 3REZA 4U08A 3WPEA 2XOTA 2OMTA 3RW7A 4BSUA 4FMZA 4XGOA 3W3GA 1A4YA 1FS2A 1XKUA 3RJ0A 5AWAA 4GLPA 4NKGA 3E4GA 2O6SA 1XCDA 2V9TB 3FXIA 4FD0A 4FDWA 4V2DA 3ULVA 3W3JA 5HDHA 4HQ1A 1FT8A 2WFHA 1KOOA 4QC0A 3CVRA 4QBZA 2WQUA 4R6GA 1O6SA 2OMVA 4Q3IA 5IYXC 1GWBA 4FS7A 1DS9A 2Y5QA 4LSXA 2OMUA 1OOKG 4R07A 1SQ0B 2JQDA 3W3NA 4Z8GA 4P91A 1O6VA 2Z66A 5GMFA 4PSJA 2ASSB 1XECA 3TSRE 5GMHA 4MN8B 4Q62A 4PQ8A 3KJ4A 2OMZA 2Z62A 4CC4C 4LSAA 5IJDA 3RIZA 2A0ZA 1DCEA 2ELLA 4PEQB 1M9LA 5IJBA 4BSSA 4M7EA 4EZGA 1P9AG 5CMPA 4FHOA 3GOZA 3ZYJA 4TZHA 4ECNA 1YRGA 3CIYA 1P8VA 2BNHA 2P1OB 5AZ5A 5CMNA 4Z94G 3DZEA 4YEBB 3VQ2A 2XWTC 3O53A 2WQWA 2Z82A 4Y61B 4OQTA 5AWCA 4KT1A 3C6NB 3UN9A 4U06A 4PKIG 5AWBA 1FQVA 4B8CD 3C6OB 5B0NA 3ZYIA 1XEUA 3OGLB 3W3MA 4ECOA 3W3LA 3UL9A 4R6JA 4L3AA 3ZYOA 4RCWA 3JB9j 2CA6A 4LXRA 1H6UA 1G9UA 3P72A 3RGZA 3C6PB 3RFEA 5GQRK 3M18A 1XWDC 4IM6A 4P8SA 4Z61C 3E6JA 2Q4GW 4V2EA 3WPIA 4R6AA 2V9SA 5HZLB 1DFJI 2UZYA 4R08A 4LSCA 2FT3A 4R58A 4AY9X 3WPCA 4KXFB 5D3IA 3OGMB 2OMWA 5B4PA 3E2JA 2P1QB 1K5DC 5A5CA 4CC4A 3BZ5A 3ULAA 1ZIWA 3RFJA 3RFSA 4R6FA 4U09A 1U0ND 4GT6A 3G3BA 3UL7A 2WQVA 1Z7XW 2O6QA 1H6TA 2BEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR6 A;  3O6N A;  3E3Z A;  3UL8 A;  4LXS A;  4J0M A;  4LI2 A;  3ZYN A;  4PER A;  1FO1 A;  4R5C A;  5GMG A;  1JL5 A;  1QYY A;  4XSQ A;  1K5G C;  4C2A B;  1OTM A;  4Z64 C;  1M10 B;  3OGK B;  4XOS A;  4ARN A;  3WPG A;  3WPD A;  4J4L A;  4R0A A;  5FTT B;  3OJA A;  4CP6 A;  1D0B A;  4H09 A;  1OTN A;  3WPF A;  4C2B B;  2P1P B;  2UZX A;  3A79 B;  2AST B;  4AW4 A;  1M0Z A;  3OJA B;  4CIL A;  5GS2 B;  4QXE A;  3WN4 A;  3G3A A;  5AWD A;  1WWL A;  2OMY A;  4BSR A;  5GS0 A;  2OMX A;  3WPB A;  4UFR A;  4CNM A;  4U7L A;  5B0T A;  1PGV A;  2Z63 A;  4WP6 A;  4LSX C;  3W3K A;  1P8T A;  3G04 C;  2O6R A;  4R5D A;  3G06 A;  1LTX A;  5LFN A;  4FCG A;  2Z64 A;  4K17 A;  3M19 A;  2Z65 A;  3WPH A;  3G39 A;  2P1N B;  1W8A A;  3CIG A;  4ARR A;  4L3F A;  2ID5 A;  4KNG A;  3RGX A;  4BV4 R;  1OTO A;  4LI1 A;  1IO0 A;  1OZN A;  2RA8 A;  1A9N A;  4NKH A;  4CNC A;  3ULU A;  4RCA B;  2JE1 A;  4MQW X;  2V70 A;  2IFG A;  2Z81 A;  3RW6 A;  4RWT C;  4G8A A;  2P1M B;  5IJC A;  3SB4 A;  4M7E C;  4Z79 A;  4R09 A;  2R9U A;  1KOH A;  2Z7X A;  3PMH G;  2JE0 A;  1OGQ A;  3VQ1 A;  1M9S A;  4I6J B;  4V2C A;  4Q3G A;  2WQX A;  2Z7X B;  4WYK A;  1O6T A;  3REZ A;  4U08 A;  3WPE A;  2XOT A;  2OMT A;  3RW7 A;  4BSU A;  4FMZ A;  4XGO A;  3W3G A;  1A4Y A;  1FS2 A;  1XKU A;  3RJ0 A;  5AWA A;  4GLP A;  4NKG A;  3E4G A;  2O6S A;  1XCD A;  2V9T B;  3FXI A;  4FD0 A;  4FDW A;  4V2D A;  3ULV A;  3W3J A;  5HDH A;  4HQ1 A;  1FT8 A;  2WFH A;  1KOO A;  4QC0 A;  3CVR A;  4QBZ A;  2WQU A;  4R6G A;  1O6S A;  2OMV A;  4Q3I A;  5IYX C;  1GWB A;  4FS7 A;  1DS9 A;  2Y5Q A;  4LSX A;  2OMU A;  1OOK G;  4R07 A;  1SQ0 B;  2JQD A;  3W3N A;  4Z8G A;  4P91 A;  1O6V A;  2Z66 A;  5GMF A;  4PSJ A;  2ASS B;  1XEC A;  3TSR E;  5GMH A;  4MN8 B;  4Q62 A;  4PQ8 A;  3KJ4 A;  2OMZ A;  2Z62 A;  4CC4 C;  4LSA A;  5IJD A;  3RIZ A;  2A0Z A;  1DCE A;  2ELL A;  4PEQ B;  1M9L A;  5IJB A;  4BSS A;  4M7E A;  4EZG A;  1P9A G;  5CMP A;  4FHO A;  3GOZ A;  3ZYJ A;  4TZH A;  4ECN A;  1YRG A;  3CIY A;  1P8V A;  2BNH A;  2P1O B;  5AZ5 A;  5CMN A;  4Z94 G;  3DZE A;  4YEB B;  3VQ2 A;  2XWT C;  3O53 A;  2WQW A;  2Z82 A;  4Y61 B;  4OQT A;  5AWC A;  4KT1 A;  3C6N B;  3UN9 A;  4U06 A;  4PKI G;  5AWB A;  1FQV A;  4B8C D;  3C6O B;  5B0N A;  3ZYI A;  1XEU A;  3OGL B;  3W3M A;  4ECO A;  3W3L A;  3UL9 A;  4R6J A;  4L3A A;  3ZYO A;  4RCW A;  3JB9 j;  2CA6 A;  4LXR A;  1H6U A;  1G9U A;  3P72 A;  3RGZ A;  3C6P B;  3RFE A;  5GQR K;  3M18 A;  1XWD C;  4IM6 A;  4P8S A;  4Z61 C;  3E6J A;  2Q4G W;  4V2E A;  3WPI A;  4R6A A;  2V9S A;  5HZL B;  1DFJ I;  2UZY A;  4R08 A;  4LSC A;  2FT3 A;  4R58 A;  4AY9 X;  3WPC A;  4KXF B;  5D3I A;  3OGM B;  2OMW A;  5B4P A;  3E2J A;  2P1Q B;  1K5D C;  5A5C A;  4CC4 A;  3BZ5 A;  3ULA A;  1ZIW A;  3RFJ A;  3RFS A;  4R6F A;  4U09 A;  1U0N D;  4GT6 A;  3G3B A;  3UL7 A;  2WQV A;  1Z7X W;  2O6Q A;  1H6T A;  2BEX A; 
#chains in the Genus database with same CATH topology
 2RR6 A;  3O6N A;  3E3Z A;  3UL8 A;  4LXS A;  4J0M A;  4LI2 A;  3ZYN A;  4PER A;  1FO1 A;  4R5C A;  5GMG A;  1JL5 A;  1QYY A;  4XSQ A;  1K5G C;  4C2A B;  1OTM A;  4Z64 C;  1M10 B;  3OGK B;  4XOS A;  4ARN A;  3WPG A;  3WPD A;  4J4L A;  4R0A A;  5FTT B;  3OJA A;  4CP6 A;  1D0B A;  4H09 A;  1OTN A;  3WPF A;  4C2B B;  2P1P B;  2UZX A;  3A79 B;  2AST B;  4AW4 A;  1M0Z A;  3OJA B;  4CIL A;  5GS2 B;  4QXE A;  3WN4 A;  3G3A A;  5AWD A;  1WWL A;  2OMY A;  4BSR A;  5GS0 A;  2OMX A;  3WPB A;  4UFR A;  4CNM A;  4U7L A;  5B0T A;  1PGV A;  2Z63 A;  4WP6 A;  4LSX C;  3W3K A;  1P8T A;  3G04 C;  2O6R A;  4R5D A;  3G06 A;  1LTX A;  5LFN A;  4FCG A;  2Z64 A;  4K17 A;  3M19 A;  2Z65 A;  3WPH A;  3G39 A;  2P1N B;  1W8A A;  3CIG A;  4ARR A;  4L3F A;  2ID5 A;  4KNG A;  3RGX A;  4BV4 R;  1OTO A;  4LI1 A;  1IO0 A;  1OZN A;  2RA8 A;  1A9N A;  4NKH A;  4CNC A;  3ULU A;  4RCA B;  2JE1 A;  4MQW X;  2V70 A;  2IFG A;  2Z81 A;  3RW6 A;  4RWT C;  4G8A A;  2P1M B;  5IJC A;  3SB4 A;  4M7E C;  4Z79 A;  4R09 A;  2R9U A;  1KOH A;  2Z7X A;  3PMH G;  2JE0 A;  1OGQ A;  3VQ1 A;  1M9S A;  4I6J B;  4V2C A;  4Q3G A;  2WQX A;  2Z7X B;  4WYK A;  1O6T A;  3REZ A;  4U08 A;  3WPE A;  2XOT A;  2OMT A;  3RW7 A;  4NZR M;  4BSU A;  4FMZ A;  4XGO A;  3W3G A;  1A4Y A;  1FS2 A;  1XKU A;  3RJ0 A;  5AWA A;  4GLP A;  4NKG A;  3E4G A;  2O6S A;  1XCD A;  2V9T B;  3FXI A;  4FD0 A;  4FDW A;  4V2D A;  3ULV A;  3W3J A;  5HDH A;  4HQ1 A;  1FT8 A;  2WFH A;  1KOO A;  4QC0 A;  3CVR A;  4QBZ A;  2WQU A;  4R6G A;  1O6S A;  2OMV A;  4Q3I A;  5IYX C;  1GWB A;  4FS7 A;  1DS9 A;  2Y5Q A;  4LSX A;  2OMU A;  1OOK G;  4R07 A;  1SQ0 B;  2JQD A;  3W3N A;  4Z8G A;  4P91 A;  1O6V A;  2Z66 A;  5GMF A;  4PSJ A;  2ASS B;  1XEC A;  3TSR E;  5GMH A;  4MN8 B;  4Q62 A;  4PQ8 A;  3KJ4 A;  2OMZ A;  2Z62 A;  4CC4 C;  4LSA A;  5IJD A;  3RIZ A;  2A0Z A;  1DCE A;  2ELL A;  4PEQ B;  1M9L A;  5IJB A;  4BSS A;  4M7E A;  4EZG A;  1P9A G;  5CMP A;  4FHO A;  3GOZ A;  3ZYJ A;  4TZH A;  4ECN A;  1YRG A;  3CIY A;  1P8V A;  2BNH A;  2P1O B;  5AZ5 A;  5CMN A;  4Z94 G;  3DZE A;  4YEB B;  3VQ2 A;  2XWT C;  3O53 A;  2WQW A;  2Z82 A;  4Y61 B;  4OQT A;  5AWC A;  4KT1 A;  3C6N B;  3UN9 A;  4U06 A;  4PKI G;  5AWB A;  1FQV A;  4B8C D;  3C6O B;  5B0N A;  4NZT M;  3ZYI A;  1XEU A;  3OGL B;  3W3M A;  4ECO A;  3W3L A;  3UL9 A;  4R6J A;  4L3A A;  3ZYO A;  4RCW A;  3JB9 j;  2CA6 A;  4LXR A;  1H6U A;  1G9U A;  3P72 A;  3RGZ A;  3C6P B;  3RFE A;  5GQR K;  3M18 A;  1XWD C;  4IM6 A;  4P8S A;  4Z61 C;  3E6J A;  2Q4G W;  4V2E A;  3WPI A;  4R6A A;  2V9S A;  5HZL B;  1DFJ I;  2UZY A;  4R08 A;  4LSC A;  2FT3 A;  4R58 A;  4AY9 X;  3WPC A;  4KXF B;  5D3I A;  3OGM B;  2OMW A;  5B4P A;  3E2J A;  2P1Q B;  1K5D C;  5A5C A;  4CC4 A;  3BZ5 A;  3ULA A;  1ZIW A;  3RFJ A;  3RFS A;  4R6F A;  4U09 A;  1U0N D;  4GT6 A;  3G3B A;  3UL7 A;  2WQV A;  1Z7X W;  2O6Q A;  1H6T A;  2BEX A; 
#chains in the Genus database with same CATH homology
 2RR6 A;  3O6N A;  3E3Z A;  3UL8 A;  4LXS A;  4J0M A;  4LI2 A;  3ZYN A;  4PER A;  1FO1 A;  4R5C A;  5GMG A;  1JL5 A;  1QYY A;  4XSQ A;  1K5G C;  4C2A B;  1OTM A;  4Z64 C;  1M10 B;  3OGK B;  4XOS A;  4ARN A;  3WPG A;  3WPD A;  4J4L A;  4R0A A;  5FTT B;  3OJA A;  4CP6 A;  1D0B A;  4H09 A;  1OTN A;  3WPF A;  4C2B B;  2P1P B;  2UZX A;  3A79 B;  2AST B;  4AW4 A;  1M0Z A;  3OJA B;  4CIL A;  5GS2 B;  4QXE A;  3WN4 A;  3G3A A;  5AWD A;  1WWL A;  2OMY A;  4BSR A;  5GS0 A;  2OMX A;  3WPB A;  4UFR A;  4CNM A;  4U7L A;  5B0T A;  1PGV A;  2Z63 A;  4WP6 A;  4LSX C;  3W3K A;  1P8T A;  3G04 C;  2O6R A;  4R5D A;  3G06 A;  1LTX A;  5LFN A;  4FCG A;  2Z64 A;  4K17 A;  3M19 A;  2Z65 A;  3WPH A;  3G39 A;  2P1N B;  1W8A A;  3CIG A;  4ARR A;  4L3F A;  2ID5 A;  4KNG A;  3RGX A;  4BV4 R;  1OTO A;  4LI1 A;  1IO0 A;  1OZN A;  2RA8 A;  1A9N A;  4NKH A;  4CNC A;  3ULU A;  4RCA B;  2JE1 A;  4MQW X;  2V70 A;  2IFG A;  2Z81 A;  3RW6 A;  4RWT C;  4G8A A;  2P1M B;  5IJC A;  3SB4 A;  4M7E C;  4Z79 A;  4R09 A;  2R9U A;  1KOH A;  2Z7X A;  3PMH G;  2JE0 A;  1OGQ A;  3VQ1 A;  1M9S A;  4I6J B;  4V2C A;  4Q3G A;  2WQX A;  2Z7X B;  4WYK A;  1O6T A;  3REZ A;  4U08 A;  3WPE A;  2XOT A;  2OMT A;  3RW7 A;  4BSU A;  4FMZ A;  4XGO A;  3W3G A;  1A4Y A;  1FS2 A;  1XKU A;  3RJ0 A;  5AWA A;  4GLP A;  4NKG A;  3E4G A;  2O6S A;  1XCD A;  2V9T B;  3FXI A;  4FD0 A;  4FDW A;  4V2D A;  3ULV A;  3W3J A;  5HDH A;  4HQ1 A;  1FT8 A;  2WFH A;  1KOO A;  4QC0 A;  3CVR A;  4QBZ A;  2WQU A;  4R6G A;  1O6S A;  2OMV A;  4Q3I A;  5IYX C;  1GWB A;  4FS7 A;  1DS9 A;  2Y5Q A;  4LSX A;  2OMU A;  1OOK G;  4R07 A;  1SQ0 B;  2JQD A;  3W3N A;  4Z8G A;  4P91 A;  1O6V A;  2Z66 A;  5GMF A;  4PSJ A;  2ASS B;  1XEC A;  3TSR E;  5GMH A;  4MN8 B;  4Q62 A;  4PQ8 A;  3KJ4 A;  2OMZ A;  2Z62 A;  4CC4 C;  4LSA A;  5IJD A;  3RIZ A;  2A0Z A;  1DCE A;  2ELL A;  4PEQ B;  1M9L A;  5IJB A;  4BSS A;  4M7E A;  4EZG A;  1P9A G;  5CMP A;  4FHO A;  3GOZ A;  3ZYJ A;  4TZH A;  4ECN A;  1YRG A;  3CIY A;  1P8V A;  2BNH A;  2P1O B;  5AZ5 A;  5CMN A;  4Z94 G;  3DZE A;  4YEB B;  3VQ2 A;  2XWT C;  3O53 A;  2WQW A;  2Z82 A;  4Y61 B;  4OQT A;  5AWC A;  4KT1 A;  3C6N B;  3UN9 A;  4U06 A;  4PKI G;  5AWB A;  1FQV A;  4B8C D;  3C6O B;  5B0N A;  3ZYI A;  1XEU A;  3OGL B;  3W3M A;  4ECO A;  3W3L A;  3UL9 A;  4R6J A;  4L3A A;  3ZYO A;  4RCW A;  3JB9 j;  2CA6 A;  4LXR A;  1H6U A;  1G9U A;  3P72 A;  3RGZ A;  3C6P B;  3RFE A;  5GQR K;  3M18 A;  1XWD C;  4IM6 A;  4P8S A;  4Z61 C;  3E6J A;  2Q4G W;  4V2E A;  3WPI A;  4R6A A;  2V9S A;  5HZL B;  1DFJ I;  2UZY A;  4R08 A;  4LSC A;  2FT3 A;  4R58 A;  4AY9 X;  3WPC A;  4KXF B;  5D3I A;  3OGM B;  2OMW A;  5B4P A;  3E2J A;  2P1Q B;  1K5D C;  5A5C A;  4CC4 A;  3BZ5 A;  3ULA A;  1ZIW A;  3RFJ A;  3RFS A;  4R6F A;  4U09 A;  1U0N D;  4GT6 A;  3G3B A;  3UL7 A;  2WQV A;  1Z7X W;  2O6Q A;  1H6T A;  2BEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...