4CC4A

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
265
structure length
262
Chain Sequence
ASESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSALSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INLC PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
total genus 80
structure length 262
sequence length 265
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc4A02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4cc4A01
4L3AA 1SQ0B 1K5GC 2Y5QA 1YRGA 4AW4A 5CMPA 4OQTA 1FT8A 4V2EA 4J0MA 1XEUA 3WPCA 4R58A 3C6PB 3ZYNA 1M42A 3VQ2A 1OT4A 4V2DA 3UL8A 1DFJI 1O6VA 2BNHA 1D0BA 3RW7A 4Z94G 4BSUA 4CNCA 3RJ0A 4PERA 1OGQA 4Q62A 4P8SA 2Z81A 3WPEA 1U0ND 3O6NA 2WFHA 4QXEA 4BV4R 4LI1A 3G3BA 3W3NA 5IJDA 3C6OB 1OTNA 4FD0A 1JL5A 4XOSA 5AZ5A 5B0NA 2O6QA 4CNMA 3DZEA 1XCDA 3OJAB 3G39A 4R6JA 4XGOA 1OTOA 4U06A 5FTTB 1M9SA 4PEQB 1LYQA 4Z79A 5B0TA 4PSJA 3BZ5A 3VQ1A 3FAXA 2P1QB 4NKHA 2RA1A 4ARRA 3O53A 5HDHA 2OMZA 1G9UA 4BSSA 4R09A 1OZNA 3E4GA 1KOOA 2OMWA 5GS0A 2P1OB 5D3IA 1ZIWA 1WWLA 3KJ4A 1KOHA 2Z66A 4Z8GA 3FAWA 2RA8A 4KXFB 4M7EA 3ZYOA 5GS2B 2ELLA 4Q3GA 2WQUA 3JB9j 5AWCA 3FXIA 4R0AA 4Z61C 5AWAA 3OGKB 2V70A 2O6RA 1FS2A 3CVRA 3G3AA 4R5CA 3W3KA 1XWDC 1H6UA 1M10B 3W3GA 4NKGA 2RR6A 3UL7A 4R5DA 4TZHA 4YEBB 2XOTA 1OOKG 3M18A 4FDWA 3GOZA 5IYXC 2Z65A 4P91A 4LI2A 3OGMB 4LSCA 1A9NA 3TSRE 3WPGA 4QC0A 1P8VA 1IO0A 2XWTC 4L3FA 3P72A 1P8TA 4CP6A 1H6TA 2ASSB 4CC4A 3REZA 3ULUA 1IX2A 3ZYIA 2Z7XA 4MQWX 4GT6A 3ULVA 4LSXA 3RW6A 1FQVA 2P1MB 1M0ZA 2C9RA 5IJBA 4H09A 2P1PB 4XSQA 2JE0A 3CIGA 1XKUA 4BSRA 1LTXA 2R9UA 3CIYA 2YA1A 4LXRA 2Z82A 3WPIA 4UFRA 4J4LA 2Q4GW 4G8AA 2O6SA 4I6JB 4FCGA 2ASTB 3ULAA 2UZXA 3WPFA 3E6JA 4RCWA 4Y61B 1M9LA 3BC9A 4KNGA 2Z62A 5CMNA 2OMVA 3A79B 1DCEA 1NM4A 4U09A 2JE1A 1Z7XW 4MN8B 4KT1A 4RWTC 1K5DC 1FO1A 2BEXA 3WPDA 4RCAB 4C2BB 4V2CA 4FS7A 1A4YA 3RFEA 2V9SA 2FT3A 4QBZA 3UN9A 5B4PA 2Z63A 1W8AA 3E3ZA 4EZGA 4AQ1A 3RIZA 5GMHA 2C9PA 3WPBA 4R07A 2OMUA 3PMHG 4PQ8A 2UZYA 3W3LA 4PKIG 4R08A 4M7EC 3M19A 2C9QA 5A5CA 4R6GA 3G06A 4B8CD 2Z7XB 1DS9A 1O6TA 4WP6A 4Q3IA 2WQVA 2OMXA 1GWBA 4ARNA 3RGZA 3RGXA 4C2AB 2A0ZA 3G04C 4WYKA 5GMGA 3C6NB 2ID5A 3RFJA 3W3JA 4HQ1A 3WPHA 4AY9X 2V9TB 4U7LA 3ZYJA 4R6AA 2OMYA 5GMFA 2OMTA 3OGLB 3SB4A 4ECNA 5IJCA 1PGVA 3BCFA 4FMZA 4LXSA 1P9AG 2WQXA 1O6SA 4IM6A 2Z64A 3OJAA 3E2JA 1OTMA 5AWDA 4CC4C 4GLPA 5ICUA 2WQWA 3RFSA 1QYYA 4R6FA 4K17A 4LSAA 4LSXC 4U08A 2JQDA 2IFGA 3BCDA 3UL9A 4CILA 2CA6A 4ECOA 3WN4A 3W3MA 4FHOA 5AWBA 5HZLB 2P1NB 5GQRK 4Z64C 5LFNA 1XECA
chains in the Genus database with same CATH superfamily
4L3AA 1JTTA 5D9SA 2W1NA 5DUPH 5CD5D 2HFEA 3A0OA 1YNKL 1FZOB 2DL2A 3TTYA 1MH5B 2RQ8A 4OLXL 1UHVA 3T9WA 4FTVD 4L18A 1J9SA 2XBZA 5B7FA 4NNPL 4PJ9C 2MMXA 1QFWM 2BVOA 1QACA 3C60C 1DEEA 1I3GH 5JLZB 4M43H 2D7OA 4FMKA 4YEEA 4E41B 4BUGA 1PS3A 4LRIC 3LKRA 5DDHA 4FNTA 1G7QA 1NEZB 1QRNB 2UZIL 1NCIA 2VLRB 4PBVC 1U8OB 3C5ZA 5I28A 1RZPA 3AC0A 1NWOA 4KDTA 2YSSB 2CK0H 2X05A 2CM5A 4FG6D 1BFTA 1R3LA 3FOMA 4LSPH 4GQ9L 4F8PA 1DFJI 5KVGH 1A9VA 3KR3H 2CO2A 3FU8A 5HSFA 3VGDA 1NGQH 2JXMB 1IE4A 2G5BA 3JWOH 5AG9A 3ARFB 4ZO9A 1Z3GL 2G9HA 1DYZA 2FJSA 5T5FA 5IFAL 2XG5B 5FA3B 5I5MA 3QUMH 1HYRC 1YQVH 3KLLA 1MQKL 3DX9B 4JM4H 2J25A 3MNDA 4Z7WF 1P7QD 2FEJA 2W65B 2QQKH 2FRGP 4XXCA 3ZIMA 3F04A 3L95A 3CVDA 4AT6A 1PCXA 3DVGA 3AY4C 1G6RA 3SKOA 4NYLA 4QGTA 2AERT 3TBWB 1J88A 2P5EE 2XTJD 1HDMA 4O51B 3MRDA 2DI9A 5EF1A 4QRBA 2D9QB 2CXGA 4HMEA 5CKGA 1FG2A 1DUZA 5B7EA 5I71B 1ZKAA 2EEBA 3GJFB 2AI0L 3RL1B 3TLRA 4XOSA 1MLBB 2VM4A 5DHVB 5GRVL 2F7IA 5AZ5A 1X5ZA 1OGPA 4HIIA 1OW0C 4N2EA 3V9CA 2I32A 3MGTA 3L13A 5T3XH 5ANMB 4K7FB 4NKOA 3VXRA 1BVOA 4GSQA 5KSAC 3FYIB 4HD9A 1JYVA 1GGCH 4CBPA 3WOVA 4MYPA 4QRSA 3ARBB 5F3BA 3EBAA 3EJZD 3HUJE 1KDJA 1P1VA 1BZ9A 3JZ7A 4ZS7H 4U06A 1GZHA 3S36L 3V79C 1LYQA 2AMGA 4NKDB 4XXWC 1R5IB 3K2KA 2V8LA 2CHNA 1UQSB 2R0KL 2H6PB 4PAZA 5AB2A 3FAXA 3D52A 4U3CA 3O53A 3S98A 1AHMA 1K5WA 4B0MM 3TIEB 4TVUA 4N9GA 4BE5A 3QFJD 4M7ZB 3U1SH 3E2HB 4DGVH 1KOOA 4XN1A 2OMWA 1IAOB 3BSHA 4UINH 5F6IC 4P9ML 3WLBB 5KVEL 3TXAA 2BLFA 3VFGL 4AGOA 4EI6B 4BH7A 4I3SL 1OAQL 4KI5D 4H0LC 1W0WA 3PP4H 2ARJQ 3FAWA 3KPOA 2NY5L 4PG9A 3REWA 3RGVA 1UADC 1L7IL 4EUPH 5FR3A 1XL6A 1K9TA 4NQDE 3VFPB 5CEYA 4L8SA 4XVTH 4BK5A 1NLDL 1NUNB 3L54A 4M7KL 4Y2NA 2VN6A 1NGPH 2IXQA 2OKMA 4LHUD 1HI6A 3LIZH 5E08H 2BNQE 2VUYA 5GJSH 3RTQA 3CLFH 3VFWA 3MRPB 1YLBB 1YEIH 1D5XA 3DURA 1AJ7L 3UAFA 2YD0A 1I9RH 2OTWA 5SWSE 2CDFB 4DZ8A 2BY0A 3CH1B 3IJSA 4PRPD 5F7LB 4YHNA 1FBIL 1CZ8H 4IJ3C 5DS1A 3D9AH 3QUXB 3F7VA 1N68A 2PO6A 1BF5A 3QARA 1OPGH 1U93A 5CHNA 4Y88A 5T3ZD 1CN4A 4FQJL 3EOBA 5I2IA 1BQLL 2ICCA 4X42A 1F86A 1S2EA 3CLEL 2F74B 2HA1A 2X4OA 2XFXA 4ISVA 1HAWA 4QRUA 3FZUD 5C09D 3GJFK 3I74A 3RVXD 4QHNA 4LKCB 3O0RL 3RY6C 3HNTL 3PUCA 2GITA 5IVXF 4UV7L 2VDNB 1RIHL 4Z3EA 4HEME 2XWEA 4XBGA 3TPUA 3VWJD 3BAXA 5EU3A 2WXKA 5I1GH 1GW6A 4TULL 3GBNL 4NJ9L 2F18A 3UPRA 3L3OA 4WSGA 1NBYA 2X40A 4JW3A 3O2DH 5AYTA 4R0LC 4M1DH 1MNUL 4YQXL 5B1CA 5IQOA 4NZRH 2VLJA 3EYOA 1WBZA 4KOCA 43CAA 3MRHB 4LSCA 1V5JA 3BGFB 1A7BA 2EYSA 2Y2YA 3KGSA 4JANA 4C4KT 4DZBB 4POYA 5KVFL 5ECJE 1J87A 4L5FL 2NY3C 2CGRL 1GGBL 4K9EC 3ZOAA 4KZEH 4PJBF 5FO9A 2JKSA 4ICWA 2B0SL 2D31B 2DLTA 2FD6H 4ETQA 3P72A 3KM1A 1JPEA 5FHAH 1I7ZA 2P7TB 1OE3A 4KHXH 1R5VA 5H37H 4JN1H 1KSRA 1MDTA 4QCIA 1IBGL 4X9FA 1UD2A 4AWJC 4PBXA 4EJ1C 4JG0L 2AXGA 1ZV5A 4OJCA 3SCMD 3UEQA 1QVOA 2D8KA 5DI8B 1NAKL 1NIBA 1WGVA 3IB4A 4U6YA 4L2LA 1WH0A 4WGVB 3U4BL 5IROA 2VXSH 4UIMB 1AHKA 1SXNA 3H0TB 4P4RA 4K94C 2VL5A 4LEBA 5I15L 4I3RH 4KNQA 1Z9PA 4G8FB 4N24A 5H35B 1XGZA 4KO9A 3IDJA 1NGXA 4KDVA 1RHHB 2NXYB 5ICZA 4H09A 3PV6A 2EE6A 4PVNA 4DPBX 4FXTA 2GFBA 1NMAH 1WT5C 4L1DA 1KV7A 1J9CT 3HLAB 4K7PX 4XNXL 1IFHL 2OI9C 3GIVB 1Z6JT 4JPWL 4MASA 3ZT6A 3VXNA 1T03H 4CVXB 1MCFA 1KJ2A 2QR0A 2XPZA 1PDKB 4H40A 2Y06L 4I9WD 3LQAC 3RB5A 4FXKA 1M3JA 1XAUA 5JZ7C 5E9DD 3QJOA 1RK1B 2AJZB 3ZDYB 4IIZA 2EDFA 1A1NA 5DD0H 2R2BB 3RWGB 4W6YB 2NX5E 3KJ6H 2Q4GW 2DQTH 2GJ6A 1SBSL 3GNMH 2LU3A 3LKSA 1KLFA 4JB9H 12E8L 2BVEA 3I6GB 1K4DB 3GS4A 4MAZA 2BY3A 2AXWA 3HMWH 4D7BA 3SYPA 1BQSA 2W94A 3GT6A 4LCWA 3BT0A 3HHSB 3FO0L 4JDVA 1KIQA 2CCLA 3JTBA 2WIIA 4KUZH 5A16A 4MA7H 2JK5B 4QHMB 5AVXB 3DUUB 2WCSA 3GSXB 3N9GL 1I3RA 1RIVL 3SY6A 1EHLL 4IHOA 2WUBH 4G6FD 4AENB 3BZEA 4HUVB 5I30H 2X4TA 3RZCD 2Z35A 3NUKA 4CVZB 5ABDE 2E9GA 2X9WA 2XV3A 2DPKA 1GJIA 3NN8A 3U46A 1GKOA 4XNAA 1RPKA 5GGVY 3ZO0A 3ARGD 4DQAA 5I1JL 1HJBC 4CAGA 1NFIA 2EXSA 5C07B 4XC1L 2D0FA 2OL3H 2C3VB 3QUHA 2FEDC 3RLSA 5HYJB 2ZKHL 4YDIL 5E6IA 4DP0X 3MOAH 1MUJA 5TPWL 5B4PA 3V5DA 3RWJA 2XKNB 1CICD 1N7MH 4P07A 3FCGA 4WWKC 4BA0A 4LCYB 3TFKC 4EKJA 2I60H 4FQHB 1KJMB 5JDJA 5MEOA 3ETBJ 1L0QA 2D7NA 2QQNL 2EH7L 1TCRA 4NX0A 5D4HA 4OI7A 2FB4L 4PY8I 1JHLH 3QQXA 5CN2A 5BOPA 2Q8AH 1FZOA 1NOFA 4C8XA 1J8KA 1MH5A 3NK4A 5I1EL 4DGIH 5KYXB 1INEH 2A77L 2DQ6A 2ZKMX 3KWTA 4F92B 3AXLB 1OY3B 4HMCA 2JJSC 3LPWA 3KYKH 3JVGA 4S11A 1TETH 5JLZA 5DD5H 4GO9A 4JAMB 4ZMQA 2ZZUT 3ABMB 4NO2B 4ODHL 4R26H 4E41A 1KULA 2WJ5A 2WWMC 3ZE0E 4PHXA 2YD8A 4F5CA 1XGYL 4LSTH 1QRNA 2VLRA 3IKKA 4X9YA 3FN9A 1PFOA 2X4RB 3OC8A 1R17A 3BJLA 3MOBL 3NP3A 3O6KH 1LO5B 3TWCH 4OZGF 3VYPA 4HOWA 1JYXA 1N3NB 2YSSA 4FYTA 3RP1A 3GK8L 2VDNL 2EIBA 4HS6B 4X7FC 1IO4C 1SBBA 4F7PB 4NC1E 43C9B 1C8PA 3F62A 2JXMA 4A7TA 3HNSH 5JOPD 1K8IA 4WYKA 3ARFA 3MXVL 1JCKA 5E1AB 5JPNB 2XG5A 5FA3A 3IPFA 1IAKB 4YE4H 3DX9A 2ZOLB 4LNVA 2QKIB 2VR7A 3P2TA 1QI5A 1YN6B 1XH2A 1NCCH 2WSKA 3T65B 3LH9A 1ACXA 1G7PB 5E95B 2WP3O 2YXWA 2XG4B 5TH2B 4N2NA 3TBWA 1JNJA 4O51A 2OXGB 3QPKA 3QZLA 3FQTB 4YEFA 3RPKA 4MAYD 2EXWD 4QRQB 3OC5A 4Y9BA 6TAAA 2GG1A 4WEBH 1IGML 3RL1A 1MLBA 5DHVA 4MCZA 3PYCA 1OGAD 2WZAA 4G6ML 4KK6C 4M93C 1KXQE 5B8CB 4K7FA 4F7CB 1RZQA 3RUGF 5C86A 2VNCA 3FU0A 5T1DH 3ZSTA 4S0HA 3HG1D 1LK2A 1J5OH 3ARBA 2ED7A 4J3OD 4OF5A 3WN6A 1WWBX 3EDJA 1E67A 4CC4C 4XX1G 1ID5I 1R5IA 2ZYHA 4AK1A 4B3EA 1ZOXA 1YPZE 5CR1A 2H6PA 4Y4HB 3SDDC 3CVIL 3QCVH 2ICEC 4LSXC 3X1NA 2VQ4A 1IAIH 1P2CB 4G5ZL 1BZOA 4PLJC 5BZDB 1BJMA 1RIUL 2ALWA 3EDEA 3QR0A 2E6JA 3ULVD 2YLHA 3IGKA 4PJFE 3VW3L 1UD4A 1IAOA 3WLBA 2WO3B 3SPHA 4EI6A 4YE0A 3O3UN 5EU7C 1I1AC 2XBTA 3OV6A 4U1KB 2UZYB 3NPZB 3UTTE 4Z64C 5CZVH 3UYPB 3DX2A 4JRXD 5I75B 2GJPA 2GPZA 2ZYIA 1Q9LB 3VFPA 2JKXA 3NJKA 4MZIA 4OCWH 3NZUA 4G8AC 3PQYB 3AITA 3BIKB 2XX1A 4TQ8A 3UTSD 1V7ML 4BQCA 1WZ1L 3RIFF 3MRPA 5L2JB 4L4TE 1WTGT 4XP5H 4I7ZC 1SXSA 5C0FB 3C6LD 2CDFA 4N2CA 5D2NE 3CH1A 2E27L 3WN5A 1DVUA 1KELH 3RX5A 4R5TA 1CR9H 1IC7L 1WUZA 5FYLL 4EEEA 1OHZA 2P47B 3DJSA 4YSQA 4XOCA 2YD6A 4B60A 5KYUB 4DGUA 4QOKD 5DMGD 4Y4FB 1JZEA 3KNBB 4JO8A 5IJKA 1IBBA 2DM2A 1G1KA 2Z93B 4YZFE 5HI5D 2F74A 4IRSC 3AACA 3Q6FB 4Y5YC 1DJHA 3P2BA 4QJ4B 4LKCA 4YNYB 4JQVA 2OS7A 4LPXA 4B5ZA 3LKQA 4QR7A 2FT7A 3KS0H 4LCIH 5ADPL 5BVJB 3MV8E 4JGJA 4PCKA 2YC1B 3SGKA 4JY6B 2IPTL 1AXTH 1LO4H 3UG5A 4M5YH 4HV8B 1HU8A 4TSCL 2H2SC 4TL4A 5D2LE 4ODTH 5BO1H 1TQUA 4X6DE 4GSXA 2MEJB 1AQ8A 1GL4B 1I31A 3HAEB 3SOTA 4WQOA 2XVLA 2Y6TE 5DZLA 5EN3A 1EZSA 4K3JL 2OJ1A 1AC0A 4FD0A 4IOSD 3MFFB 5F9WB 4DZBA 1IGIL 2AVGA 2BW5A 2O6FA 1CDIA 5D7IE 4EN3C 1P4UA 1MJJB 1U30A 2D31A 4J6RL 4JREB 5KUKA 4D9QD 2P7TA 1RLBA 3OKMB 1O5DT 3W81A 5FFLA 2O5NA 1QPKA 1NBZB 3MROB 3W9DB 4PWHA 3FFCD 1KDIA 2O5ZL 5FB8B 1CLZL 3NSFA 3U0WH 3VMNA 5DI8A 3HHMA 4PR5B 3VXME 4D0DB 1A14L 3GO1L 1JGEB 4NBXB 5IBUB 3T4AB 4QJ3B 1QEWB 1A4JB 5CJOH 5FTTB 3H3PH 5EFIB 3EBGA 4AX3A 4PEQB 4UIMA 1MRCL 3O6MH 3H0TA 5D7SL 1TMCB 4W70A 3STBA 3WMQA 5FCUL 2V3FA 3KPRD 4G8FA 1UA7A 3S3CB 4R5XA 4HFUL 4PJ7B 3L2NA 4BZ2H 5J13C 4ZXBC 3PGFH 4MA8L 5I6XC 1E9PA 4JKLA 2YRPA 4A2FA 3HLAA 4MCNA 3GIVA 5T33H 4M8QB 3DOHA 4CVXA 2VLMD 3OMZA 2CO7B 3NJHA 3BKJL 2AXJA 1DR9A 3HI6L 5E8DL 4DT2A 1UM5L 3LS5L 1RK1A 2AJZA 4OTXH 3NCYP 1QRKA 2R2BA 2VN7A 3O45B 3RWGA 1B6DA 1K8DA 3PWJB 4NRYB 4I1RA 3WTTA 5AWCA 4OSUH 3EOYG 3SGEH 3I6GA 3PREA 4P5RA 1K4DA 3GGWB 4M5ZL 5F0MB 3DTDA 4TUUA 2Q2EB 3HC0B 3HE6B 3TJEL 5E1GA 3HHSA 1ZS2A 3K6SB 4JFPB 2DQIL 3O6LH 1KFAL 1LNUB 3NZ8B 2MKWA 1FFOB 2WJ7A 3LZRA 4IDLA 1M6UA 1JWSB 2JK5A 4QHMA 1H3TA 3DUUA 1UWEH 3GSXA 4HU8A 5BRZE 3TNMB 3CXFA 5TD4A 3K80A 3ZT5A 4MNQE 4DN4H 2XVKA 3DHJA 3G3LA 1TXKA 4IBUA 2EDTA 4LDOB 3SDAC 4LLUB 4N0FB 3KYMB 1P9MA 1UOWA 4HUVA 3E38A 1L9TA 4CVZA 2HAZA 3QXTA 1G7MB 5MI0C 3L1OH 4NCC1 1E5YA 2G4EA 4KZ0A 5C07A 2C3VA 5HYJA 2HKHL 3HCVB 4XPHL 5ANHA 4GI9A 4HK3J 1QFOA 2VH5L 2DLFL 1LO0L 2XA8L 2JJUA 4FQHA 1KJMA 1JGIA 1J10A 1WS8A 1QSFE 1G9NH 1Y6KR 4U7KA 5LKNA 1RUAH 3GRGA 1JZFA 4G7YL 2WBWB 1EHNA 1IC1A 2VZUA 3SYCA 3UJIL 4KFZC 5EN2B 1RUMH 1IL1A 3QDGE 1IKFH 1MIEL 1P8VA 3P02A 3QJQB 4AE0A 4LSUL 2XTLA 2CNYA 2DYRB 4LSSL 5C08E 4UM8B 5GS1C 3AXLA 4ZX4A 1H3WM 5FUZH 4RFOH 1RULH 2YOCA 3EDDA 5LBSL 4JAMA 4NO2A 4BD4A 1NCWH 2IDUA 1AO7E 3BH9B 3JV0A 2NY2B 2R0WL 5C0RH 4WTQA 3V4PL 2PCFB 4CVWA 2X4RA 4O2FA 1RQ5A 3MUGB 3VQ2C 2EIDA 4JE0A 3OXRB 4ZD3H 1IGCL 1LO5A 5KN5B 3AG4B 4F93B 5JTWA 1N3NA 2EZ0C 4YFEA 4HS6A 2AEIT 4OM1H 1NFKA 4PRHE 1KCRL 5DZJA 3WY3A 2OJZH 3AQDA 3C8DA 43C9A 1H8NA 2G3XA 3VGGA 5L4JA 1D9KA 3B37A 3T2PA 4S10A 4IOFD 4P5TC 2KZBA 3TZVB 1KTLB 5DVKA 5E1AA 5JPNA 4N2MA 5D6DA 1IAKA 4W9CC 4ANXA 1SQMA 1B2YA 2ZOLA 3EGDB 5LXGL 2QKIA 2YMOA 1WSST 3IGUA 3V52L 1YN6A 1S9VB 3GXMA 4NI3A 1HT6A 4Q52A 3T65A 4JS7A 1FVEA 3KHQA 1G7PA 2XG4A 5TH2A 2HVBA 2OXGA 3DK0A 4IRJB 4MNGE 3FQTA 5E56A 4WVRA 1PBYA 1R75A 1PYWB 5DGQA 4QRQA 1CFMA 4LVHC 1SRDA 3S3JA 4H8QA 4WI6A 3RVWD 1YG9A 2DM4A 3T2OA 1QG3A 4KNGA 4Z8FH 2EXYC 4L3CB 1BQUA 3P9LB 3FULA 3ARXA 5B8CA 2FSDA 4K7PH 4FABL 4F7CA 3B2MA 1P6AB 5D1QC 3U7WL 4NQDB 1YUHB 1G0DA 3RX9A 5FO2A 2AJYH 5CUSL 4TVPE 4WW2C 3VXRD 2D7PA 2YGNA 1FSKC 4GNKB 3QDJB 4Y4HA 2JJWA 5EWIH 2Y4SA 2XJLA 3Q13A 2V9SA 1QTYT 5SWSB 4Y5XB 2Y07L 4BFNA 4DO5A 4FJZA 3QR1A 1E27B 1P2CA 4QD2E 3LIZA 3E3ZA 3MREB 5BZDA 4Z7IA 2DQMA 2R4RH 1F1GA 3DX8B 3MLVH 4R07A 1GS8A 4YXKL 5BV7C 1QWUA 1YNLH 1EDQA 4N2HA 2R8SH 3DECA 2R59A 3OJVC 4NN5B 1PZ2A 2OQJB 2UZYA 3C09C 2C34A 4JFDB 3UYPA 3UABA 1AP2B 5L4IA 1A1OA 2WLNA 3EH1A 4PJGE 4XAKD 3LRSB 1BF2A 2YN5A 2R0ZL 1W72H 5JPMA 2I5YH 1MWAH 2W92A 4X4ME 3WI9A 1H19A 1J9RA 3QQDB 2P5PA 5DT1L 3BIKA 4PMEA 2VN5A 4OGYH 2UX6A 3G5YB 4BSVB 5L2JA 3RGVD 3N04A 4A2EA 2Q7NA 1A6WL 3WE6B 4ZX6A 1L7TL 1RKRA 5C0FA 2AQPA 1VIWA 2D7TH 1W91A 1HNYA 3ZE2F 1HH6B 3L4ZA 1T0OA 1T20B 1EXGA 2HRPH 4FFZH 4MCMA 4V33A 1LD9B 4M8RA 2J88H 3RTQD 4CKVX 5LQBH 1RMFH 1X5IA 5KYUA 1RP9A 3H85A 5CLZA 1YEFL 2I7OA 5M95B 3B9KB 4Y4FA 3KNBA 1QBML 1JWMB 3FTWA 2XRAL 4LSVL 1CFBA 4JM2A 2Z93A 4E9TA 2KYIA 3EO9L 3WIIL 1AGFB 4JN2B 3Q6FA 2FEEI 4NUGL 4HHGA 4YNYA 1S4IA 2PO6D 3GM8A 3SE9H 1PKQE 5HYQB 2GUOB 5CU5A 4OIIH 5F9OL 2CGYA 3LMJH 1J5HA 2YC1A 2GJZB 4JY6A 2JCCE 3IJ7A 3BZDA 3DUHA 4J3VA 1QD0A 4HV8A 5LBGA 2NXZC 3ARTA 4XCNB 2EDEA 4M29A 4R83A 2X42A 5TE4H 3OGLB 1P4LB 4TOYH 1DSYA 4WHTB 4NO5A 2JB5L 2P24B 3UADA 3VH8G 5GS0H 3MFFA 3US1A 2BINA 3VD3A 4A2LA 4YUEL 1MJJA 3RWEB 3MRJB 2BP5M 1OP5H 2KI6A 1CLOH 2FEEL 3OB0K 1N4XH 2VLJD 3PWUA 4K8RH 5HD8D 3OKMA 2EVHA 2B5IC 2P43B 2X4SA 1NBZA 3MROA 1TJIH 4HBCL 3W9DA 3OR6B 2Z64A 2Z8VC 1NCTA 4B7LA 5JHMA 5FB8A 3AW5A 2EP6A 4D0DA 4EKXA 3UZQB 1JGEA 1KIRA 1VJSA 3T4AA 2IALB 4YSPA 3RIAK 3ZHKA 2A9DA 1QEWA 5IREA 1A4JA 2H2PD 2HXAA 4CDGC 3D30A 5EFIA 3QYNA 3GB7B 2UYLB 1IAII 1PZ5B 4H8UA 5MP6H 2UWEF 1NFDA 1AOHA 2PP7A 2Y9RT 4JFYB 3H1ZA 5IESL 15C8H 1S7WB 3D4CA 3TEUA 1OCOB 4PJ7A 1NCHA 2CO4A 1E6JL 2XA3A 4FCAA 1KBPA 2R0LL 3QEQE 2PYEE 3IU4H 3EDKA 3LKOA 3IDXL 3B6SB 4AQ8C 3EXLA 5DQJB 4UDUB 1UB5B 3MDJA 2XDHA 4M8QA 4CU8A 2VRQA 3NQKA 3WO3B 3ECWA 1XV8A 1IC0A 2AABL 2CO7A 4PS3A 4P23C 3NJXA 5IGXL 4CW1B 2CJSA 1ND0B 3WKQA 4MB3A 5LAXA 1U8HB 1M6OB 2NY0D 3O45A 3IFOB 1E8YA 1MFBH 3PWJA 4NRYA 4W68A 4WO4C 4M7LL 2HX7A 4HT1L 3NRFA 5J3HC 3QNZA 1UTDA 3GGWA 5GRXG 5KVGE 4WFGD 1MAKA 1SJXA 3JVFC 4N2DA 5ADOH 3BDXA 3HC0A 3HE6A 5GRWA 1FT8A 5FM5M 3TH3T 4UTAL 1I3UA 4JFPA 2GJ6D 5AOKA 3K6SA 5GGRY 1LNUA 1ZD6A 3NZ8A 4A66A 1FFOA 2DQDL 3TEZA 3ZYNA 5KVMC 1TVHB 4ZNEA 1JWSA 2GW5A 4XODA 2P48B 5GISH 5IG7B 1U3HC 2W81C 5D1XE 3MRQA 3OB8A 3TNMA 4M6OL 6PAZA 1IM3B 3IFPB 4LCWD 4PWFA 1FORL 3OXSB 4MMZB 4LLUA 4N0FA 4Q9RL 3DYMA 3T2LA 3MR9B 4KK5C 4KGLA 2N01B 1PG7X 3I02B 4DOHE 1D0BA 2OJEA 2VXQL 4JFFE 3G6DL 1G7MA 2Y7LA 1I7UB 2FO4B 1QBLH 5HVHC 3L9EA 3CD4A 1KCUL 4LRNH 4DGWC 3VXPB 3L17A 3U7AA 3WMSA 2UUDH 1C5CL 4EOWL 4PGZA 2Y23A 4CSPA 3V8OA 1E4XI 2WGXA 2BJML 1WV7T 4AMKL 2JLPA 4NKIH 1KXHA 2IG2L 4YFLI 2EUWA 1X9QA 2NYZA 4MAUH 1KWKA 3EJCA 5EB9A 3GDCA 1TZHB 4EQ2A 1CXIA 1WF5A 2QVKA 2YGPA 2B59B 4JKPL 4I8DA 3NCFB 3HFML 4OCRH 5EN2A 3VRIB 2CGZA 1W9XA 3VWKB 1J8SA 4XC3L 4AL8H 3MCLH 2Z1KA 1LP9F 2WUCL 4R8WL 3HB3B 3L7FB 2DJMA 4UM8A 3BGAA 5KSBF 5IMLB 1KN4L 5F9DC 3WNNA 4PD4K 1SM3L 4EF3A 1GHFL 3BFQG 3KBPA 2W38A 3WTXA 4X8JB 4OFYA 2B2XH 3N1PC 3BE1L 1OQOA 3QRBA 3BH9A 1A25A 3K4DA 4PIRF 1E4XL 2VSMB 1ANUA 4F80A 1NKOA 2PCFA 5A2LH 3DO7B 2E75C 3VH8A 1TTCA 3CFCH 5KN5A 3OXRA 4HS3B 2RA1A 2ZUSA 4UOW1 4PJDB 4E41D 5KBDA 1KCVH 1L0PA 2Q3AA 1WFIA 4LBAA 2MCG1 1KNOA 4EIZC 4DP5X 2IDTA 1ILSA 1QRND 2VLRD 2H1LM 5D93B 1N64L 2CA4A 4OB5L 4NRXA 1UD5A 4H26B 4P3WA 2CCWA 1FGNH 2PR4H 4RZKA 2E6PA 2ENJA 1CXEA 1MIMH 1MCRA 3TZVA 1KTLA 4MB5A 4KVNH 1AZBA 2BIMA 4G9FE 2XJKA 5HHOE 4EZMA 3CDGB 1OAZH 3EGDA 3OKEB 3D09A 4TS6A 3SGEI 1OM9A 2JIXD 1S7XB 5FLVA 1S9VA 3R8QA 3ARFD 1PEZA 1YPZB 4H13C 3UJJL 4AUUA 4KMTH 2H0JA 5CD5C 3PIQB 5GPRA 4IRJA 2NT0A 2GBVA 2OAAA 1WEJH 4I77H 4NFDA 1PYWA 4CKQA 3IRZA 5B22A 3ARUA 3AFLA 2NR6A 5DZAA 4DN3H 5IJCC 2W9LA 4PJFB 3P3YA 4GG6F 4L3CA 3P9LA 4JO4L 4Q74A 2APVA 2QSCL 5JHDB 3BPCB 5FYJL 2HG5B 2J44A 3G6JF 3UTTB 3Q06A 4H0IA 4R5CA 4K5OA 4R7LA 3HBZA 3BP4B 4NQDA 1YUHA 1EJOH 5HJ3B 3ZZ1A 4CRPA 3APDA 4Y0GA 4UTAA 1PX4A 5EOQH 1I1CA 4Z23A 3NCJL 4ZMAT 2XOTA 3QDJA 4L4TB 3UBFA 1RJZB 3KE0A 3GBMH 4LKXB 3ARBD 1W72B 4LP8A 4WW2F 4Y5XA 2UXFA 3C5XA 4KQ0A 5D2NB 4GRWF 1E27A 3L81A 3HR6A 3D87B 3DOSB 1RXLA 3GOZA 2PXYC 1FFNB 4HGKC 3DX8A 2VXQA 4YXHH 5DJAB 3IPEA 3B9AA 2P1YA 2YQ2A 1JHTB 2ZUQB 2CMRH 3C5SB 1KCBA 1AACA 2HYMA 2YIHA 4IDJH 1QO3B 4JFDA 5LBVA 4GRMB 2W91A 1CU4L 3LRSA 2FJFB 4WHDA 3B1TA 2W5PA 3AS0A 1YEEH 5JW4M 5JA9A 2RALA 3NJLA 4HX1B 3RURA 2I85A 3BO8B 4KNUA 5G5DB 2D2CC 3QQDA 4FKHA 2EINB 3FU9A 1YSOA 3V6OA 3G5YA 4HEMA 1MRDH 4BSVA 1WVZA 4U6VH 1U2YA 3ZU8A 1UT2A 3WE6A 4B5EA 1DDHB 5D2LB 3OG6B 1HCVA 4X6DB 5KG9B 3ZDXE 3NH7H 1JXKA 2V2WB 2VM3A 1HH6A 2VM9A 4FJ6A 1L4IA 4GO6B 1T20A 4IMLB 4JPQA 1HINL 3B2PA 4Z6AT 1LD9A 4PCYA 2AK1H 5FHBH 3VCLB 4KJQD 4AIOA 4F20A 1RLWA 4JVWA 2X6AA 3RW6A 2LHAA 1QNZL 3S9DB 2X53A 3RWCA 1J11A 1TIUA 1GYUA 3JWNH 3B9KA 3IMTA 4IOIB 3QS2A 1E42A 4B53A 2WV3A 3QUXD 3EOTH 4C55A 4BGLA 4JN2A 5DMKB 4XSQA 3WGVB 1O0VA 1TQBB 5JHLL 5F70A 1R3JB 3LPOA 4NPJA 3KEHA 3EO0B 5HYQA 2GUOA 2NQ3A 2YWZA 1EDYA 3TTSA 4R2GC 3PXLA 5ID0B 4XNBA 2NNXA 2GJZA 2LU4A 4KI5C 1FNLA 2IQ9L 3D25B 3F6JA 3H2PA 3X3GH 4JQIL 1RCYA 1THCA 2HFFB 2R23B 1I85A 5H94B 3ULAA 3AU1B 2NTFB 3VXUB 1IC5H 4LK4A 1P4LA 4WNSA 5JQ6H 5ALCH 4MRCA 4WHTA 3SZ6A 2P24A 2OULB 3QISA 4MJHA 3WDIA 1PD0A 4NHUB 1INQB 4EVNB 3C6SA 3RWEA 3MRJA 3UO1H 4XPAL 3IN2A 4FG0A 4PQXA 1Q1JL 1UB6B 4XBEL 2Q1EA 4TTDD 2N7AA 3OR6A 4HMDA 2R2HB 4LLYB 3G04B 4BH8B 3MQIA 3ATFA 4P3DA 4K3DL 3UZQA 5C1MB 1A7QH 2GT9B 2IALA 1CGSH 1YEKH 2AZUA 4NKMB 2EUXA 4HXAL 4PG2A 1ZDSA 3FSVA 4Z1PA 5DUMH 3WD5L 3GB7A 2UYLA 1A66A 1PJWA 3HZMB 5EOCL 1AI1L 1PZ5A 1HAUA 2PMZA 4HJUA 3VVWA 5IBTL 3N43B 4XB3A 4A2MA 4K2UL 5IMMB 2QELA 1QLRB 4JFYA 3WIHL 5KJRL 1S7WA 4KDWA 3M1OA 2X0UA 2YRZA 5J1AB 1CQKA 1HS6A 3UN9A 1NL0H 3HC4L 5HBBA 3MA9L 3QEHB 1W8AA 1ZANH 3B6SA 2ZPKH 3PL6B 1JYWA 5KAQF 5DMYA 4MNQB 5DQJA 3QG6B 1NEPA 1UB5A 4UDUA 3FTUA 3FRPG 4E9LA 3PCYA 3U9PL 3BDBA 1J12A 4KRNA 4UT6H 3I6LD 2NXYD 4CW1A 4PKIG 1ND0A 3NDYE 4X7SL 1SYVB 1U8HA 1M6OA 2ZCLL 5JW3H 1OQXA 2CDGB 4KH2A 3IFOA 3MODH 5SV4A 2BSSA 5A5CA 1S6NA 1Q72H 1OPOA 4KRPC 4RESB 4AMWA 4ADJA 5F9JB 4UOZA 2AHIA 4YDLC 5BUAA 2MQ3A 4W9EC 2HRHA 3MRIB 3MV9E 5I8CB 4ODUB 3JWDC 1RFDL 4ZTOH 2BPBA 3V7MA 3O6FC 4MS6A 2FVNA 2VJ8A 3WFCH 1TVHA 2LV4A 3GMQB 1BAFL 2IBGA 5IG7A 1D7FA 4DGYH 4ENZA 1ONQB 4MA1B 2QQQA 1IM3A 3IFPA 5L88L 1OSYA 3OAZH 2NY6B 5B3JE 3TESA 3OXSA 3CX5J 4MMZA 4JCWA 3ALXA 1T22B 3MR9A 4KKAC 4M1GL 2FX7H 1OM3L 2E7MA 2A0ZA 3I02A 2GTZB 1Z3RA 1A5FL 3MBXL 3QG7L 4IK7A 1I7UA 4YHMH 3WJLA 4PJXA 2XKUA 2DD8H 4GP5B 4ZX3A 1FFRA 4S1SL 2QVTA 3VXPA 1WZKA 4IYKA 1FGVH 4MDJB 4U1GC 4GAYB 3BVDB 1Y1DA 5BVPH 2GYSA 1EZVX 2ATKB 3OAUL 4UNTA 4KXBA 5EEUA 4G42B 2XQYG 2C9VA 5FYLD 5HYJD 3E9UA 1CT8B 5JHLA 1BGXL 5L8KB 4PRHB 1OTSC 1TZHA 3SE4A 2P4AB 2SEBB 4XMKH 3S35X 3UTZB 3CSGA 1SXZA 3VRIA 1J1OH 2P9RA 1A4KB 4Q6IB 1KCWA 1RZJH 3CZFB 4JQIA 1C5DB 2AJXL 3L7FA 1JGVL 4QXGH 4CNIB 2G60H 1H3PL 5IMLA 4OBSA 2HVKB 3GTTA 1BV8A 1AZVA 4X8JA 1SN2A 4FAAB 5C2BL 1FPTL 2E4FA 2IMNA 3EG9B 4PWKA 5CJ5A 1A7PH 3X13B 4MNGB 1FNSH 3SHSA 5J56B 3QAZC 2DZEA 1D5BB 3DO7A 2FHCA 4EZKA 5K9OB 2XICA 1ZLVK 3W2DH 1ZA6B 5HDBB 4P99A 4A6YB 1J1PH 4HS3A 4XNQB 5HI3D 2FATL 4GUQA 4PJDA 4JDTH 4OBRA 1JSYA 4N6RA 3U4EB 4LLQB 3FQYA 4ANWA 3B56A 1CE6B 2Y6SD 1KXQA 3IT8D 5EA0H 4P3CL 4Z18A 4YHOL 3BPNC 2F9BT 2GVYA 4H26A 3IJEB 1G87A 1NAMH 3DO4A 3DV6B 4YSDA 4AZ8B 3Q2WA 4E42B 1IIIA 3MC0A 3CDGA 3WIHA 5BNXD 3E8UL 2HKAA 4GAGH 2H6UA 3OKEA 2DQCH 5E6RB 3CWGA 1S7XA 5FDWB 1YPZA 2DS4A 4MA3B 1FFTB 1RPQA 4P46B 1E6OL 1X4XA 3A6CL 5BUGA 5TGBB 2OXHB 5KTEH 1T7WA 2ZIDA 2YAMA 4XN2A 4DWHA 2E8YA 2APFA 4JRLA 2A2QT 1KTRL 1VFMA 2B08A 3FRPA 4S1DC 5D8JH 3LEYH 3Q44A 1OF0A 3ILEA 3QI9B 3BPCA 4HH8A 4PJCB 2ZXWB 1HL4A 2HG5A 4M8UA 5JHDA 1R0AH 1XB6A 3DXAA 2OMXB 2TSBA 4ZMVA 1ZTMA 7FABL 1YQ2A 1A65A 3BP4A 5SWZE 2C4XA 1GKEA 5HJ3A 5D4QA 3DSFL 2BCMA 2C1OB 2A73B 4NWUH 1GJUA 1MAML 1ZHLB 5IHWA 3RJ0A 4L4TA 2MH4A 5E2VL 2DEWX 1RJZA 4X5XB 3GZPA 4P8SA 1EGJH 4LKXA 4MTMA 3B2DC 2Z81A 3WPEA 1W72A 3I6SA 4IRZL 1BEYL 3TBBA 3H9YA 5CJQL 1X5GA 2AEQH 3P0GB 4P06A 5D2NA 1DVSA 2W80C 1SF5A 1DLHB 2JE8A 1A22B 1DQML 3BYYA 5TE7H 3VD7A 3U6RB 3TN0C 4GJTB 2F8OA 1FFNA 2WB7A 2J4WL 2DAVA 4Y4HD 3VX0A 2DH2A 5DJAA 5IVXE 1JHTA 3CXDL 3C5SA 1NWPA 3LHPH 2OPCA 4YDNA 2FTAA 4GRMA 4LEOB 4RMTA 5KBPA 2EXWC 2FJFA 4PRAB 4N0CC 1NTDA 2V7HB 1AQMA 5IBLD 2AJSL 3BO8A 3EYFB 5G5DA 1BAGA 2ITFA 1CYWA 2VE6A 4JFSA 1JF5A 1CFTB 3X17A 1HC1A 3FUEA 2JCCB 1XCDA 1FN4A 2FQGA 4PYGA 3ZDZE 2XQYA 4H20H 2AV1B 1TLKA 5GGSA 1DDHA 1AZZC 5D2LA 4KHTH 1UYWH 4X6DA 1RZGB 5TJWK 5KG9A 2XZAL 3PQYD 2V2WA 4DKFH 5F0LB 1NCDH 4IMLA 5E6ZA 5FUOL 1V3MA 4Z79A 4OZIE 3VCLA 1B88A 3ML9A 4I13B 2FWOB 3BPLC 4ARRA 3BAIA 5D6CB 3ETSA 1TJGH 4NQCE 3S3PA 4IOIA 3I50L 2QQLL 1FQ9C 1S78D 3UAAA 2C3GA 5JIHA 3O3AB 1TYRA 3NTCH 4ERSL 4TKWA 5DMKA 5GS0A 2KQNA 2F5AH 3MRBA 4RFEB 1R6VA 1D2PA 4LCUB 5I1AB 4HUMB 5JXEA 1J48A 4Y4FD 1T89C 4YDMA 4DW2H 5ID0A 1K6QH 3JV6B 4Z8GA 4ZG1A 1G7IB 1MHCB 4M7EA 3U30C 2NQCA 5JXAH 1F1AA 2EACA 2H3KA 3D25A 4WSJA 1GY2A 4M6MH 4UZSA 5IJBC 2Y1YA 3EAKA 1I8IB 4C83B 2ADFH 2HFFA 5AAPA 1U8LB 5AZ2L 2R23A 5EBGA 2VR9A 5H94A 2Z0UA 4AKPA 1MREL 3AU1A 5LGKA 2NTFA 3VXUA 4D9RE 1ASOA 4FULA 2PYEB 1BOGB 2V4LA 3NPSC 5D1ZI 1XBRA 5MHSE 4FOMA 4PB9H 4NHUA 4EVNA 1INQA 2EDKA 3DETC 4XPFL 1QASA 2IH3B 4NN7C 2FR4A 1A7RH 2VR6A 3HI1B 5DWUH 2QZQA 3KMDA 2ZX5A 1FH5H 1UB6A 4WEUD 2YGOA 4QUOA 1DBBL 1T5WB 4A6YL 4NUPA 3HKFA 4EI0A 2ENQA 4UNVA 3QORB 4F7MB 2R2HA 4LLYA 1IAMA 2MCPH 3G04A 3FHEA 4BH8A 2VLLB 3IAQA 4NKMA 2X10A 4PUBL 3B7YA 1I1YB 3MLWL 3Q2LA 3HZMA 4U1SB 2B1OA 1AD9B 3KGTA 5IMMA 1QLRA 5HI5C 4ZX5A 1Z9SA 2Z7ZA 2FIKB 2YKLL 1T83C 4TVPL 4XGZB 5J1AA 3II2A 2OYPA 5JA8B 1ZTXE 4S0TD 1SOXA 2YMXL 4OT1L 5HGBB 3Q5OA 4Z78B 3QEHA 5D1XB 5GGTL 3UZEC 3PL6A 1E5UI 1CGVA 3QG6A 4AG4H 3MU3A 3UG4A 1OOWA 3A4DA 4MKMA 2X70B 5AVRB 3WFEH 1B0GB 4IRZA 4JFFB 2MCMA 3ATEA 1SYVA 1PKOA 4XP1H 1OTUD 4NFCA 2AQ2A 3NVQA 3OHXC 3O2WL 2CDGA 4ZW7A 5EF3A 4LARL 4HKBB 1FO0H 2HZHA 4NAQA 3QHFL 4IM8A 3X1FA 1FDLH 3LD8B 3K6DA 2PPFA 4KQ4H 1UWGH 1JV2B 3R4DA 3L3DB 5L9DH 4FFYL 3MRIA 5I8CA 4HJ0C 4ODUA 1D7DA 3L5WB 3VXQB 3CFDB 2X89A 3GMQA 4RBPK 3MLZH 3L5JA 3DX7A 4Y2OB 4YXLH 2OCJA 4YPGB 5CMAB 1AE6L 2H0EA 1PNDA 3ZE1E 3VI3F 2NSMA 3HE6D 1RU9H 2PWDA 4ELMF 3QQ9D 2WN3A 3EFFB 4XWOC 4KJWD 3BI9X 1CBVL 1T22A 5DC0A 3GIZH 3V4UH 4HAGA 2MHAB 4N0UE 1LDPH 3JT2A 3ZTCC 1MJ7H 3T8XB 3OPZH 4LPWA 4RWHA 4TQHA 3FFOA 3CIGA 5C0AE 1IIKA 3FQ1A 3QPXL 3GC3A 4Y2LA 2YA1A 3HBGA 1PY0A 5AW3B 5KANI 1HHKB 3AG3B 4ZI8A 5HHVH 3WJJC 2XFGB 4L9LB 1HXMB 1T66C 3JWNG 1MHPL 4MDJA 1H0DB 4GAYA 3RYMA 4AQAB 2FJGB 3UDWC 4J7RA 3SKJL 1KCLA 4G42A 5E1IA 4N8CL 4DTGL 3OKLA 2AEPL 1BQRA 1CT8A 5DZVA 3VM5A 4BYHA 2ZYSA 3T3ME 4PRHA 1M9WA 2UZXA 3R1GL 4DERA 5T5NF 2QLVB 5A3ID 3WPFA 3UTZA 4N20A 2F7QA 2UXGA 3LEVL 5DO2C 1SEQL 2MQCA 4FXGB 4D0BB 4QRAA 5IB1B 3VSUA 3I2CL 3M07A 4DJMA 4GMTL 4X7TA 2P8LB 1A4KA 5I16B 1FE8H 2OW7A 4Q6IA 5FW7A 5KANG 3CZFA 2DQGH 1C5DA 1WG3A 1JXGA 3TVMA 4CNIA 3C08L 4ZDHB 2BIQA 5AZUA 5FA4B 4JZNB 3MLXL 4KMLB 4OD1L 4HJTA 2HVKA 3PDOB 3ZL4H 1TZGL 4J23A 4U09A 1NAMB 4TNWK 3EG9A 4A39A 1N9PA 2I24N 4X0NA 3X13A 7PAZA 2VZSA 2DWTA 4MNGA 2JQAA 5A2IH 1E65A 5D7LE 1K5DC 4A7GF 1D5BA 1E30A 1EDHA 3O9WB 5K9OA 4FS7A 1ZA6A 5IB4B 2VDMB 5LWYL 4A6YA 1IJNA 4XNQA 4AMXA 4YK4B 3PRZA 4S1RH 3EUUA 2HMIC 3ARDB 5BZWB 3U4EA 3ZL2A 4LLQA 3H9SA 3IXTB 2VLKB 5DMIL 1ZEAH 4FX5A 1CE6A 5KSUA 5EZIL 2NY2D 3ZZQA 1DFBH 1F6LL 4MGXA 5L6YL 3AT9A 4DUVA 5EO9B 3IJEA 5KYYA 2XC8A 3DV6A 3EF4A 3Q9PA 4AZ8A 3N6YA 4PB0H 2KDYA 2W9DH 4KXZH 1ZLUH 4C59B 4E42A 3PMHG 3SPVB 4GSDL 4NQXB 4NZFA 1CJYA 1VFOA 2XYCA 2ORBL 4GSRA 5D70L 3BIAX 3ILPB 5FDWA 1NKGA 3RBSA 1A7OH 1CCZA 3TIDB 1QOKA 2VAAB 2XN2A 3TZVD 2C9QA 4MA3A 5CJXC 1H3VA 5GGTA 2EIZB 3G5WA 4Y16C 4WFHD 3RFZB 2OXHA 4F15C 5KBNC 4MJIA 3VAEA 2L4OA 3FXIC 1JPTL 1BM3H 3VRLE 3X3FH 2B15A 4BFOA 3CHQA 2AGJL 3NZHL 1SFDA 3LSOB 4LVNC 4HK3N 3VUAA 4IRJD 4RIRB 2C3WA 1FVDB 4HS8L 3IDYB 3QI9A 5L0QC 1I1FA 2Z7XB 4PJCA 2OLDA 3BDYH 4MWFB 2OMXA 2NR6D 3WEMA 4BFJA 3RNKB 7TAAA 3ULUH 2BFGA 4IBVA 3GS7A 1UOLA 4FFYA 4X4MA 5KS9F 2C1OA 1D5IL 2FX9H 1VGEL 4KNSA 3QUKB 2A73A 4BKSC 3T0EE 1ZHLA 2ZUUA 4ANVA 4OCYH 3C5ZC 5C6WH 1UC6A 4X5XA 5IOKA 3QCUH 4YHYB 1NCJA 1DEDA 3D12B 4NQDD 1PLGL 2PWFA 4KDTC 4GRLD 5E9AA 3WY2A 4Z95H 3TNNB 3W82A 3PPSA 1BZDA 1DLHA 4G8EB 3U6RA 3QDJD 3EJUA 5I1CH 1DVFB 1L3WA 4HC1H 4XMLL 1IVTA 5DQ9A 1JTOA 1ZWIB 1JGLL 4LCVA 1TYEB 5SWSD 2UVFA 3TO4B 1A7NH 4IBTA 5I1HH 1Q9OB 3WS3A 5ENWB 5C7ZA 4LEOA 2E7HA 3KGRA 4NQSB 1MPAL 2Q3XA 1C1EH 2ILLA 2WWKO 2ZSVB 4PRAA 4WCYL 1KV3A 3IE4A 2V7HA 4CC0A 1M7XA 4ZS7L 1BD2E 5AVZB 2B4CH 1HCZA 3EYFA 3VXSA 1WCQA 5J89A 1QHQA 1M4KA 4JFDD 3NESA 1ASPA 1N6QH 2VUOA 1CFTA 3I85A 4ATTA 1JVOA 2DMHA 2IC2A 3J2PA 4DAGH 3LZQA 3DV4B 3QIUC 2BS8A 3U83A 2DYPB 3ISWA 3VSQA 2AV1A 3CQQA 5KVDE 4M56A 3V4VH 1RZGA 4K7PY 1HNFA 2FUTA 2WQWA 1ETJA 2X09A 1E50A 3CIQA 4H8VA 3HFFA 2MRYA 3AM8A 3O4LE 4YBLC 4NXKA 3QQ4B 2FWOA 5BZZA 3C2SA 1Z1WA 3EYQC 3L3JB 1N5YH 4OW6A 3PHQB 1WJ3A 3BIBX 4IKJA 3S35H 3OZ9L 5D6CA 5AALA 2CQVA 4U08A 2JQDA 1ZLWH 3BCDA 2X6BA 4ECOA 2OTUB 1RAMA 4UQCA 3O3AA 4MB1A 1GZHC 1PG7W 1E3ZA 1KENL 4DQOL 2V8MA 3CGTA 4LSQL 5IKCB 3TU6A 1BJ1H 4BA8A 3KYNB 3DVNB 1XTMA 2ICES 4JGMA 4RFEA 4LCUA 4JZJB 5E99H 3B9KD 5DEGB 5I1AA 5AYUH 2V17H 3IEAA 3JV6A 1SOQA 3IGFA 5GRJH 1G7IA 1MHCA 1TENA 4QT5B 3A47A 1SQ0B 4FNRA 3S3SA 1ZDQA 4PJEB 5C70A 4E9YA 4C83A 1I8IA 3BGMB 1U8LA 2QSTA 1H8SA 2GEEA 2L7QA 4G1EA 4K5NA 3NABL 5ERWB 4ZUWB 4WNQB 5JIKA 1EH9A 5FS5A 2NZ9D 1BOGA 1U33A 2R15A 2EDXA 2BHUA 3QEGH 2VRKA 4CGUB 4Y1TA 4YHIB 4EN2A 4BSWB 4UQ3B 2IDQA 2IH3A 5GRYA 2HTKD 3HI1A 4L8SC 4BK5C 1YC7A 2CCVA 2VDML 2A74B 2F58L 1T5WA 2FYVA 3GXDA 2CSPA 4ALAL 1BVKB 4WENB 1HXKA 2DIJA 1JGUL 3QORA 4EXKA 4F7MA 3RTQC 1NBQA 2XVGA 3SBWA 5FYKE 4ZS6D 5LCVH 2VLLA 3IAPA 1BPLB 3ASOB 3HS0B 1I1YA 3C5JB 3LOWA 4UT6A 5FEBA 3FTYA 5CIPH 4U1SA 1G1YA 2Q7AA 5LGHH 1AD9A 4UB0L 3MV9B 4NPYB 2FIKA 5F1OB 4XGZA 1LHZA 2C9XA 1V10A 2OZ4L 2M2DA 2JB6B 4WWID 5C0ND 5HGBA 1T4KB 3ZZSA 4Z78A 1JTPA 3MA7B 3SQOL 5I23A 1G9ML 5GGSY 3H3BC 3DVIA 5ALBH 2BO0A 1WZLA 5FYJD 3HUJF 2PCYA 5IVZB 2A3TA 2K78A 2X70A 3BAWA 3CZLA 1DL7L 4MJJA 3R06A 4JFFA 3OM3B 1MW2A 4AYMC 1KLUB 4ZUVB 4XNUL 3THML 3UBHA 3PDDA 1CD1B 1T6BX 1FIGH 1WITA 2ZOWA 4H88H 2Q7YB 2H41A 4CNMA 1O6SB 4X98A 1I8LC 4LCCB 2XU9A 5HGHA 1JV2A 4Y1SA 3NFPB 4TSBL 1OAUL 3L3DA 3WCYA 4X2UA 2DIAA 5T3ZH 3BN3B 4HYTB 3EBHA 5DJ8B 5ESVB 5ACZB 2YARA 4ZAKC 2C3HA 1QI4A 2A9NL 1USQA 3H42H 4G3YH 25C8H 4XVJL 2ZNWA 4BINA 1QZNA 1OTOA 3L5WA 3VXQA 4JUTA 3WKML 1JNNL 4Y2OA 4PSJA 4YL4A 5EUOA 4YPGA 5CMAA 3HE7B 2FLMA 4NAJA 4WUKH 3RB7A 2HUEA 3VQ1A 1SOSA 1WLHA 4XXDB 3I75B 1GC1L 3EFFA 1G7HB 4WV1B 3WKNA 2RJMA 3L5HA 2MHAA 1IC4H 1MXGA 2FGWH 5GGUB 5BOJA 1OCWH 3T8XA 5IROC 1JP5A 4NEHB 1HIML 1IM3D 2ESVE 5IWLA 3Q5YA 5GSVB 1OE2A 1R47A 2QL1A 5EDSA 3HW7A 3KJ4A 2VERA 1HHKA 2DWYA 2F68X 1KTBA 4J4PA 2OR8A 2VDPH 1G5AA 1HXMA 3ECUA 4L9LA 5CZXC 1H0DA 2A99A 5F89B 4AQAA 1EMTH 3MOQA 2XWTB 1DJWA 1EO8L 1T7ZA 5JIDA 4F8QA 3DPBB 2GI7A 4XPGL 1FLRL 5AOJA 3F6LA 4GUCA 2NY0C 1U8CB 2R2EB 2BP0B 4Z61C 5C71A 2VXTL 4TN9A 2ZXGA 2MOGA 2WLIB 3X11B 4FXKC 4JO3L 5IB1A 4D0BA 3DOIA 3SJVB 4DO4A 5KW9L 1MCPH 3AVEA 3MUUA 3K8MA 4OLWL 3RHWF 4APQC 4H8WL 2P8LA 5I16A 2CLRB 1UVQB 1DO6A 1U2HA 2XXCB 5I6MA 4ZDHA 4FQQB 1MXDA 5FA4A 4JZNA 3KXFA 1YYML 3H8NA 2V5SA 3PDOA 3VWKD 5DJ6B 1LWRA 1NAMA 1Z7JA 4K71B 5BRQA 2RR6A 1XH0A 5GRUL 1XH1A 3HB3D 2XQ0A 1IVLA 1IU1A 2IAAC 4GIAA 4XI5C 3O9WA 2R29H 5IB4A 1BVLB 1U8PB 4OD3H 3CVHB 5IQ7L 3LS4H 4OJEH 5BZWA 3QRGL 4P9HL 4QRPE 3IXTA 2VLKA 4OGXH 1TUPA 1NMBL 4Z7QF 4D9LH 1ZCRA 5EO9A 3ZIYA 5DJYB 1OOAA 2DKMA 3F3HA 5DTFB 5FV1L 2IFFL 3K0YA 1KG0B 5HDOA 1ZHBB 4F57H 4XE5B 1EX0A 4NQXA 2IMMA 2HJKB 3PHAA 4UAOC 5E6IC 4F58L 4LAJH 5AL8A 1UGKA 4PJAE 2OZ4A 3ILPA 3KGUA 3EOAB 4WGWB 2VDLH 3QC5X 3EKCA 1F5WA 2BH0A 2VAAA 4MLSA 4L3FA 4L8DB 4WK0B 4PJHE 2EIZA 3G7TA 4U49A 3RFZA 4G8GE 2DH3A 4PJ6A 4KK8C 4ENEC 2VITB 4TNVF 5EU7E 1BBJB 4I0PB 2W0FB 3EJQA 3VQLA 4TLTA 3LSOA 5EU4B 1ETB1 5IVXB 4AI7A 2K8MA 3O8XA 2Z7XA 4GT6A 2XZZA 5E4EB 4LIQH 4MCYB 4MWFA 1KXTB 5J6SA 3TCTA 1EA9C 5DVNA 2OR9H 2D0HA 1ZY9A 3F7YB 3ZE2E 1ASQA 1WFMA 5JYMA 3P2DA 5DQDL 2E6QA 4YGVB 5JHDD 4RLDA 1V7NL 5I1LB 3UTTD 1SMOA 3LDBC 3T77B 4LBEB 2JE0A 4NLHA 2NNFA 2BSRB 3HOGA 2IANE 3MKKA 4H44C 1PW3A 3SPGA 1I4FB 3SDCC 1BDYA 3P4NB 4YX2L 2YXFA 2JQZA 2ZXAA 1E5AA 1SN5A 2VSCA 1DBKH 1YMME 3TNNA 1RJLB 1YY9C 4FL4B 4G8EA 5FM5O 3NJIA 4OZIB 4L4TD 1T5XB 4GSUA 1DVFA 1QUPA 4Y4KB 2O6SA 1UCBL 4HAKA 1ZWIA 4MXVE 3O0LA 3I3DA 4EBQH 1YEGH 5HHMB 1WIPA 5IJDC 2ZD0A 2GC4C 4RGNE 1Q9OA 4R4NC 5ENWA 1QHPA 5J8OA 1ZIAA 4NQSA 3T8MA 4DK5A 1P4BL 1XR9B 2YPLE 4ACTA 1M56B 1MF2H 1UM6L 5KYNA 4FGMA 4OLVH 3GRBA 3BRDA 3MUJA 1FFQA 5C9JB 2CE6A 2XN9E 3DV4A 4CN1A 3EH4B 1BA9A 3Q05A 2DYPA 3T2NH 1MI5E 2DW5A 3QJTB 1BBDL 2HT2C 1KC5H 1W15A 4MN8B 2A6JB 4KT1A 1OEZW 3KAAA 3WPDA 4W9ZA 2EDDA 2N3JA 1RZKC 5GHWH 4Q9QL 4XNZC 1SJVA 5EZLB 5L2KE 4M62L 3DROB 3QQ4A 1A4YA 4PP1C 3L3JA 2P49B 3PHQA 4DEPC 3KLHC 1CXFA 1P0SE 4F33B 4PJ8C 1PIFA 3AREB 4LP5A 4TSAH 4Z7VA 2OTUA 4KXZI 4FQ2H 2VQUA 4M4RB 1VEOA 2DQEL 5CEXA 4FFVD 4JFZL 3SE3C 4AV4A 5IKCA 2WKOA 3HTLX 3Q43A 3KYNA 3DVNA 3ZE0F 5F7YC 3C6EA 1TITA 1JZ7A 4JZJA 1U8NA 4PHZA 3TOPA 1F3DJ 3L4YA 4OQTL 4UBDD 3VU1A 2CO3A 1A1MB 4YDKH 3DO3A 3KD4A 4QT5A 4PJEA 3ZGHA 1M1SA 2XIBA 4ZMLA 3BGMA 1KPVB 3B2UD 1BYOA 3F01A 5JXED 4R6GA 5ERWA 4PRIB 4ZUWA 1SLXA 4WI7A 4WNQA 3HRZB 1T7VA 4TUOB 4J3OH 1Z9LA 3DBXB 3SGJC 1OSPL 5CIPB 5FUCC 4O58L 4LZKA 3LV3B 4Y9GA 1NPUA 1W0VB 1YJDC 2QADC 3HN8A 3KH4A 4O4YH 4BSWA 4UQ3A 3CDFA 3BUDA 5GZNC 3B5HA 3MMEA 3VXUD 2A74A 3CVHL 1UGNA 5F96L 3WXVH 1BVKA 4PJ5A 2XTSA 3CAFA 3WKPA 3SQRA 2XZQH 3NGBB 3CSFA 4UUJB 4MXQD 1RUQL 3RJOA 3KCPA 3SE8L 4M9OA 4DF9A 3ULVH 4ZODA 3HS0A 3C5JA 4GOSA 4YOKA 3WN5C 1X5AA 4LVEA 4KKBD 5GMGA 3WNPA 1S7QB 1QWNA 2C4FU 2I9TB 1J1XL 5CJ8A 5B1JA 3CN0A 3P0YH 1XCXA 3ILDA 2ID5A 4FQCH 2BVQB 2JB6A 1T4KA 1FCGA 3MA7A 4I2XE 4PJ9B 1HKLH 3C60B 5IVZA 4MD0B 1BVZA 2OK0H 4UDTB 1J18A 4JQVC 1B4JL 1ZJAA 5F1IB 1A6ZB 4I48B 3SKNB 4OZGB 3US0A 4GAFB 1D3CA 3PL6D 4PS4H 4ZUVA 4LXSA 4MNQD 4WFEE 2FBRA 4WHCA 1P9AG 1CD1A 2BY2A 3SOBH 1O6SA 3SSGA 2ZKXA 1J0IA 4ZQKB 4LCCA 4FQIH 1NSNH 3BVTA 4EO5A 3NFPA 1KBVA 4Z7OF 3L5XH 5TQ0H 5IB3B 3CIAA 1MFDL 4PJFF 5DJ8A 5ESVA 3IMRA 1F6FB 4OCXL 5ACZA 1E5BA 3CN1A 4IU2B 3VG9B 1RZIB 3MNWA 5FKAB 4L1SA 5KSBE 1HL9A 5EZJB 4J28A 5BQDA 2EUVA 4RSVA 4YHKL 1YEJL 2HH0L 2X4UB 4LSRH 3HE7A 4R7XA 4RDBA 2D4DA 4IHBA 4XXDA 3I75A 5CKAA 5IT2L 5DK0B 3U0PB 3MJ6A 1G7HA 3ME0B 4E36A 1JRHL 1AKPA 4WV1A 2CA6A 2O93L 2X89D 5GGUA 2YS4A 4PV9B 4KZCA 2Y1AA 4AC2A 1NPJA 5GSVA 2N56A 4DSYA 2NY6D 4F37F 5HHXH 5E0QA 1OTTC 2CHZA 1UZ6E 4JCLA 1QTSA 3RWIB 5F89A 5D7LB 2EADA 4OZHE 2B1HH 4B3VA 2XWTA 4CN6A 3DPBA 3BWUC 1RUPH 2NY4C 2HT4C 3D48R 3MKGA 3REVB 5KSAB 2QFRA 4YHZL 3X12B 5CMPA 1U8CA 2R2EA 2BP0A 4JPKH 1KT2B 3NP4A 3Q48A 3S96B 1PCSA 2WLIA 3OSVA 3B3BA 3X11A 3K6IA 1CI3M 1UWFA 2R9HC 3O41B 1SF3A 1H8LA 2OMBA 4OQTA 3QA3B 5F8QC 3SJVA 4V2EA 1SVZA 1UWYA 4A1RA 2D7QA 9PCYA 2R27A 4I5BB 5CINL 2MFNA 5C0IB 3NSCA 1UVQA 1M42A 2P44B 4PRHD 3DWTA 4NHCL 4OM0L 4FQQA 5IW3A 1VHPA 3BESR 3KWUA 3AY2A 2CR3A 2IBZX 3NCEB 5F97E 3AAZB 4V2DA 1Z2KA 2YRLA 1RERA 4XCFH 3ZKNC 5IMOB 1N6VA 5DJ6A 3WFBH 3G9AB 3VO0A 1ZSHA 2O6EA 2VXUH 5JO5B 2BOLA 1RZ8B 5F6IB 3Q3GB 2N7SA 2X4PB 1U8PA 3CVHA 5D7IF 3ATBA 4YDJB 35C8H 4ZFFB 5IFHH 4YPJA 2X1XR 3TBTA 3MYZA 1AY1H 4E9RA 4HU2A 3ZO9A 4DP2X 2QPEB 5D1QE 1FWXA 1NCBL 3ZJAA 5I18L 4JJHA 3EBIA 2DDQH 1QKZL 4IU3B 4NNXB 4TQEL 1R3KA 1XR8B 3GZKA 4HH9B 1BIIB 5SX4H 5SWQB 1ZTXL 3CDZB 5DTFA 2YBGA 1F90H 1BZQK 2IPKB 4GRWE 4AE1A 1ZHBA 2ZCKL 5DJCA 1G5GA 4BFKA 3EYUH 1F58L 3BUBA 3KM2A 4HCRL 4OCNC 1RUKL 5FXCH 2HJKA 4EXPX 2QHRH 1KEGL 1A3QA 3EOAA 1PZSA 3H54A 4UM9D 4IJ3B 4JY5H 1QYGL 4ANKA 4FEIA 1DJZA 4J2XA 5CCKL 2PPCA 4Z0XB 1OP3H 5B39B 2KZ1B 4TVPD 4JKMA 2VITA 3D18B 4C56E 4X80L 5EH1A 2KLRA 3FSWA 1BBJA 3KL3A 4H8HA 4I0PA 4R6JA 2W0FA 4MJ2A 2IOMA 2CJUH 4PJIE 1VPOH 3H3KA 1CLYH 1V05A 3NAAH 3ABZA 4LSDA 1HYSD 4P46D 4XN4A 3GLAA 5CS7A 5IVXA 1SY6L 4L0YA 3PXJA 1TEFA 5F3HB 5C7XH 1CLVA 4UTBH 4MCYA 5ABZA 4EDXB 1B9ZA 4D94A 4BZ1H 1V3LA 2H1PH 2EVFA 4F2EA 3JWOC 2O5XL 5J1SC 3A22A 4LLWB 3QI9D 2E7BA 4YGVA 5I1LA 3CN4A 1FRGH 4R09A 1WS7A 3LVEA 3FU7B 4R0LB 4XBPB 4LBEA 4QRTB 3T71A 2BSRA 2NOYA 3IAGC 4MVBC 3QJVB 3TONA 4H25B 2EDYA 1GPOL 1G1OA 3P4NA 4QGYA 3KWWB 4KKCC 2SODB 4HUNB 2NY3B 4JPIB 1RJLA 1OAXL 3ETTA 2WQUA 4D8PB 3M88A 1F02I 3QNYB 1D9KC 2ZSWB 3B1UA 2NYYC 2VSDA 4Y4KA 4MQXC 5DD1L 1MAJA 4AOFA 2KQMA 2WZ0A 5F8RC 1MVFA 1UA6L 2MWCA 1QFHA 5E51A 4L48A 2HTLC 3LZFH 1MWOA 1IMHC 4P4KC 5DEFB 3FT3B 5JORB 3NIDE 4F7KA 5EORH 1MCBA 4XO4A 1CGTA 3IFNH 3NJFA 2BVUA 1CFVH 3AU0A 1OALA 1PZUB 4ODSH 3RIFK 4DH2A 2ATAA 4F3FB 5C9JA 1M10B 4Z7UE 4FZ8L 3ZKXC 3E6FB 1SXBA 3T04D 2RB8A 4IJTA 4RFNB 3ECQA 2A6JA 3S8WA 2OI9B 1KCSH 2N4IA 1GGIL 2D73A 2J73A 1Y7VA 2YAOA 4WNJA 5EZLA 3RVUC 4DIXA 1J9QA 5I0DA 3IMBA 3DROA 1CFNB 3BXNB 3TJPA 1LEKA 2MNJB 4F33A 3QDME 3AREA 4X4ZA 4HJEA 4GT7A 1J9TA 4TTGA 1S3RA 3CZUB 5T5FH 1U3YA 3RWHB 4M4RA 4AITA 3TT3L 3WFHB 2DQUL 5DSCB 3VB9A 1I3VA 4P91A 1JCVA 1B0WA 2HRLA 2Y5EA 4OUOA 3D06A 4P49A 2YOAA 2XZCH 5EC1B 3OGMB 2P42B 4WKXA 4AJYV 4CL7A 4MMYB 4ZZFA 4MBOA 4MLIA 3AG2B 2FWUA 5JYLA 4JFHE 4OLZL 1A1MA 1G6RH 1JZDC 2HVJB 1GS7A 1SHSA 1KBGL 2J1XA 3VFTB 1CYGA 3AT8A 3MRNB 1KPVA 5EOTB 2GBUA 3PGDB 4HSCX 4N26A 2WAQA 4MD4B 4PRIA 1RVFH 1XO8A 4ONGH 2YBRB 3HRZA 3L1FA 5CILH 5DS8B 4TUOA 3COOA 3DBXA 4HCRA 5CIPA 4KUCD 5HYEA 2QPSA 3LV3A 4AM0B 1W0VA 2W8CA 4QAWA 4JFQB 3RX7A 4FQLL 2IADB 4KPHL 4LHQB 4ZO8A 5JPMC 2IIJA 1AQKH 1C7TA 1ZE3H 3DK2A 4MZ3A 4YIQA 5T1JA 4MS8C 4HIHB 3QEQD 4GIOA 2PYED 3MNZB 3NDZE 2H3XC 3S8FB 4RSYA 1HWGB 5TDPA 4UUJA 1D6EB 1AQDB 1UJ3C 3JTTB 4FG2A 4WWKB 4WY7H 5JUEL 4P2RE 2PYFB 5BRPA 4HALA 2WQ8A 2YJLA 1SY6A 1CURA 3NJJA 1GAFH 3GI9L 4UT9L 1XKUA 1UD8A 3QORD 4NT6B 1A3LH 1S7QA 1LTXA 4D8OA 2I9TA 4AKOA 5JW4Q 1WGOA 3FTXA 3FUMA 2XQBL 4DHLA 3DGGB 1EBPA 2BVQA 3D2UB 1UKTA 1FLTX 5AWNH 1UXLA 4KKRA 5MENE 4HJJL 1SHWA 4JM2C 4PJ9A 4X9IA 3TYFB 3D2TA 1NBVL 1JL8A 3MRRB 4E5XB 1URZA 2AF2A 2K8QA 1H5BC 3C60A 4MD0A 1ROCA 2J8UF 4KK9D 4UDTA 4M7JH 3RGBA 1PZAA 1U3ZA 2EO9A 2YKKA 5F1IA 4Z3FA 4F2MB 1A6ZA 4I48A 2X44D 3SKNA 3U9UB 4OZGA 3CN3A 1IILE 3MPCA 4LRIA 3BC9A 5D1XD 4ZFOB 2ESVB 2ODHA 2VR8A 3P30L 2YK1H 2EIMB 4HPOH 5A43C 2Y7SA 1OT1A 2BZCA 2TRYA 3MJ7B 3VWJA 1JZ5A 4ZQKA 4TVSa 3FT0A 4JFFD 3PJLA 3CNKA 4C4BA 3MRMB 4NZTL 2IEPA 5IB3A 1YNKH 2OMNA 3CHOA 5GRZA 1T4WA 4OLXH 3GHBL 2JE1A 4IU2A 1RZIA 4Y8AA 5FKAA 4ZMPA 1IAIM 4NNPH 3PAUA 4IBWA 1WBXB 5EZJA 1JNLL 4WTZG 4UILL 1U41A 4JBSA 2WVUA 3K4ZA 4PJGF 2X4UA 4IK6A 2K3TA 4M02A 3N40P 4KKQA 1DJGA 1HHJB 1ML0A 2F54E 2IV8A 5KVDL 3VGBA 4F1SA 1WYJA 5DK0A 4Y5VC 3AWFA 3U0PA 2HLAB 3ME0A 3OBAA 4K9EL 4JO1L 5J12C 4DETA 5HXMA 3BAJA 4GXUM 1KTCA 4L4VE 1B2WL 1KTJA 2UZIH 3AY4A 1I7TB 3U2SB 3ULSA 1HQRB 4PV9A 4LESA 1E3FA 1JS4A 4R4FL 4K0OA 1FI8C 1QFWL 3IDGA 4GQ9H 2H32B 3RUGA 3D0VB 3PWPE 3RWIA 5D7LA 5DEZA 5HGGS 4C54A 2KC0A 4GW4B 4HXBL 3IS0X 4M93B 4K94L 4MD5A 1Z3GH 4NUJA 5IFAH 3N42B 3ULUE 3PP3H 3REVA 5KSAA 1SVBA 1MQKH 3I9AA 3X12A 3S6CA 1VERA 4WRLA 1KT2A 5CLWA 4J4PD 5F1NB 3U36B 3S96A 1CDYA 4URTB 3QUYC 4GQQA 4OQ1A 2JH2A 3O41A 2Q3ZA 3QA3A 1A9BB 3J27A 3UTPD 3PFUA 2FX8L 4I5BA 4XXWA 4BWTA 1CYXA 1EPFA 2KHAA 3FFDB 3LQAL 1DS9A 4PMFA 3X14B 3SDDB 1TVBB 2JCCF 2ICEB 2WXLA 1TU2B 2AI0H 3MAWA 1S46A 4J3OG 3AAZA 3GBEA 4OF0A 4QTFA 3QEUB 4XP4L 5IMOA 3PHOB 3ZKMC 1WZAA 5JO5A 4ABWA 4PJHB 1RZ8A 4KH9A 3K4AA 3Q3GA 1FNGA 2X4PA 4TYUA 1I1AB 1GH7A 2VIRB 2ZXBA 5FYKL 4YDJA 5F0PB 4ZFFA 4G72B 3IDMA 2NY1C 3SO3B 1HOCB 2CRIA 3AMKA 2Z3FA 4A7VA 3VD2A 4OZ4B 3RQ3A 3S36H 1VSCA 4G43B 2DJ4A 3CLWA 4RMUA 4AC4A 4IU3A 4NNXA 3O9WD 2R0KH 3F5WB 3ROOB 1XR8A 5BOZG 4HH9A 3KPLA 1BIIA 4M1CC 3RVTD 2IPKA 3UGUA 3ZE2B 3ARDD 4UT9A 2OFQA 3HMXL 4W9FC 4ECNA 1U4FA 3N55A 2VLKD 2HFTA 2GKIA 2AFNA 3DX4A 1L0XA 2WNKA 1PGVA 2HWZL 3NOIA 1HEZB 1N59B 4P9MH 3GEFA 3LB6D 2IANB 3PE9A 4HIEB 3V0WL 5KVEH 3VFGH 4I3SH 3QXWA 3OR7B 3VFNB 1OAQH 3P11L 1IGTB 5B39A 4JVPA 4Z0XA 1AZNA 1DBAL 1YMMB 1GZQB 5E00B 3RPBA 4RAUB 2LU5A 3D18A 1U6AL 1IUZA 2NY5H 3NJVA 3W37A 1L7IH 3FC8A 1MNNA 4QY8B 4HF5L 3KL0A 2XTJE 1OTMA 1FNHA 1NLDH 3EFDL 1OB1B 3ARYA 4KU1A 4M7KH 4RAVB 3HPJB 3OZLA 4TUJA 4IRSB 5HP5A 1WAAE 1PVHA 4GKSB 5ICUA 4Y5YB 2QDWA 4XRCB 1RURL 2BWIA 3IMUA 4OD2B 2DJSA 4O5LL 1BZ7B 3QNXB 4LSAA 1ID2A 3R0MA 3RY6A 1AJ7H 5FK9B 4EDXA 2I26N 1NIFA 5TDNB 1EAPA 2X28A 2YPLB 1IZKA 2HRGA 1FBIH 3FCUB 1UCTA 2BZDA 4LLWA 1QBBA 3ZR5A 4GBXC 1A4AA 2NY2C 3FU7A 4XBPA 4QRTA 4XN5A 2XN9B 2NY7L 1DVYA 1M1XB 2J1YA 2IPUK 3NCWA 4FLHA 2YPVL 3KDPB 4H25A 3NCCB 4RGOL 3DVFA 3KWWA 4FQJH 3GSVB 1BQLH 3G08B 4JPIA 4PV1C 3VI4E 4EN3B 4OJAA 2DWXA 4ZFOL 2EE0A 3CLEH 1O9WA 4N8PA 3L7EB 4PI2A 3UBXB 4O02L 5DRXB 1IJ9A 1K5GC 4B9YA 2CUMA 4D8PA 3QNYA 2ZSWA 4AVHA 3O0RH 2Z7YA 4NRZA 4AW4A 2J72A 3HNTH 3GSOA 5A6MA 2BNRB 1WQVT 3BAKA 5JHAA 4UV7H 4AZUA 1RIHH 3FO9A 2ENPA 4YH6A 5DHYB 1ZS8B 2ED9A 2M83A 4ZOAA 4YSEA 4TULH 3GBNH 4NJ9H 5TF1L 3E1F1 5I6KA 1CGWA 2BS9A 4NJAL 1DVFD 5DEFA 3FT3A 3HVDA 3R0NA 5JORA 3LRMA 1D5MA 4KI5E 3V0AC 1MNUH 3H6AA 4YQXH 1TQSA 3BZ4B 3U4KA 3TO4D 2VN3A 5AOMA 2KZWA 5KVFH 4IBYA 3PLYA 3PNRB 3SEPA 4F3FA 3IJYB 1QFUL 2DIEA 2HLFD 2CGRH 1GGBH 4L5FH 5J13B 4ZXBB 4X7EC 5I6XB 3GQFA 3UL8A 3IDNB 2B0SH 3E6FA 3OX8B 3DDFA 5DEJA 2OR7A 1TEGA 2HX8A 1NMCC 4QNPE 1IBGH 4X0KA 1OGQA 4JG0H 1GYVA 1CFNA 1MZZA 2EDNA 5HJBA 1FCCA 1MCNA 1NAKH 3BXNA 2DYPD 3P0VL 1TQWA 4NXSA 2YD7A 3VVVA 3V0JA 4NLAA 3DX3A 3GMOB 3CFBB 4OIAA 3MV01 4PRPE 3U4BH 1WDAA 1A8ZA 1AR1C 3FUFA 1FNAA 3TP4A 4WI0B 5CBEB 3RWHA 1ET7A 2B14A 2HKFL 3U0TB 3WFHA 1AANA 1E9QB 2ZYRA 5DSCA 3B9EA 4JR9L 5I15H 2PW1B 5EC1A 4J3TA 2H0PA 3MN8A 3O3EB 3S37X 2IPUG 3T1WA 2OMTB 5ICXB 5SX5K 4MMYA 5H4YA 2ZP9A 4JRYE 2J57A 2AEOA 2HVJA 2A6DB 4RMQA 2R83A 4XNXH 2E86A 1IFHH 1RJYB 4JPWH 3VFTA 2HSIA 3LQZB 4EAEA 3ZL1A 3MRNA 1JMXA 4TUKL 2Y06H 5EOTA 5F7EL 3GS0A 1EXUB 2CPCA 2W0PA 3O4OC 4MD4A 3GJFH 3WAJA 4PY8J 2YBRA 5DS8A 4ZMNA 3SDAB 3QZNA 3HMXA 1D2OA 4ZQTA 1YA5A 4XGOA 4AM0A 1UH3A 1F13A 4N3UA 1SBSH 2CR0A 1VADB 4JFQA 12E8H 1OHQA 5MI0B 2LLLA 2IADA 1H8OA 1FF5A 1UEYA 1XFPA 2AQ1A 1QAWA 1UT1A 4OV6F 5DVOA 1BQKA 3CG8A 5KUMA 5I0WA 1JZJA 4HIHA 1VRSA 3MNZA 1VCBC 2FWSA 2F1BA 2DEXX 4K5LA 5HI4C 3V6OC 4AGLA 3FO0H 3TBSB 2MTAA 4YMPA 5LO7A 1D6EA 1AQDA 2CWRA 3JTTA 3RY5A 1LO3L 1EZVY 4G2AA 4WWKA 1ZVHA 3IS1X 1G9UA 4DEUA 1NJ9B 2PYFA 3N9GH 2JNZA 3VI3E 3D51A 1RIVH 3K6NA 3DIFB 4QDGA 5B4MD 1EHLH 1E7UA 4NT6A 2WXNA 4JDEB 2MJWA 1LP9B 2BHYA 3R7RA 4Z76B 3DHMA 3UYRL 5KSBB 2ZJSL 5DJ2B 4AXWB 3DGGA 3D2UA 2R7EB 4NZDA 2AEWA 2DM3A 3ZYOA 4PLKD 5I1JH 4XC1H 2PW2B 3TYFA 5GS1B 3MRRA 4E5XA 4R6UA 3MV9D 2C4FT 2JJSA 2ZKHH 4YDIH 1A6UL 4R0AA 2X7LA 5TPWH 1HEJC 4UV4L 2YPVA 2F1EA 3E3QE 4F2MA 1ZV9A 3UBXI 3WIAA 5E23A 3CVRA 4ZFOA 1JVLA 2BFVL 2QQNH 4HPYL 2EH7H 1MCEA 4O9HL 5E9DE 2FB4H 1P7BA 3CBJB 3AGVA 1CQYA 3MJ7A 3T1FB 3EZJB 4OZHB 1B0RB 3T3PE 1VGKB 2FHFA 4GKZB 5I1EH 4KBPA 3WTSA 1A0QL 1AAJA 1JN6B 3Q8CA 2A77H 3QJHB 4PRDB 4P5TB 4R5DA 1WC7B 3GD1C 2FL5B 3NFNB 3SPCA 4B41A 1URLA 1CXKA 3P3RA 3A67L 1HHJA 1A9EB 3MSPA 3UBXG 4ODHH 3LTVA 1N2RB 2HLAA 4FDWA 5F7FA 1XGYH 3MRGB 1AH1A 4YS4A 1TJHL 1FZKB 1KYFA 1I7TA 3U2SA 1CDJA 1HQRA 1XF3B 2VXVL 2QMJA 2DQHL 3MOBH 3HE7D 3GSUB 4U1MB 5C0NC 3T6WA 2BDNL 5K1NA 4TL5A 3BD3A 4R3SB 3GK8H 2VDNH 1Q94B 3W56A 4GG6B 4LVHB 3ZDXF 4ZPVB 1DVQA 1UA3A 2N0KA 3DX6A 2H32A 3HNVL 3D0VA 3LN5B 4PS7A 1U8JB 4RRPA 2B77A 1KYAA 3VYOA 1BXUA 4U3XA 3BQUC 1QSZA 2WXMA 4GW4A 4KJYB 3BAEL 4OAWB 1Q4NX 3MXVH 4P5SA 5FGSA 5FECB 2G2NA 3EJYC 1I82A 5C2UB 2X6UA 2D3VA 4OZFB 1KN2L 2JV6A 2ZX7A 4HIXL 4LOVA 5DLML 4NFBA 5F1NA 3U36A 3F12B 4L8BB 1F2XK 1C08B 2DJUA 1A9BA 4R90L 4CC4A 4WW2B 2J8HA 3ZRCC 3W39B 2FDBP 1FSKB 4GRWB 3S0PA 3FU3A 4PU2A 1I9JL 3QO1B 3INUL 3FFDA 3INOA 3ZYIA 2VDOB 3X14A 3SDDA 1TVBA 2ICEA 4LSXA 1IGMH 1S9WA 1TU2A 3N1FC 3SJVD 2YR3A 1FL3B 3QEUA 3ZR6A 1S9YB 1DJXA 4QHLB 3PHOA 4G6MH 1KACB 2CM6A 5AOLA 2BC4B 4PJHA 2OMZB 1CDUA 2CRYA 4YVNA 5T1KB 5J11C 5BV7B 3II1A 3OAWA 2J1ZA 7PCYA 1I1AA 2VIRA 1BMWA 3LNFA 3MV7E 4CC1A 2BK8A 2IOOA 3CX5K 2R9UA 3SIKA 2BIIA 1MCOL 3QZMA 1IKOP 4OZ4A 4QXVA 2QJDA 2A0LC 1HCFX 4BXVA 4GXFA 4QHUB 2Z31C 4G43A 3RG1C 2WTRB 1EK3A 4J4LA 3F5WA 3ROOA 3EDFA 1G9NC 4G8AA 4BCXA 3RKDD 3BP6B 4LGPB 3VMPA 5TK2A 2JWYA 5JW4N 3CVIH 3LZOA 5EEWA 1RZFL 3K46A 4M61A 2L7UA 4G5ZH 4M3KB 1DBML 3U7YL 2O6CA 1AYRA 1RIUH 2X1PA 4FKEA 1HEZA 1XGTB 3VW3H 1X9UA 1N59A 4I9XA 2IANA 4HIEA 4BZ1A 2XIDA 3H2QA 3S2CA 3OR7A 3VFNA 1IGTA 3PP3K 1XD1A 2WBJC 1GZQA 3OWRA 4XTRD 4RAUA 3PY9A 3VA6A 5JOFA 4YGAB 3LY6A 1PSKL 1AZCA 1TQCC 2FJHB 3ECVA 2LTQC 4QY8A 4Y7MA 5EF0A 2ZX6A 1MW3A 5K1VA 1LQSR 1OB1A 3DA0A 4RAVA 3HPJA 4ZO6A 4JGUA 4IRSA 1MKFA 4GS7C 4XRCA 1D7BA 1V7MH 4OD2A 1NINA 1WZ1H 4WIQA 4YBQC 4BGDA 1BZ7A 3QNXA 3SB3A 3K6OA 5FK9A 3ZXAC 1OGAE 3RVVD 4I0PD 2EVJA 1ZGLB 1V8HA 5TDNA 1EO5A 3QIBC 5T1MB 1NLBL 2E27H 2YPLA 2CKBB 4E9WA 3TV3L 2FUQA 3HG1E 5K9KB 1IC7H 3WTUA 2NXZB 5FYLH 1C8QA 1UOVA 1DO5A 2FT6A 1M1XA 4Z7UB 5BCAA 4NI6A 4WEMB 4YSOA 3GSVA 1IEHA 4R7DB 3G08A 5LGJB 4EN3A 3L7EA 3UBXA 3L4WA 5DRXA 3GMNB 2ADJB 2XY1A 5B3JF 4HA1A 4X5LA 2B5IB 1KPRB 2G3MA 2BNRA 1B3IA 3QDMB 3ZZLA 5ADPH 4J8RA 2P5WE 3V6FB 1TT6A 5DHYA