4CC4A

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
265
structure length
262
Chain Sequence
b'ASESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSALSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INLC PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
total genus 80
structure length 262
sequence length 265
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc4A02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4cc4A01
4CC4A 3W3JA 1JL5A 4QC0A 3WPDA 3BCFA 5D3IA 2P1MB 2RA1A 4Z94G 2ELLA 2XWTC 1XCDA 3M18A 4M7EA 1NM4A 3ULAA 4LSAA 2WQWA 4YEBB 5AWCA 3O53A 2WQXA 2WQVA 2P1PB 3ULVA 2OMXA 3G39A 1Z7XW 4KNGA 4AY9X 1DFJI 1OTNA 5AWBA 3CIGA 3WPEA 3OJAA 3C6OB 1KOHA 2BNHA 1IO0A 1YRGA 3ULUA 4Z61C 4B8CD 2ASTB 1QYYA 2Z66A 5HDHA 2YA1A 4FMZA 2OMVA 3RFSA 3SB4A 4LXSA 1U0ND 4V2CA 1O6VA 4KXFB 3ZYJA 4AQ1A 1FQVA 4U06A 3ZYNA 3WPGA 1LTXA 3WPBA 4MN8B 1DCEA 4K17A 4KT1A 3FAXA 5ICUA 3W3MA 3RW6A 3RJ0A 1PGVA 3RGZA 4PKIG 4LSXA 2OMZA 4RCAB 5GS0A 3UN9A 1O6TA 3VQ1A 4H09A 2ID5A 5GQRK 2UZYA 2CA6A 1P8TA 4AW4A 2OMUA 4Q62A 2V70A 4EZGA 2Z63A 2JE1A 2Y5QA 1W8AA 4R58A 3UL8A 5IYXC 1M10B 3DZEA 4V2EA 5GMFA 2A0ZA 4BSRA 3GOZA 5HZLB 4R09A 3W3KA 3A79B 4LSXC 2JE0A 4XGOA 4CP6A 2UZXA 4ECNA 3RFJA 5B0NA 5GMGA 5CMPA 3E6JA 4P8SA 4Z64C 4NKHA 3WPCA 1OTOA 2P1OB 2ASSB 5GS2B 4LI2A 2OMTA 3TSRE 3E3ZA 1M0ZA 2Z7XB 4CNCA 2Z82A 3OGMB 2C9QA 4LSCA 4XOSA 1FS2A 2BEXA 1XKUA 4CC4C 2IFGA 2O6QA 4R5DA 4R6GA 3P72A 4J4LA 3OGKB 4ECOA 1M9SA 2XOTA 4M7EC 3KJ4A 4PERA 1K5DC 1D0BA 4I6JB 1M42A 1XWDC 1GWBA 4GLPA 2FT3A 4FS7A 2P1QB 3O6NA 3OGLB 1P9AG 4FDWA 4BSUA 2Z62A 4BSSA 1OZNA 3ZYIA 4BV4R 4OQTA 4R07A 3E2JA 3C6NB 5A5CA 2C9RA 4WYKA 4MQWX 1FT8A 4U08A 1A9NA 4R6AA 4ARNA 3RGXA 4PEQB 4C2AB 1H6TA 4PQ8A 3ZYOA 3WPHA 4NKGA 1K5GC 4FHOA 4R5CA 5AWDA 1LYQA 2RR6A 3JB9j 3CIYA 1IX2A 4RWTC 4WP6A 3WPIA 4HQ1A 5CMNA 2Q4GW 3CVRA 2C9PA 4RCWA 4Q3GA 3RW7A 3G3AA 3W3LA 1OTMA 5IJDA 4U09A 4J0MA 3M19A 3W3GA 2JQDA 4LXRA 3G3BA 2O6RA 4C2BB 1SQ0B 4R0AA 5AWAA 3UL9A 5B0TA 4V2DA 5LFNA 2V9SA 3REZA 4CNMA 1ZIWA 4Z8GA 1OGQA 3G06A 4R6JA 4FD0A 2R9UA 1O6SA 3UL7A 1XECA 4UFRA 1OOKG 4P91A 1A4YA 4PSJA 2OMYA 4GT6A 3W3NA 1OT4A 3G04C 1DS9A 3BZ5A 1WWLA 5B4PA 3VQ2A 1P8VA 4R6FA 4Y61B 2Z64A 3PMHG 2RA8A 3WPFA 2Z81A 4QBZA 3RFEA 3RIZA 4ARRA 2Z7XA 5FTTB 1FO1A 3WN4A 1G9UA 4Q3IA 4L3FA 2WQUA 4G8AA 4CILA 4Z79A 3FAWA 4L3AA 1H6UA 4IM6A 1XEUA 5AZ5A 3OJAB 2WFHA 5GMHA 1KOOA 4TZHA 1M9LA 4R08A 3BCDA 5IJBA 3C6PB 4LI1A 4QXEA 4U7LA 2Z65A 4FCGA 5IJCA 3BC9A 2O6SA 3E4GA 2V9TB 2OMWA 4XSQA 2P1NB 3FXIA
chains in the Genus database with same CATH superfamily
1AY1H 3SDXE 4Z8FL 2ZUTA 4L8BB 1XB8A 4YHNA 3MV7B 4TUJB 4R0LA 2BJMH 4I1PA 4L9DA 4KFZC 43CAB 4EKJA 3F2LA 1K9TA 5CN3A 5JW4Q 3V5DB 1JGUL 1QFWH 3WFHA 3RGBA 4RIRB 4UV4H 4HLJA 3QDMD 2XBDA 1GGIL 2WJ7A 1NINA 3BOVA 4KNTA 1E5UI 5CUSH 4ZMAT 5L2KA 4OTXL 2HLFC 1IC7H 1NAKH 4I5BA 4B9IA 2GJPA 4LOUC 3QUKB 4IQHA 2O61B 4D0CB 1MFVA 2OYMA 3TWCL 3WFEH 4NBZB 1OCWL 1MVUB 1DSYA 4UQ9A 3RNKB 4WFEE 3BDYH 4JO2H 3B2DC 4KXDA 2A73A 3PNRB 5GGQL 1X4ZA 1FL5B 1IBYA 2EIZB 1JPTL 4KTEH 2YMTA 4NKQB 4ZQKB 1G9EA 2DH2A 3DWTA 4WW2F 2O5ZH 3NZ8B 1T1YB 1UD5A 4Z3GA 3QDAA 3RBGA 4D0BA 4X4XA 1BZ7B 1ZVNA 3BAEL 5D1XD 1YJDL 5AWBA 3OKNB 4NKMB 3HAEB 1UYWH 4XXCA 3QG7H 5IJBC 1IO0A 3G6AB 3PV7A 5DO2D 4TUOB 4MKTA 3QG6A 4FYRA 3TFKC 3SOBH 1HIML 5EO9B 1AD0B 1B2WL 5I6LA 4XNYL 4N0UE 2CDGB 1FRGL 5HPOA 5G4NA 5C0EA 4WO4D 2A9NL 4P3DA 2V9TA 4MLSA 4O9HH 5TPWH 1O9ZA 4KK6D 4PGCB 5GQBA 1L3NA 4G8EA 2CH8A 5FKPA 4PGBA 4LXSA 1RVFL 2WXQA 5AWNL 2Q1EA 4Z7NB 1X9LA 1O6VA 3QQ3B 5MERB 1OPGH 1RUAH 5I1IH 2DQFB 4FF9A 4FQHB 1IAII 4DH2A 3PJSA 2X7LB 5DJ2B 3SGKA 5I6OA 2PLTA 4N87A 2V0AA 4UILL 3FTWA 3EUDA 4HAGA 1AR1B 4FMFA 3PV6B 1ADWA 3BKYH 3BESR 4Y9BA 2PXYD 5E9DA 2OX5A 4JJ5B 3SDXB 1ED3A 2J2ZA 5IREA 5LDUA 1L3WA 3HLAB 3SYQA 5A16A 5IROD 5DC4B 4JG0H 3GSXB 1YDPA 4R4FL 2OV0A 3WPBA 1PCXA 2HMID 2ZCHL 5FF6A 1ZK9A 4HIIA 4J3OH 1F90L 4K17A 3VW3H 1J8RA 4YPGA 1AZVA 1X7QB 1A21A 1RFDH 1YEJL 3A5VA 4MMXB 3R7RA 3VGEA 4ENZA 5GHWL 5BZZA 3MCKB 1EUUA 3RGZA 1KTDB 1NKGA 3CVHH 5D7KD 4WENB 4Z77A 5B4MD 1HKFA 2E9WA 4NN5B 4CJ0A 2J4WL 2X09A 3CPUA 3N85H 1PZSA 4OFPA 2VJXA 1QSED 1SEQL 2BIHA 1J5DA 1XF5B 2CA3A 3ILEA 3HN3A 3S88H 2QTVA 2VZOA 3L1OL 3TZVC 3P9MB 4FXTA 5CEYB 4U1KA 1QASA 1NDGB 3BQUA 4JO3L 3ZT5A 3GS7A 1NPJA 4DK3A 2V9RA 3PRZA 2ADJB 1CQKA 4HXAL 3RL2A 4W1TA 3H9SA 3ZDXF 4E0RB 4OLUL 3QZWA 5F7FA 4LRNL 4LEEA 1E3ZA 1Q94B 2XV6B 3GMQA 3LXUX 4FN0A 4E41E 4ZMWA 1CICB 3O4OB 3N5AA 5DHMC 1BEXA 1GC1H 4LGPB 1VCAA 4N0UB 4G72B 4H8HA 5I1LB 1EGJL 1HCZA 2FYVA 4XN2A 4R58A 3ZZLA 5IR1A 4QY8B 1OM3H 4JFXB 3UX9B 3AY2A 3DZEA 5CBEA 3MLUH 4N2AA 3V4LA 1UH3A 1Q1JL 5HDWA 4D9RD 3QRGL 4PVBA 3J27A 2WWKT 3GOZA 1ET8A 4JPWH 4U1NA 1MCBA 4FQLL 4NWTL 3L17A 1QWUA 1XGYL 4FYQA 3RWHA 5IOPB 5D7IF 5IG7B 2JE0A 2V7NB 3EYVB 3KCWA 3QUGA 5IWLC 2BPBA 5AEAA 1ZHNB 1WEJH 2IIJA 3H3KA 4UWQB 3W39B 2XVLA 1EHLL 5B3NA 2N1TE 4PB0H 1BZQK 3EOTH 4JFOB 5JHLH 3C87A 5CSZB 1SLWA 2IVFC 1K2DA 3DJ9A 1R5WB 1MQ8A 1J9SA 3L3JA 1HAUA 3PGDA 4G1EA 2XIBA 1I8LC 5KYUB 3MNVB 2CKBL 4X6FB 4ZFFB 3PWPD 2DPKA 3EF4A 3NCBB 5DJAB 1KTJA 4TNFA 1KB9K 4KMTH 5INCB 1DL7L 1QNZL 3GINA 4KTDL 1KCVL 4KTYA 3RDTA 1HZLA 3LB6C 2CIKA 5J13C 1JVLA 4CC4C 3F7QA 5CEZE 2VISB 4N3UA 1PIGA 2QQNL 1XH3A 3VI4E 1VPOL 4GI9A 5L4IA 2O6QA 4JY4A 1L0PA 1YG9A 3UTQA 2F5BH 3OJMB 4JVUA 2WXMA 1NUGA 4N3TA 5IJVA 4RWHA 4UYPA 2MRYA 4RA0C 3Q06A 5I82A 1CDBA 5I0DA 1DR9A 3LPGA 3U4KA 2Y1ZA 3H9ZA 1PFOA 2NMSA 3AQZA 3JQOB 4DEPC 3AUWB 3ETBF 3IDNB 2EDYA 4GBXD 4LDCA 4ELKA 1N6QL 5BOZG 2Q5BA 3NACL 4E41B 4Y19E 2IAMC 4ANVA 3NJHA 5A7EA 1BF8A 1AOZA 3MLYH 4KQ3L 4N0CC 3O6FB 3ULUD 2P8MB 1TEGA 3WEOA 5CEZL 5EU4B 3WDIA 3CX5J 2I5YH 3B9KC 1DJGA 2R51A 4P2RE 3T0EE 3O6NA 2F74B 4IOIB 4JRXE 5HHPB 3T3MF 4KMQA 2EINB 1F18A 2GW5A 2NQCA 2UXTA 1V55B 3FFDA 4PJDA 5JPMB 2CKBB 1HOEA 4XCYA 3FOMB 4XHJC 2J73A 3IVKA 5CD5C 4R07A 4DGVH 3U46A 2XVGA 3GIZH 2F1AA 4G1MA 4QCIA 4WJKB 3V7AE 1XF3B 4JFQA 4ENEC 3U7WH 1GSKA 4PBWD 1J1PL 1F3JA 4P46A 4JHUA 3P9LB 2N4IA 3TT3H 1OB0A 3DUUA 2GTWB 2W60A 2HJFB 3I9PA 3AVEA 3JWDH 3JZYA 4XMPL 5DWUL 5DF0A 2CDGA 5D7SL 2WOBA 2KLTA 1UJ3A 4RQQB 4FNUA 2LTQB 3N1QC 4JK0D 3T0AA 4HS8L 2XV3A 4MAYA 1KBPA 2RHEA 4LE8A 3HG0A 4ZODA 2K0RA 4LARL 5HVHB 2E7CA 3KXFE 3QHZL 5I6XB 3WPHA 4MJIE 4AQ1C 1Z6JT 4M5SA 1HQ4A 4TLUA 4H1LA 2FO4B 2XZQL 4MA7H 4E42B 5LXGH 1HCVA 1ID5I 3TN0C 4Y4FD 3UPCA 3N1PC 2VWEC 2PYFA 3MV9A 2FAUA 1U8MB 2BC4B 2XPGA 4FHJA 3VI4B 2AP2A 4RFNC 1YNTA 2IWGA 1E9PB 1IX2A 5EBMA 3HLAA 4ZD3L 3SDDB 1VGEH 2ED7A 4GLRH 2LVCA 3C8HA 5F7DA 1RLWA 1EA9C 4YO0A 1VAHA 2NNFA 1A1NB 1C5DA 3NJMA 4M61B 4N5UA 4JM4H 5I2IA 1S2EA 1X7QA 4XAWL 2HYMA 3SGEH 1CE1H 1KTCA 1G4MA 1P5UA 1YMHB 2YLKA 4M3JA 5EZOH 5KS9F 1PTZA 1RJLB 2EC9U 3OKDB 4XVTH 1P84J 1EXGA 3AFLA 4Y19B 12E8H 2HPTA 4LHUG 3DVFA 1NC4B 3VE0A 3FW6A 2R0KH 3KS0J 3VQ1C 4P2RB 4C2BB 5FHAH 1F8TH 1CLOL 1TZIB 3P9MA 2BVPB 4JRXB 3VUAA 5IQ7L 1ADQA 4JDVA 3KE0A 3RGVC 1NDGA 3BHBA 5EF3A 4G82A 3LHPL 4CVZB 4H2AA 3LZFH 4L4VA 3P4MA 1A02N 3B2UD 3BGFC 3GMLB 4W9DC 1EWHA 1G9MH 3NIDE 4ONGL 3GZKA 1RU9H 3IMSA 4N8CL 4X80L 2H5UA 5D70L 2VXUL 4N0RA 5K9QI 2R1WA 4JB9L 5EMYA 3QJHA 3WY4A 3T8XB 1GS8A 2GBTA 3P0GB 1A47A 1Q94A 3MROA 5KBMA 3VFUB 1ZHLB 5DJXB 4KQ0A 3IF1B 3L2MA 4FFVD 1N8ZA 3CHQA 5GGUA 4Z23A 3Q43A 2JB6B 5C97A 4JUTA 3D2UD 3NK4A 3RTQC 4F7MB 3RUGF 2VDLL 4PRDB 5MP6H 2QKIA 4I88A 1IU1A 5HHQA 4LLDA 1HE7A 2YC1B 4FX5A 3KXFB 4JM2C 4MJIB 4YHIA 3F83A 3RA7H 2WVVB 3H4FA 1GZPA 4GRMA 1IM3A 4QRSB 1JNJA 1KJ3L 2RTTA 2AXFB 3B5TA 3QJZA 3EADA 3L6FA 4NM8H 5ELIA 4P91A 5IQ9B 4ODVL 32C2B 3EYVA 4Y16B 4F2EA 2FSEA 1ZWIB 3HMWL 3VQMA 1XIWB 1OP5K 3EZ8A 4RMQA 3VQ2A 4WFGE 4MXVF 3ARDD 3BIBX 1MY7A 2E47A 3UDWC 5ALCL 2K3HA 2VH5L 3EJSA 4XMLL 1PQZA 4JFOA 5EZJB 1JZ7A 5CSZA 2HFGL 4DN4L 5KVMC 1LDSA 4QBZA 4HKJA 1M7DB 1GHFL 2NZ9C 2XWJA 2NCEA 5IB4B 5F7AA 1HH6B 4ATWA 1FORH 1N7ML 3C6SB 4L29A 5H35A 1SXSA 4F58L 4J8RB 2VDPH 1S5IL 4ODHH 3WKNA 1FO1A 1NGXA 2H0PA 4APXB 4UF7C 5C7ZA 2OTWA 4Z79A 4HV8A 1ANUA 2V8LA 3QUZB 3UJJL 2VDLB 4ZMZA 2VR3A 1EXHA 1UVQB 3SGJC 5D6DC 2EDWA 3NIDB 3FO9B 4Q14A 1QHOA 4R08A 4F7PB 4NQVB 4AWJC 4NZ8A 3LKNA 3C6PB 2P48B 5DK3A 4ODSL 3MGTB 2OXGB 1P2CB 2Y6SD 5AFAA 3BC9A 1P4LB 1A3QA 3HZYA 4LT7A 4TQPA 2OMWA 1C5CH 3LQMA 3P77A 4NI6A 3WIHH 3IU3B 1JWUA 1U8NB 2WXGA 4HKBA 4ICXA 3NCJL 5DRXB 2WUCH 4ZTPH 4ZW5A 3N0PB 4LOUD 3APNA 5FUZL 4PRHB 3UO8B 3MU3A 5F8QC 2NQDA 4X4YB 3PNWB 2GFBA 3WPDA 2AITA 5JIKA 1SNRA 2MQGA 3S7GA 4UBDC 4OR1A 5DU7A 3BUBA 4QPEA 5IBUB 4D8OA 2GC7C 3B2XA 5C0AD 4IRSC 5C0NC 1I1AA 3LKSA 5JPMA 1XCDA 3KGSA 5IHUH 2Z8SA 3PAVA 3RAJL 4G9DB 3L3KB 5BVPH 4D3CH 1ND0A 4EUPH 2R56H 3MBEC 3GF8A 2XN0A 1CWVA 4APQA 1N2RA 2EIKB 2GTWA 1CURA 3V0HA 4K3JH 4CW1B 5JIMA 3TFKD 1HDMA 2X4OB 3V0WH 3G5ZA 5DD1L 5KANI 2PP7A 4M6AA 3GBML 4MA1B 1UB5B 2WQXA 4A39A 2Z31C 2R4RL 3VTMA 3WAKA 3ZT6A 1UWXH 2CWRA 5K69A 3ULVA 4XWGH 5FHBH 3K4ZA 4PVMA 5DI8B 4K9JA 3RGHA 3BE1H 1ES0A 4JGMA 4WEMB 4F57L 4LKXA 1VFAB 1YQVH 3MA7B 1VFBB 3MCLH 4Z95H 4PJEA 1DZ0A 5IMMB 4A7TA 1YECL 4S1QL 3O4LA 4L5FE 3DJZA 3QUMH 3DPBA 3J8F7 1ZPUA 3ARFD 5K9QG 1FVEA 2Z1KA 3DLQR 4ZUTA 4E42A 4JKPH 1IGMH 1EHXA 3S5LB 3GTNA 3OB8A 4Z7VE 3BX7C 3II1A 3WS3A 1CR9L 3EG9B 3F7YB 4EAEA 2Q7AA 3OF6D 5BUPA 3EFDH 4FQCL 2BC4A 5DJ8A 1R24B 3FN0L 2OMVA 1UWXK 2CK0L 3ECUA 1TTRA 1Z5YD 1G1YA 2EYTA 2HAZA 5E1HB 2Q7YA 4WNSA 4H8UA 5HDLA 4ZS7L 4TOYH 1GY2A 4H26B 4JY5L 4MQXD 3I02A 5MEOA 3SQOL 1LD9B 1HU8A 5L4MA 5E7FA 1CTNA 1TJHH 3MCYA 2BDNL 2JJSC 1RK0A 4DIXA 1AKPA 4N90E 1TTCA 4XH2A 3EO9H 4L5FL 4YWGH 1ETB1 3N9GH 5EIIB 3WLBA 3AACA 2QVTA 3BD3A 4HH9B 2Y1YA 2FECI 3ECQA 3NSDA 4TN9A 4KVNH 4JN2A 4BH8A 5BMFH 3UPAA 1IFRA 1A4KB 1F97A 4Z7IA 3TZVD 2DBLH 2NR6C 3T0EA 4BSJA 4JRXA 5G4MA 4NAQA 1B0RA 1NLBL 2CLVA 2X1XR 3CSPA 4PSPA 4BRJA 4ZXBA 5ICUA 4CADB 1CO1A 3GBLA 4ZUUB 3D25A 3GXDA 5CP7A 4JX0A 1J48A 3ALXA 1YMMD 4Z3HA 4XMKL 1A6UL 4FULA 1RUQL 5E56A 4RRPM 5IQOA 2MHAB 3NSFA 1BM3H 3IU4L 4XCCL 5EBWB 4OIBA 3C5ZA 5CR8A 1FDLH 3NFNA 1U41A 4W9FC 1JVOA 2D2CC 4LO9A 4MD4B 2OMTB 4UIKL 2D31B 3FPYA 3LNIA 1JYVA 1S3RA 2J6WA 5GQRK 4AYID 3WHXB 1VSCA 4JMXA 2X6MA 3CFTA 3HI6H 3WNLA 3O0RL 3FT3B 4PTUA 1CLZL 4KI5F 2JSFA 3WUWG 4EI5B 3HNSL 3X14A 4WCYH 1ID2A 2F68X 3GPSA 3KPMB 5E6ID 4AI7A 1RURH 5CIPA 3UAJA 4Z7VB 3JTBA 2AXFA 4OCLC 3ZE1E 2R1YB 1TJXA 2WXLA 4AQEA 3EOAB 5DLLA 5T3ZE 3IMBA 4KZDL 3T0XA 4DP7X 1T2JA 3BLBA 3TOPA 2XKSA 1FZJA 4RFOL 4EF3A 1NFDB 2L8AA 3OWRA 1N9PA 4NM4L 1M7XA 2VM4A 2AGJH 1QP1A 3EOYG 5E70A 4AIZB 3IGFA 5B1JA 5HP5A 3TFBA 3FO2B 4QGTA 3ZRFC 2YD3A 1JHKL 4Z3IA 1J8HD 5EC2B 3MRFA 3KDPB 3CFDB 5FCUL 1BHGA 2DDQH 4RAVA 5J06A 2I25N 2OL3H 5C07A 2F54A 3C6SA 2NY4B 5CWSA 1FZMB 3VGHA 1DQIA 1AO7E 1GW0A 1LP9E 4ZFZA 3GDBA 4C4KT 4F24A 1PSKH 1OAKL 3K2UH 5C08A 3DHUA 5LAXA 3LB6D 5T3ZL 4L3EE 3Q13A 4OD1H 1U8LB 4YNYB 5FK9B 3BFOA 5KANG 4EEEA 4GB9A 2L7JA 4OZFB 3VXRD 1GZQB 5GZOA 2Y7SA 3HI5L 3CQFA 4KY2A 2EDDA 3MRPB 2OXHA 1MG3C 1IUZA 3HHSB 4L0PB 2J88H 2OSXA 5FB8A 4JDZA 2L7EA 5EOQL 2O30A 4TNEA 5ISZA 2YS4A 4XC1L 2R27A 3EYUL 2B4CL 1Q9OA 2VN5A 3EH3B 4LFHD 5C0JA 2BEXA 4CVXA 2IAMD 1WDAA 1X5KA 2ZQKA 3HS9A 3X3GH 4DPRA 1HHJB 3HE6B 4XCEB 4N0CD 4L37B 4DP8X 4CC0A 1TETH 4QXUL 1EDQA 2DYPA 4R6GA 8PAZA 3CU7A 3VFRA 2X41A 2AQ3A 4HCRL 4XVJH 1OB1A 4YHML 4XCFL 3RNQB 5FAAA 3QQ9C 4HUCA 1SBBA 3GIVA 3CLFL 4L8DB 3C2SA 1SJXA 1QUNA 3GSQB 4XHJD 4TQIA 4Q4IA 2CIIA 3GLEA 1WPCA 1NQBA 4NFBA 4CN4A 5IIEB 5HDQL 4QLRA 1FVCA 3CH1A 4ENED 3ZE1B 1JIBA 1IGTB 2HN7B 4GLPA 2PCXA 1LE9B 2EADA 5DUJA 1ZHBB 4MCZA 1DEEA 4HHAA 3IDJB 1IEBA 3BFQG 4KNSA 3GJFB 2BP5M 2DBJA 4WKZB 4OD2A 3IDMA 3DX7B 1MQKL 3RWGB 4BKTC 4N5EC 2R8SH 2CGZA 4HUXB 1UB5A 3PDOB 4YGVB 1QG3A 5BRQA 4X5LA 5HGGS 4OQTA 4L3CA 3FHQA 1A6TA 3IMUA 3E6FB 5GGVH 1IE5A 3MFFA 4M1GL 1LM8V 2PWHA 4KUZH 1XWVA 3FO0H 4XN7A 4FFYL 3FO1A 4XBMA 4Q9RL 4IHOB 2Q76A 1AO7B 1LP9B 3IDIA 4I0KA 4P07A 4WI8A 4YZFE 2HRPL 5AOJA 5B39B 2HH0L 4TSAL 4L3EB 4ZPVA 2R0LH 1DFBL 2WLLA 5HHVH 1NGQL 4JGNA 4UM9D 3MRRB 2JTYA 2PR4L 4EDXA 1FFNA 2YUXA 2ZIDA 1NOFA 3FT0A 4Y8AA 1BQUA 3RFZA 3QS3A 4QD2E 1IFGA 1SUJA 5L88L 4YHYC 3QDMA 3C60C 1XH1A 5CCJA 3WGUB 3JUYA 5DZJA 4XOAA 4F7EB 3ME0A 1T6VN 3KVPA 4LCWE 1M2OA 2XCMC 4UV7H 4NO3A 3SO5A 3N1GC 2HTKD 1O6SB 3GFUA 4HH9A 2LU7A 1EAPA 3CIYA 2YPVH 3VFOA 4GSDH 4J27A 3IJSB 5DMKA 1NFIB 3VRJA 5CMNA 3VB8A 5HGHB 3HZMB 1TSRA 2C9PA 1DANU 2OSLB 1T21B 4BFNA 4H44C 4ZMPA 3FULA 1EBPA 3RGVD 3MYJB 3W3LA 2WBWB 1BGXH 5D1XA 1NDMA 1TJGL 1ILSA 1FZOA 2OKMA 2X28A 1U2HA 2HFEA 2ZAIA 4HP5A 4Z18A 1YEGH 4DGIH 3QO1A 3KYOA 4HJSA 1I1YB 5D2NA 5F3FA 4IKIA 4RMWA 2NW3A 3TJEH 2AJYH 4LXRA 2N56A 1T03H 1MFDL 1MXDA 4OZ4B 4WO4A 5FM4A 1KENL 1NSNL 3IJHA 1N5YH 1ULVA 4GQQA 4PV9A 4MJJA 1A0QH 4E36A 1JF6A 3KWUA 5AWAA 4XMUA 3KLAA 5KYWA 1CGYA 2LV4A 3B2VL 4IOSD 3RTQD 1Y07A 3PAYA 3WO4B 2QSCH 3QJQB 3GRWL 4U4BA 3TBSB 1HC1A 3L9RB 1YYLL 3KL0A 1IGJB 1V05A 5E4EC 3IFNH 3I2CL 3HJ0A 2GYSA 1F4WL 4H4NA 2BS71 3MJ8B 3V0EA 3WFDL 3BXNB 5A3IC 1D9KB 1L9RA 2GK0A 2PXYA 5C9JB 4LCIH 4CNMA 2ZUSA 2WZ5A 4GKSB 5IROA 1EX0A 1CDGA 4Y5YC 1XSOA 2V8MA 35C8H 1O5PA 3LYRA 3OR6A 4RGOH 3B6SB 4R6JA 4AEIL 4QHUB 2CDEA 2ERJC 4AE1A 5DD6A 1MIMH 1UXLA 4LAJH 1CTMA 4HXBH 4PGZA 1SDDA 5DD5H 3UZQB 1UZ8B 3UTPD 5D4QA 4XNBA 1PIFA 4BWTA 2B8OT 2DQHH 2LLLA 4MJ2A 4DKAA 2E4TA 3QR1A 2FEEL 3FO2A 2AFNA 1OAYL 4X2UA 4LSTH 2NZ9D 5EC2A 4IS6A 4LCWB 4U1JB 2JELH 5GRJH 1QSEA 4WZ9A 5JXAH 3DHPA 3VXME 5IQLA 4PSJA 1BX2A 5D6CA 3NRFA 4LSPL 3CHOA 2Y1VA 4WTZG 1HHKA 4N8PA 4Y1TA 3NCEB 4ELMF 2JCCB 5B4PA 4ALAH 1KBGH 3QEUA 1LO2H 1RPUA 2G9HB 4PYHA 4JHZA 4W9EC 3ULAB 1U8LA 5GGTA 2FYYB 1S7QB 3QVAA 4HOMA 3PMHG 1OXYA 4K8RC 4KAQH 1F4AA 4FZEH 5KSUA 2MQ3A 3MRPA 2DKMA 2BNQD 3C08L 3LIUA 1YNLL 3T65B 4IKKA 4WW2B 1GA2A 4DW2L 1UD3A 3VFNB 4Z5RB 5MI0C 3GK8L 4KJPC 2FZ3A 1CU4L 2V17L 4KKZA 1WJ3A 1IZKA 3PXLA 1XL6A 5K39B 3QWRA 5DFWH 4Q3IA 3U6XS 1NL0L 2DQJL 1ACZA 5GJSH 4FRWA 3AROA 5LVEA 5ADOH 4OJFL 4JO5A 4E9RA 4F8QA 3EO0A 3TV8A 5KSAC 2PWDA 2RR3A 3FB8A 1ZTXH 1QKZL 3KM2A 3K6NA 5I26A 3WJMA 4F33A 3OJAB 4IBYA 1QEWB 2WFHA 2I24N 1FNSH 2D0HA 4LL4A 3U79A 1A1MA 4YPJA 3VXOA 2RCSH 5ECJE 5C0ND 4IRSD 5AAMA 3DGCR 3RKDC 1DQLH 3HRZC 4N85A 4NI3A 5GS0L 5IJCA 3E4GA 1AANA 5L8JB 3IKCA 4LLMB 3QI9A 2FCBA 3HIZA 2EUVA 2XC8A 4ODTL 3UAEA 1G5GA 2HN7A 2ZSWB 3IJ8A 3MBED 5H4ZA 4X7EC 2JV6A 3FU8A 2RFXB 2KC0A 2ENQA 3GJFA 2E6JA 2E86A 2NY2B 3PGFH 3DXAD 2DLIA 1XZ0B 1JWMA 1T89A 2R0ZL 4Q89A 3PE9A 3PDOA 1N5AB 3PWPA 2CDFA 2MJWA 2Z31D 1SXNA 5GRVK 1JYNA 4JG1H 2YEQA 4I9WD 4P5TD 4R8WH 4DESA 1J0ZA 2LAAA 1YN6A 3RP1A 4PVNA 1FH5L 3CDFA 4F37K 2YHGA 3M88A 3VXMB 2EEFA 3VVWA 3W9DB 2N0KA 4L9LA 1JSYA 4I3GA 3A67H 4LLUA 1FWXA 3QEQD 5IB1B 5AWCA 5IVZB 3ZIMA 1RSFA 1GJUA 4PN6A 4XZUA 1VB9A 3Q2WA 1PL3A 3U4AA 5KYYB 4Z7UA 3W5NA 3FCSA 2FHCA 3TBYA 2WQVA 3LKQA 4MJ5B 1EFQA 1THAA 4XXWA 3ROOA 5B8CC 1KGXA 4OJEH 4GBXA 3S3CB 2QZQA 2AEPH 3FSAA 4R7NA 3UTTD 3OXSA 3VXQB 3DRTB 2WXRA 3KPOA 4PU2A 5BZDB 2BNHA 3X12B 2PW2A 2ZG2A 4DUXA 5AYUL 4PR5A 1LE5A 1IGFH 3WNMA 3ULUA 1NJ9A 1O7SA 4G5ZH 3KWXA 1BQRA 5J6GB 4P2CG 4OLWH 2Z66A 1BQHG 1M53A 4NHCH 1DBKH 4LHQB 4X6BA 1UG9A 2DAVA 4JN1L 5JDSB 1CT8A 5D7LD 2P44B 3CSTA 3I50H 4H20L 2NXYB 5DEFB 5EIVA 1U0ND 3DSFL 4D94A 1TZGL 2OSLA 3T3ME 3WN6A 4XBGA 4NIKB 3VFGH 1PGRB 4XRCB 1YPZE 2X87A 5DHXB 4GMTL 1HSAA 4X7DC 4MNGA 4YUEL 1P9MA 4XNUL 5BV7H 3VFSB 7PAZA 2IBGA 5I8KH 5G5DA 3CVIL 2JKJA 3M1OA 1M7IA 1JERA 3EYFA 3K6OA 5B1CA 3WD5L 3FH5A 4X5WB 1T0MB 1A2YA 3WTYA 3DTXB 4ZO7A 1OK0A 1LTXA 1UD4A 2GJ6D 2PO6C 1I9IH 4DTGH 4MN8B 2XQYG 5JA8B 1T80A 3E8VA 1JV5A 5TK4A 3FUFA 4J3OC 4BELD 1JHTB 1JXDA 2EAEA 2E7BA 2CD0A 1BFVL 1DVSA 5EFIA 1FG2A 2F19L 3CX2A 1MFBL 4Y4FA 1FUNA 3HPJA 1O9WA 4OF3A 4Q0XH 3KEHA 2EE6A 3CUPA 5I8EA 3DX0A 4RMBA 2PPCA 1RZJH 3SZKC 1FNFA 1U8KB 4EDWL 4JFVA 3HZ3A 4OI8A 5F3HB 4HIQA 5JLZB 2JF1A 4L0YA 4H09A 4Z78A 1EERB 1EJOH 4H8PA 1YA5A 4KK5C 4E9VA 4XNAA 3QUYB 3SKJL 4AENA 2XUWA 2EH8H 1VCBC 3CFKA 2IOOA 2ZXEB 1MJ7H 1NWPA 1ITCA 3C5SB 1DDHB 3LQAH 2XRAL 5KUKA 1X5AA 3ARGC 4K71C 4U1JA 5KS9E 4GI8A 2Q86B 3WNKA 5SX4I 4H5SA 3WKML 2KT6A 2WSDA 3CFCH 1GC1C 2OK0L 2JE1A 1KY6A 3BPLB 4UMSA 4U1MA 4X6EA 4Y2DB 1B4JH 2Z34A 4S0TD 3VH8B 2IF7A 3UIZA 4X8GA 2Z64C 3UMNA 1C8QA 2G9HA 1P1ZB 5LBSA 4ZW7A 3T3MB 5ACZA 1A9BA 4W4OC 4BSRA 3MNWB 3QDJB 1YPZB 3QWQB 1TR7A 3CBRA 3FCTA 2EEDA 2E8ZA 3HI1B 2NSMA 5EU3A 2C4XA 3T65A 2NX5D 3CN0A 4IBSA 5I5RA 3X2QB 3VI3F 1VKXA 2GBVA 1NMBL 2GB2A 1ACCA 1EO7A 1BFOB 2XWDA 4NPKA 4B9KC 2YEVB 1KBBA 3VA6A 2NY7H 3SBWC 3LN5A 1BG1A 1E8XA 4Z3TA 3D2UA 3U25A 4BXVA 3DURB 2YJQA 5ANME 3QO0A 1MW0A 2NNAA 4HQQH 2XZAH 4LSVH 1GCFA 3BUQA 5F96H 2YPLD 2BVQA 4JQXA 3W38A 2C9XA 1N59B 1UACL 3CZJA 2WM0A 3CZGA 3E8UH 5D71H 5IBLC 5T5NF 3RUGE 4MD5B 5DDHA 5CFHA 4M43L 3WLWD 5IB5B 3K91A 2DD8H 2P28B 1I3VA 5D2LE 4PW3A 3SEPA 3II3A 1IAKB 3L95B 5L0QC 1RUKL 4LQFH 4NQDE 3ZPDA 2CKNA 4N1EA 3M1CA 3TJHD 2ZOUA 3V0DA 3ARDA 4X7CC 1OWWA 1NPNA 4BBWA 3V52H 4OLXL 2L04A 5DHDA 4PREA 4GI6A 1HSBB 1KG0B 3KPQB 1N8OE 3P2TA 4GW5A 5JHBA 4M7EC 2WINB 4MXVE 4N5ED 3O2VL 1HTYA 2E74C 3AT9A 4N22A 4U49A 1NIDA 3BP5B 3L4TA 5ICXB 3ZTNH 3V9FA 1R33A 3NSXA 4XP1L 3K71A 4F91B 4K3EL 1JE6A 3QCVL 1KCKA 2CHNA 4P06A 2VXSL 4DQAA 1AGCA 4TNVF 5KS9B 4HGWA 3IFPB 2JH2A 3VXMA 4UT7H 1JXKA 5C3LD 3W9DA 5JW5B 2ZXCA 3BKML 4V1DD 3NCMA 1EHAA 5DJZA 2D3JA 2VLMD 5IVZA 3U36A 3HRPA 3L3DB 4FEIA 1B4LA 3MX0A 2Z62A 3WEBA 1AI1L 2H3NA 4JHWL 2D73A 1EUTA 4H8VA 1OZUA 3ZYIA 4KKCC 2XJKA 1S7XA 2VM9A 4BDVA 4KKBC 1IVTA 2Q0ZX 3MRMA 4OLVH 4UM8A 2B59B 2CG9X 3C60D 4GKLA 1DJHA 2AXHA 1KXQE 2QQKH 3V0VA 5IESH 3B2MA 4AK1A 1TJIL 5BZDA 1IKFL 2PCFA 5GS3A 3FTGA 1DBMH 1AHWB 3FHEA 5IJKC 4GMSH 4QO1A 3OHXC 1V8HA 4YHLH 5ECGA 2ZKXA 3VFVA 3Q8AA 1RKRA 3FPXA 4JZJC 3MLRH 4HS3A 4MDRA 4N8VG 3Q6GH 5ANMB 3WS6C 1SQMA 4R6AA 3ELQA 4WDIB 4ZO6A 4TQHA 1CE6B 3FU6A 3LEVH 1IGYB 3IGAB 5I15H 3LS4L 1OOAA 5I5IA 2MIZA 1KFAL 1O75A 2CCLA 3RUGB 3T08A 1FFQA 3CX5K 3K4DA 3BISA 1CGSH 1UH2A 1W91A 5CHNA 3MRDA 2XA8H 2DQEH 4O2FA 3ESPA 2DWEA 3T2QA 5D2LB 5FFOA 3I3DA 2PMZA 1Q9KB 1XZWA 4M5ZH 4OCYL 1U3HB 4NQDB 5DK0A 1DVFB 1HYRC 3INUL 3TNNB 1G7PA 3VGGA 3F8UB 1SN5A 2MNWA 5EH1A 3F64A 4E9XA 4BINA 2AVFA 2BSSB 3ARYA 5D7IA 3BP4B 3WPIA 3W2DL 3GB7B 1PKQE 2WLIB 5DRWB 3KLHC 2B15A 1FL6B 4Y4KB 4QRRE 3FU7A 2ESVE 4XBEH 4XR8C 5MENE 4NENA 1I9JH 1S7UB 5TGBB 5BO0D 2NQ3A 1JHTA 1A5FL 2ENPA 4N9GB 3ARFA 4XPFH 4YXKH 4IMLB 2BVUA 1C08B 2CR3A 4UOW0 2JMRA 4EN2A 5A3ID 3HAEH 3O0LA 1KGCD 1D5IL 4DKEH 2WSPA 1OE2A 4N24A 5I5MA 2EO7A 1KIPB 1QPKA 2OYPA 3GHPA 1EHNA 2OZNA 4QHKI 3DROB 1G7IB 1EEZB 3LZQA 4Z8FH 1A7NH 1AGBA 1DLHB 4AXWA 1OP4A 2P24B 5AAWC 3VGDA 4YHZH 4WWKC 1KEML 5EOTA 2V2XB 1I3UA 4QJ4B 4AOFA 1G9MC 2E6PA 1Y0LA 4X7TB 3I74A 3QORC 1IEHA 2ZWSA 5T3XH 1W6WA 1AACA 1AQMA 4GSUA 4IEFB 1UB6B 5DRZB 2V4LA 4KX9A 5INDB 4Y9EA 2H26B 4OTXH 1CF8H 3LNEA 5J5EA 5I5JA 2B2XH 2DW5A 3ZO9A 1IEAA 3RWDB 5FA4A 3S48A 3AAZA 3FUHA 3TZVA 1UD6A 1MFAH 1P84K 1NGWA 4TF4A 4ZPTB 5FW7A 2I9TB 2AVGA 3LPPA 2JCWA 3MKGA 1WZMA 3EHBD 4OUOA 3QXWA 4F15B 4LCVA 5FO9A 5DFVC 2HRHA 4M3HA 4K8RD 3MNWA 3QSKB 1YMMA 1RPKA 2VO5A 4KPHL 3QQNA 2EO1A 1EXUA 3CVDA 3HI1A 1KLGA 1K6QL 1EBAA 3GSNA 4U1LA 1XCXA 4IMKA 4ZMTA 1BVLA 1KSRA 4EIUA 2IH9A 4KJPD 1BFOA 2ZF8A 4UIMA 1NEZG 3QZOA 1HIMH 3QA3B 4OF8A 2CO3A 3FU3A 3G04C 1B2WH 3FTSA 1PKQB 5IFJB 5L4JA 1Q1PA 2A9NH 3MR9A 1X9QA 1T3FB 2F53E 3ETBJ 1ADQH 2K78A 4IKNA 1U3JA 4QRRB 5ITFA 2ESVB 3R0NA 2RA8A 3QDHA 1KYOK 3WPFA 5MENB 1JDAA 1UZ6F 3C6EA 5BW7C 2CPUA 3IGUA 3RKPA 5E6IA 4AYFA 1HHIA 2NTSP 1BQLL 4TVUA 3RKDD 4ZUSB 4OV5B 2VO8A 4HJ0C 5IWLA 4KI5E 2X4NA 1IL1A 1NKOA 4GUPA 5HGAA 2AMUA 5CJ5A 4V11A 2A6KA 1PZ5B 3VCLB 5DVNA 5AENA 4IM6A 2F6AA 3WKPA 5AZ5A 3IJ9A 4I89A 2B1OA 1K3IA 4LVEA 3ZL2A 3AS0A 3MRBB 3AREB 1KOOA 1YEJH 5AVZB 4PW9A 1J8HA 1I8LA 2I07A 1N64L 2VDOL 3V55A 2CUAA 1M71B 1F2QA 5E5UB 1XSKA 5ICXA 3IT8D 2V7HB 3BSZA 4GAGL 4FCGA 2IH1B 2PTUA 1NCAH 3U4BL 1JPSH 3ARVA 1QZ1A 2J4WH 4QRUB 3FBQA 4PY8I 1OTTD 1SEQH 2EXWC 1BOGB 5D7JB 5HHNB 4CC4A 1G84A 3PGCA 4GXVL 1JZGA 1OALA 4AYDC 1LK3L 2VN3A 2ZSVB 4L8CB 2L4OA 4RGNC 3RE0A 1AQDB 3VXRA 1AQKL 3QNYB 1NZRA 3FB5B 2P1MB 1PS3A 3VFPA 3L3DA 3CHXA 3D85B 2BFVL 4PVLA 1TQTA 4M4PA 5K1VA 3F12A 3CTTA 5LLIC 3STLA 5BJTB 2IQAB 3VD1A 2CR0A 5GS1B 5CF3A 3ZTJG 3T4YB 3C6LC 1DQDH 2GITB 2ALAA 2WTRB 3NSJA 3RWIA 1PJWA 3RB5A 4G2AA 2Z7WA 5C09E 2AF2A 1JFHA 1G4RA 5AB9A 3D12B 3NJJA 3L5XL 1IKNC 3GC3A 1W0VB 3KBHE 4ZOBA 1AHWA 4NXSA 1BIHA 1A22B 3QRLA 2ICES 4ZS6C 5AW6B 1EGJH 4UTCA 2HTLC 1WIOA 4WV1A 2F53B 2GG1A 3K6FA 4X7FC 3A6OA 1QR4A 1OPOA 2OJZL 6FABL 5J3HD 4GUQA 2C4FT 2VDOB 1Q1JH 3BUDA 3LX9A 1DFJI 1OTNA 3L3IB 3CBKB 2FUTA 4OFQA 3GHEL 4S10A 1IV8A 4HUNB 5EC1A 2ATAA 4JHAH 3TEUA 4FQLH 3V79C 1QQDB 1AR2A 1XGYH 2EKSB 2W1NA 4NNYB 4Z7QF 2COVD 3ZIYA 5IVNA 1Z7JA 2DTML 2EIDA 2FLBT 3SBQA 3T04D 1CL7H 3EH4B 3IE4A 1QBLH 5B22A 4HKZB 4LAQH 1EHLH 1HOCA 4GW4A 4XNXH 2YXMA 3GKWL 5CJOL 3H0TA 4HMDA 1HN1A 2C7UA 2PO6D 1F58L 5EBGA 4BZ1A 5J1AB 3RX7A 4KXFB 4NWUL 3MODL 2GK2A 3KR3L 2A83B 4J3OD 2VABA 2VXQA 4FXGC 4AQ1A 3EH1A 3Q1EA 2GAZB 4J39A 4PJAE 3T4AC 2UWEA 4OCNC 4P9HL 3NH7L 4IYKA 4HISA 1FO0L 1QNZH 1MIEH 4KTDH 3VD2A 3OMIB 4U3HA 4NN6B 5TDNA 4OZGF 1KIPA 4UM9A 4KHXH 2QQNH 1CFQA 1VPOH 4JLRB 1X6NA 2QSQA 4JKKA 2DH3A 1DLHA 4PY7A 4QXGL 5E99H 1WZ1H 5FO7B 3TU6A 1CC3A 3FAXA 3U83A 2EE2A 4ODWB 1ZK5A 3ULVH 4MMZC 4NBYB 4CNIA 4KK5D 5I19H 2V2XA 3VTAA 2X0VA 3ARTA 4LSXA 2ZKHL 3DYPA 4OSUL 4NAJA 5T1MA 3JV0A 4BV1A 2PPAA 3FQNB 3N43F 2VQ1A 5C09B 5JPNB 3SPVB 5DRZA 5INDA 2UV3A 2GCYA 3CVCA 3NJKA 2BNUA 4KX8A 1WHOA 5F89A 4QRPD 5A2BA 3US1A 3IJ7A 1KELL 5IUSA 5F1IB 5CEZH 1KNOB 3VQ1A 3QJUB 2WGNB 3WIIL 4G7VL 4GW1B 4X0KA 4G6KL 1QTSA 3RGVA 4J3VA 4HK3N 2DLFL 4KV5E 2YQBA 3P0VL 4KVPA 4GRLD 4ZMOA 4E5XG 2MQ0A 1G9NH 4MWFA 3BO8A 2ZKYA 3U9WA 3HBPA 1KMGA 2G5BB 3UBHA 1KBVA 5L7XL 1MI5E 1XF2A 5J9PA 4HWZA 1FO0B 4HUWA 1DQMH 1YC8A 4WFFE 4OIIL 1KJMA 1JZ4A 2VDNH 1KIUA 3P3SA 1BXXA 2NTFA 5IW6A 1R3IL 1XL4A 5HJGA 1G7MB 4L8SB 1NMAH 4WFHE 2WLNA 3ABZA 4EN3B 1BPVA 5IYXC 1MCPH 4DO5A 4IOSA 1HVXA 3RTQA 5D7SH 2D3VA 3L4WA 3MRQA 4MBOA 5ITBL 1CFBA 2MTAA 1JDDA 1FFOA 2DQ6A 2ED6A 1J05B 3ZMEA 2ENJA 3UZVA 5AOIA 2A74B 1I31A 4K7PX 4PJAB 1QYGH 1ICTA 3P73A 1MREL 2XZQH 4I87A 4XGOA 1GGUA 4JFEE 3RVWC 4O58L 2NY3C 3GSWA 3R8QA 5B0NA 5GMGA 4QNPE 1X3DA 4AGQA 4FKHA 3D34A 4ZAKD 1UWGL 2E5EA 2XWTB 3B8YA 4FMVA 2AANA 3KCPB 2AQRA 2BIIA 4ZD3H 3UDWA 4R2GD 1FNHA 4I0PC 2MPAH 4CVUA 2X42A 5MEQA 3T6XA 4W6XB 4K23L 3CZFB 4GLRI 4OGXL 3M8OH 4ETQB 1FGVL 3I9GL 5K1JA 5C0CD 3AQDA 4M6OL 1GMEA 4CNCA 1R3KA 1YEHL 2A9BA 3NPSB 1QPXA 2FJHB 4RGMC 1CFNA 5CIPH 2Y9RT 2YGNA 1IBHA 2IFGA 4PJ5D 2K1MA 1SHMA 3AG2B 5F6IC 2YWZA 4XMVA 1FP5A 5H2BA 5HHNA 1BZ8A 1FIEA 2CRIA 4ZI8A 3WIFA 1P7KB 1G87A 4HA1A 1A6WL 1DO6A 1VEMA 3GI9L 3R7QA 5KOMC 4W9LC 4ELME 2VL4A 5IQ7H 4ECOA 2FX9H 3HB3B 4U1IB 3SGJA 4QYOB 2BNQA 2F08A 1WA1X 3RJQB 1K5DC 4CAGA 3N50A 1MFMA 3FQ2A 3K7UA 2FO1A 4NPJA 1M05A 4KKCD 4N8CH 1TVHB 2QR0A 3QHTC 2ITEA 4HEME 4KKBD 5GS1A 4KUCF 1MI5B 3OAZK 3PWVB 2F61A 4JB9H 3A4FA 4KC3B 4OFDA 1JZ8A 2O72A 4PJFA 1CBVH 1U58A 4AH2A 4FQ1L 3WAJA 1E40A 2IFFH 1SJHA 1FYHB 4UT9L 4U6HA 1BD2E 5DJ6B 2YAOA 4V2BA 3OAUH 1DJXA 4UU9A 4XNZC 1ESOA 1S7VB 3I6KA 2VDLH 2GSGB 5JOPD 4AQ8A 4AVHA 4FLQA 4HUUA 2VCOA 4BFIA 2VUYA 4G83A 5HYJE 2HP4A 1C12B 1MH5A 1S78D 4FKEA 3MOQA 4IRSA 1NAML 3OSKA 1YEIH 3QQDB 3U1PA 5LWYH 4LGSB 3C6NB 4XZ4A 3VD4A 2J71A 2K9FB 1YEWA 1MZYA 2XICA 4HT1L 3BPNB 1E6OL 4JFEB 1XGTA 2WN2A 4F27A 3D69A 1KUMA 4Y5VA 4MQWX 4P2OC 2AQ2A 3LZLA 5F9AC 3RVTC 4PRIE 2I60H 2G2RB 3GMPA 3TX4A 3HMWH 3DXAA 3V0AC 1Y1DA 4DKTA 4ZFOL 1NCCH 4Z9KB 1SYSB 5E8DH 3G5YB 4PEQB 1X44A 4XMLH 2Z31A 1ORSB 2R83A 1CLYL 1XD1A 3HVDA 2ITCA 4HKXA 4M8QB 2JQZA 4P5TA 1HZKA 1N0XL 4GAJL 2Q6WA 5DK2B 4XN1A 4EVNB 1V3JA 4P4RB 5HVFB 2Z7UA 4Z76A 1N7MH 2BS9A 5SWSD 3RY4A 4ORGB 1S5IH 3HKFA 3QEQA 4G8IA 1JWSB 3U7YH 2R0WH 3LKPB 3GBNL 1LK2A 2JLLA 3OXRB 4U6VL 2E7MA 1RIHH 4K7PH 4WP6A 5KZCB 1URZA 3RBSA 5K9OB 1CG9B 3BH9B 3UJJH 4ELMB 4Q3GA 1C7SA 1VENA 1Q0XL 3B37A 1NAMB 3G3AA 3UTTA 1QRNE 2IGFH 1CQYA 3IGKA 4Q2ZA 2MSPA 1UC6A 4AYEC 3H6JA 4AUUA 3BWUC 1FLTX 3IKKA 1CCZA 2FT7A 3U4EB 3VMPA 2DJSA 4ADGA 3QORD 1XCTA 2ODHA 2YMOA 2I26N 1FHGA 2P26A 2JQDA 3IAQA 4A2MA 1PU0A 3NPZB 2H0FA 3HEIB 4B60A 1U8HB 1HH9A 2YQGA 2VDQL 5BS0D 1BD2B 3LMJH 4ZFOB 3QAZC 5FUZH 3MLZL 1TU2A 3PWUB 4OCMC 3U9UB 4N6RA 3EFFA 5JIPA 4U1GB 3V5KB 3S37H 3FMGL 3TPUB 4PW4A 2N7AA 1BQ5A 4NC1C 3RIFK 3ZKMD 1O7DE 3QCUL 4NRXB 4PLNC 5E1AA 3NBNA 5HYJB 3SE9L 2VIRA 1IC1A 4X5QA 4G8FB 5DFVD 2BVOB 5JW3L 1Y18A 3EYOA 5BJTA 2R1XB 1FO0A 5EOCL 4AQAA 4M9PA 3L7FA 5J89A 2M2DA 1FNLA 2W9EL 2GJ6A 2H1PL 4PRIB 1EZVY 3P11L 1OGQA 1HL8A 5DURB 1LWRA 3UOAB 3Q05A 3EGSB 1SVBA 4M7LT 1YC7A 4H25B 3H9YA 3GMOB 2BP0B 1JK8A 1ASQA 5DUBA 2R4RH 4UZGA 5AQ0A 3QFGA 2V9QA 4UFRA 1J05A 2PPDA 3LKRB 3W11C 4RA3A 3BEWA 5FKAA 1BVKA 4FQXC 4P05A 1WA2X 3UADA 4KOCA 4X5PA 1YY8B 1YECH 1X5MA 4S1QH 2J12B 1FVDA 4IIQA 4PQXA 1N12A 1UM5L 4KRLB 4OM1H 5ALBL 4ILDA 3UJTH 2Y72A 2A9AA 3WMQA 5CLWA 2VDQB 2FEDC 2JKSA 4P23D 1CR9H 1F45A 4HJ0D 3FRPG 1J0IA 3TBTB 3DNKA 5B1KA 4UTBA 1MDAA 4BIKA 5EZLB 2ZYRA 2CK0H 1P5VA 4HIXL 4HC1A 4O2CA 2ZX9A 5GRUL 4Y1AE 4RX4D 2AI0L 4WSJA 1QRNB 2HRLA 4HJIA 1U95B 3SQOH 5DT1H 4DP6X 3U0WH 2ZOKB 3KHOA 2GBUA 4G7RB 4S1DC 3MRGA 5CJQL 3ZL4L 1C5BL 1NC2B 2CAKA 1RZKL 4AEHL 1MW1A 2AJZA 2DZEA 1L5GB 3VWKC 3O8XB 1U33A 3SYPA 2OI9C 3S4SG 2H3XC 4DP5X 1MCWM 1G1CA 3IRCA 4PTTA 5GISL 1YY9C 4G8GD 3RL1B 2VZSA 3V8OA 5AUMA 1J5HA 2W92A 1IBBA 2G75A 3C2AH 4RGND 4TL4A 1ZS8B 4GO6B 2DIJA 1MWAL 1NLBH 2XWBB 4PJGF 2HKFH 1KBKA 2OPCA 5EU5B 3DYMA 5ILTL 1EZSA 4NLHA 3ARXA 2QFRA 2NX5A 3N1MC 4K3DL 3TTYA 4DGUA 1AOHA 3X1EA 1J7VR 1CGXA 1IAIL 3C6LD 3H6AA 4X9HA 1A6UH 4XMKH 1RUQH 8CGTA 4Y8DC 3UTSD 4JFFD 2J8UA 4HEPA 3B9DA 3MTXA 2QPUA 3R06A 3VG9B 5DO8A 3GGWB 5A1AA 3LEXA 1JRHH 4QC0A 2A6IA 2Y3AA 2ZOWA 2GUOB 4FKKA 4PJ6A 2DMGA 1GJWA 2YZ1A 4AJVA 4KVCL 1RZPA 1UQSB 4ZS6D 1QBBA 2YPLA 2FR4B 2P7TA 2HTLD 4IU3B 4N1CA 3IXAB 1FFPA 1XFPA 5FGBC 2GSGA 4OZFH 2AJSL 3SQBB 1GGTA 3SYOA 2Q8BH 4MA3A 1VLXA 3EFOB 3HUJA 4PJHA 2B1AL 2JJTC 1A4CA 3V6OE 4ODUB 4TS6A 2NYYC 3BJLA 3QFDA 2AJ3B 3HNSH 4P4KC 5DC9B 3KW7A 4XVUC 2VT0A 1ZV9A 1YUHB 5AG8A 2GSIB 1NGPL 3DRQB 4YBQC 2G2RA 5DTFB 3EBGA 1E8ZA 2XY1A 4PB9H 2JVUA 3HE7C 4ZK8A 1MWAB 3F62A 4Y1AB 4RFOH 4OCRL 4GFTB 1A9VA 4F5CE 5FECA 3LH2L 3QXVA 1OAZL 5BQDA 3Q6FB 3SCMD 3EDEA 1T2QL 5I1JL 2VZUA 3QXAA 1YRGA 2WWNA 2BCKB 4V1DA 3P30H 2YA1A 4UT9A 4CBZA 1SOKA 3O45A 5BZXA 4DN3L 5C6TL 4DO6A 2OMUB 3GJFH 4EUPG 5DEGB 1ZVHA 1VGKB 3A0OA 3IMRA 3F05A 3NDYE 3WE6A 2B0SH 1MAKA 2PYEE 5CR1A 1NCOA 5FYJE 3ES6B 2UXGA 1WF5A 4MHHI 5TDOA 5TQ2L 4OZIE 4C58B 1BJMA 3C60A 1QFPA 2ARJB 5GGRA 1IBGH 2MCG1 3WXVL 5I66B 4FG2A 3DECA 4HEMA 4QTHB 4TLKA 4XC1H 1LMKA 5BV7C 3EYUH 5I1HH 3S9DB 2B4CH 4GXUN 2Z91A 3OB0H 2DWDB 1RJYB 3WPGA 1IT9L 3GJFK 3JXAA 3MRJB 4F3FB 3FQWB 4KUCD 4HWBA 4FQJH 3NABL 4RISL 5JW4M 4BKLA 1DCEA 1E7UA 5I1CL 3U9UA 1EVTC 4HCRH 1UM6L 4PCKA 4RMUA 5FOBB 5FYJL 2FL5A 1FZKA 3CLFH 4HIHB 1ZGLP 5TH2A 3OB0K 1PPIA 3FONB 2A4CA 1KPUB 3REVB 5IQNA 3VGBA 5B7MA 5HDQH 4HZ1A 3F5WB 4RCAB 3W37A 1Q4NX 1WBZB 3KGTA 3IETB 4CMMB 1UT2A 4ZOEA 3A4DA 4JPKH 3QFJD 3L08A 1F41A 1O6TA 1UXSA 4PRIA 4X99B 4FLOA 3OKMB 4YVUA 1I75A 1KACB 1GYUA 2UZYA 1JTPA 1G5AA 5IF0B 4ADJA 3P4NB 2XFXA 3UBFA 2EYRB 4NZRL 2MKWA 2FATL 3GZPA 4WY7L 2A3TA 4C83B 1YYCA 4JG9A 1E8YA 3FUNA 4M1GH 5A43C 3OGCB 3SGKC 1YY8A 4Q4EA 2CBMA 4FFYH 4WEBH 4Q9RH 2Z93B 1QSFE 3ZW3A 3W0WE 1DUYA 4BFOA 5AYQA 5E4AA 4LHUB 1U21A 2HRPH 2K3TA 4X8JA 1TVBB 4TSAH 2IPUK 5DHVA 3RVWD 1M10B 1DFBH 2QHRL 5CXPA 4YSOA 3OQ3B 1NGQH 5EZIL 2ZXAA 4OFKA 4FOMA 4TULH 2XV2A 2PR4H 1TTBA 3RPKA 1VDGA 3SKNB 2GTZA 2PYEB 3D51A 4OZIB 3AB0B 4L23A 3H9HB 4S1SH 4YE0A 1GYAA 4R26L 1PBYA 3IJEB 3DO4A 3RY5A 4NT6A 3OAYH 1K72A 3OKEB 4XMXA 4B3VA 2FX8H 4ZDHB 1OAXL 3Q48A 4GT0A 5C0GA 5FYJU 4MNHB 1D5BB 1U2CA 1ZGLB 2XVBA 1DJZA 3RL1A 4HJGA 4LVHB 4OGAD 4FG0A 2KZBA 2UVFA 3T3PF 1KLFB 1K5WA 5FV2A 4LASL 3VXPA 1CYWA 4KKPA 4EZMA 5JNYB 2A1WH 2PP9A 3HZKB 2ZXWB 5T33L 2Z7XB 1TJGH 3F65A 1AKJD 2IADB 2V3FA 3WY1A 5C6WH 1KCUL 2F5AL 5JO5B 5HSFA 5AAPA 3FXIC 1T1WB 3TBVA 3CDGB 4FQIL 2PCPB 2C3HA 4FABH 4YDMA 1MFDH 4O51A 1MJJB 1KENH 1HT6A 2VLLB 4LBAA 3BIKB 3QK0A 3P72A 1VZIA 3V9EA 5J11B 1IB5A 1MRFH 1VJSA 4I4WA 2GUOA 3WY3A 1M9SA 5EOCJ 5IQMA 1UQSA 4GAYB 3ASNB 3B2VH 3MRCA 3IXAA 4P3CL 1F0LA 3D18B 1YYLH 4I3SH 1A6AB 1X7SA 4MHHG 5TQ0L 3VXSD 4GSQA 3J7HA 3KPRD 4JO4H 4LU5H 3DIFB 1KULA 3WFDH 2WWKO 4ODUA 1SJEB 2JLPA 1ONQA 4QRQA 3WSQL 1UZ6E 1BAGA 2ODIA 1QSFB 3W0WB 1BJ1J 3CZNA 5F7EL 4NUGL 3BMVA 3FK3A 1ORQB 5K9KA 4JDEB 3NFPB 4P2OD 2VDRH 4GUCA 3D7PA 1OP3H 4XAKD 1F3RB 2NT0A 1GXEA 5A2FA 4PJ7F 5J56B 1U9KA 2H1LM 2J1ZA 5F0MB 4XO3A 2V2TB 1U92A 1PNDA 5F1KC 1P4BH 3U9PH 2YSSA 5DUML 3S3BB 4PRNA 1MHCA 2CNZA 5E2VH 1OAYH 2QMKA 1BEYL 1Z3GH 4S1RL 1P7HL 3EGDB 5I30H 4WYKA 4RZCB 5DD0L 5HGDB 4BCZA 4GJTB 3RDTC 2DQTL 1OP3K 1AP2A 2WNXA 1MPAH 5CJXA 2Z6FA 2P5WE 3QUXB 3WMSA 5IKCB 4QRTA 4RH4A 4FTDA 5DQ9A 3CVBA 2WXHA 4NZJA 5K9JH 3DX6A 4M93B 3PAUA 4H88L 2HVJB 4NERA 5CSGA 4M8RA 5HHOD 3WL9A 4OD3L 5DSCB 5B8CA 4PP2B 2OTUB 1EFXD 1YNLH 3DKHA 5T1KB 4NKGA 4PWFA 3GUTA 1INDL 1HKLL 1IAIM 3GSUB 1LYQA 3GK8H 3MRNA 5C3TA 4MDIA 5EEVA 5H37A 4XPTH 2H9GB 4GPVA 3LVTA 1SJMA 2VLRD 1NL0H 4BSVA 2DQJH 3VI3A 5DR5H 1I7TB 3V4UL 1URLA 3H8NA 4DKFL 4F3FA 4PJIE 3LRKA 1SBSH 1S9VB 3E2HB 2EXTA 1QKZH 4RCWA 4PRAA 1FJ1A 3AJ7A 5IFHL 3DVNA 1BF2A 1KGYE 2LABA 5C0BD 1SXCA 1JK9B 3WHE0 1BQSA 1NCBH 1FBIL 2BIQA 2NY0B 4FTVD 3IGLA 1QABA 4Q6IB 1EEYB 4XNMB 1UCBL 1H8SA 4MA8H 3M7OA 1WIUA 4KKAC 4R90L 5AKVA 4B41A 2APSA 1KPUA 3K2IA 4ZMNA 5IMLB 4UZSA 4PJXA 3FFCE 1E9QB 1JD9A 5KN5A 5BXFB 25C8L 4ODTH 3O3BA 4YIQB 4R96A 1NANH 1QBML 1V7NL 4NIYE 2CHWA 2N01B 2PO6A 1I7ZA 4W68A 5JHDD 2DI9A 1RAMA 4K9EH 1I85A 2ATKB 3GS4A 1ZXKA 2R0ZH 2EYRA 3GO1L 3KLKA 4ZYKB 5F0LB 1T5XA 3TCLA 1ZA3A 2D7TL 3PL6D 5F44A 1OQOA 2HJKA 1F6LL 3A3YB 3W11D 5KBDA 3SY0B 3QIBB 5C0AB 3T2NL 1M1SA 1QEXA 3THML 3CVHA 1L7TL 2DQDL 4HFWB 1NGZA 4JW3A 4EI6A 3DHMA 3HCVB 1X5ZA 1FN4A 2Z93A 5EUOF 1X6LA 1AR1C 2X89A 2P5WB 3KJ6H 4JDTL 4LDLB 2CO6A 1TLMA 3FT4B 3DSNA 2YSTA 4L4TE 3VFWB 1ML0A 3QYMA 2VUOA 1RQ5A 2FEDD 4X98B 1NA8A 5E4IA 3ZDYF 4NRYB 4OZGE 1IIIA 2OA9A 5C0DB 7FABL 3MACL 3H4HA 1N6UA 1S9WA 1AS7A 1MLBA 1EK3A 3H9HA 3OKOA 1PX4A 2Y7QA 3ECBA 4IOFC 2X4RB 4ISVB 3ZKNC 4S1DD 1YJDC 4QRPA 5FM5O 1LQSR 2CRMA 1ZCRA 4LEXL 2R69L 3I9AA 4NN5C 3VWKD 1GKEA 5E2JA 3FU9A 4HBCH 4MNHA 4TKWA 1D5BA 1WWLA 4PJIB 1P8VA 1IO4C 5ESQA 1JZEA 3VYOA 4FP8H 5IEHB 2Z64A 1I8MB 3IMTA 4GRLA 1KXVC 5EBLB 1Z5HA 2H6PA 3TA3A 1TZGH 3JWOL 2Z81A 4WU5B 3RILA 2XTSA 2RB8A 3EJRA 3T6WA 2D4DA 5CMAA 1MVYA 4JPQA 1EDYA 3MRIB 3IEAA 2WVTA 2Z7XA 3WUWB 5F1NA 2WLYA 3MREB 3FB6A 3CVIH 2B1HH 3FFCB 3GMRA 1LO4H 4D2NA 4G71B 5KG9B 3SBWA 1JHLL 5ESVB 4RMTA 2OR9H 2PCPA 3E80A 4XOEA 3O4OC 3WD5H 3EJZD 1ZGLM 1K5NA 2AHIA 2C5DC 2M8XA 4JVPA 1H8NA 1I1FB 4Z1PA 1BSIA 1JNHB 4X9BA 4UQCA 3OJDA 43C9B 1W0WA 1P6WA 4JFDE 4U6YB 3PWLA 3B5HA 4NZRM 3O9WD 3Q3GB 4M48H 1CFTB 2VC2L 5JQ6H 3LIZL 1N4XL 3CC5A 1WTLA 4PJ8B 2KI6A 1P4IL 2F19H 1MFBH 4M6NH 3T1FA 4P2AA 4IJ3B 3GSNH 3KDMB 2NYYD 2A9MH 2QPFA 1QSFA 4MXWL 3D3VD 3D30A 4ZAKA 4P4KD 5C2BL 1JL5A 4XVUD 2JKRM 2HT2C 3HS0B 4TVPE 3SBRA 3TH4T 4BZYA 2FECL 1V5JA 1RHFA 4OZGB 1QO3B 3KJ4B 2M83A 3VQ2C 3PS6A 2ZXDA 1KCSH 1MN4A 5KVEE 4M7EA 2ATPB 3HE7D 3WFCH 5I0XA 1A14L 5C0CA 4YLBA 3DUSA 5EA0L 2VN6A 1ZA6A 1OGAE 1DHKA 5E6RB 4P2QE 3ZKQD 3NRQA 1F11A 3ZRSA 2I27N 3L48A 5HHMD 2EDBA 2ZUVA 1QLEL 3ZOAA 2CUHA 2JK5A 4NO0B 2BOCB 1D3CA 4AQZA 2BHUA 2OZ4L 2XG5B 3N43B 1C8PA 4LSUH 3QCTL 2NW2B 1KTBA 4TSCL 1RZ8A 4HK0B 1MRDL 4GXFA 1P7QB 3JTSB 4M4RA 4TVPL 3UTOA 4PIBA 2R2CA 5M7QA 1I8KB 3EJJX 3J07A 4B0MM 4JE0A 3M17A 1T04A 2VNCA 4NJ9L 2QFPA 5KVEL 4NP4H 5HI5C 3DVGA 5DFTA 5IV2A 4HWEL 2V6HA 4AJ0A 2VC2B 3MCG1 5DSCA 5BVJA 1IZJA 3TT1L 3O6MH 1PY9A 3BSZH 3U1QA 3WJJA 4CBPA 2MOGA 1NBVL 1NMBH 3MJ7B 3SE8L 2FWOB 2ASTB 5HY9A 1ZRUA 4YAQA 4N2DA 3BH4A 1J0HA 3QEHA 3S37L 1AG6A 1NLDL 5IJKA 2C3VA 2GY5A 3OHXA 2P80D 4NKIL 4JZJA 1XX9C 3TYGL 4V2CA 5ADPL 5BCAA 3QPQC 1QACA 1MLCB 5IB2A 4JFDB 1AE6L 2G5UA 5A2IH 1U8OA 5DS2A 5D96B 2FB4L 5JPMC 2Z4QB 4DT2A 2BNRE 1XGRA 4RDQG 5CILL 4LCUB 3TEWA 1QLEB 3GXIA 3DO7A 3HG5A 5ABAA 3NEOA 5CD3B 2EDTA 3HR5B 3E9UA 1JYWA 3GSRA 3KPTA 1I4FB 3W82A 2QV4A 2VSDA 2GT9A 2EVFA 1G0XA 2EECA 4TQEL 4K7FB 3LJ3A 1CN4A 4OLXH 1W9XA 4FADA 3N40F 1VF5C 4NZUH 2PPEA 5IHZA 2A2QT 5HGBB 3OZ9L 2JNZA 2UZXB 2AXWA 3O2VH 2Z92B 3B9KB 4HAFA 2BZDA 1SF5A 1JZFA 4FNLH 5KVFH 1OGAB 2OMZA 1EH9A 3ILPA 4P2QB 5SWSA 3NAAL 4HWNA 2NY1D 4HJEA 4MS8C 4XP1H 5HVHC 1S8DB 3SY0A 5I6XC 4QHMB 2I7OA 4WI9A 4LEOB 5FYKE 2VXSH 1OAUL 2YEZB 2YD9A 1JZIA 2W81C 3TXAA 2UUDK 4PUBH 4YH6A 2F7IA 1FAKT 1LEGB 1OW0C 2EH7H 3B1TA 3PPSA 4X98A 3M1BB 5IK3B 3KPPB 3ZU8A 3AWGA 1IIKA 4JFHD 2IDQA 4ANWA 4XO5A 3SDDC 1AI1H 3ASWA 4JHWH 4UDUA 5FA3A 4CSTA 3KAAA 4C59B 3K6DA 3M86A 3E1ZA 2ROXA 4S2SA 4PV8B 4XXDB 5IVXF 2JI1A 3WFBL 4Q62A 1G9NC 3QORA 3SQRA 3FDWA 4QIRA 1CI3M 1T22A 1W16A 3E6HA 4LHJB 1E9OB 3QAQA 5K33A 1CFVH 5F9OL 1WBXA 1CZ8L 1TQCB 5FYKL 4NZTL 2P49B 3BAWA 4UOW1 2WIIB 5BS0A 4E68A 3CD4A 4MDJA 3U0PA 2NNXA 3GHBL 3TO4B 3WV0A 2FBRA 1AS6A 3EBAA 3TN0B 1KXTB 3VDAA 1T66C 1HCFX 3T0EC 4N2OA 4DQOL 1NCWL 2Z35A 1WFIA 3BPCB 2A0ZA 4IDLA 4H8WL 1SHSA 2DL9A 4KITB 2ZNXA 3LS4H 4AKQA 2AEQH 5ID1B 4ZXBC 5T1LD 2VSKB 2BSTA 4HLZG 1CDJA 2WUBL 3S4SA 1C7TA 1PZBA 2BNRB 2KZWA 4ZMYA 1D7FA 4P5MB 3H9SD 5E2TL 1GGBL 4Z7WA 1T20A 4YDVB 4OCYH 4GP8B 4XVSL 1AXTH 3INUH 2V5TA 2HLAA 1K4CA 1ET7A 3W57A 1ZT1B 1OD7A 1XR8B 1KN2H 3MJGX 4IRZA 3GS0A 5DZOA 2YFOA 4YGAB 3UBXA 4QKXB 3OKKB 2B9AA 3OKLB 3X3FL 5GS2B 5SWZD 4AW7A 5KSBA 4J3UA 2FDBP 3TBWB 2BRQA 1H6FA 4J3SA 1KGWA 3SHSA 2VZ3A 1TZOA 5BW7A 3BZFB 3UPRB 1A5FH 4OM0L 1AHMA 3C8KB 1H3VA 2BFGA 3CFUA 4P0DA 4UQDA 4XOSA 4TPRL 3BGFB 2N0MA 4P23A 1FNGA 1G7JA 3NVQA 3REWA 4NYLA 3UAJC 3NJFA 4RMVA 4HIPA 3B3IB 4UQ3A 5EF1A 3F6IA 4FZ8L 4L4TA 3D33A 4ZMQA 2WYZA 1CGVA 5D4JA 2QVMA 5AKSA 1K8DB 1XIWC 4OZGA 4RX4A 4WAFA 1LWJA 3EJCA 3KYKL 4Y5XB 5FYKU 3KJ4A 3MGOA 3K4AA 4JFTA 1QVOA 3CDZA 2FJFA 1UT9A 1PLGL 4YDNA 1DLFL 3L16A 1AGEA 1G1KA 5KAQG 3OC5A 3WEMA 2DQUL 4JFPB 1A7PL 2DRUA 5ABDE 4X6DF 2YD0A 4A67A 4G8GA 3NYKA 4JM2B 4CMHC 4PWGA 4J28A 4N86A 4NO0A 5I74B 4LF3B 3V5HB 1J0KA 2CGYA 1K8IA 3WIHA 1CFSB 2QHLA 3QZWG 3RDTD 3R4DA 2DWXA 4A2DA 3U2SB 4C4KO 4NDMA 5MEPA 3T6QC 2EICA 1GAFL 1PKOA 3BN9C 3E1F1 4OZHF 3WN5B 2EQDA 4D0DA 1S7RA 1QTYT 2AQPA 3MV7D 4KKLC 4AT6B 4W9IC 1R3HB 5I1EH 1BCIA 1C1EL 1VFUA 2EDHA 3HPLB 4KY1L 4PJGE 5DYOA 5EO1A 1HEHC 4K94H 4JFFA 3UTSA 2W0FA 2XXFA 3BJ91 1Q9WB 2IANE 1AXIB 3CPLA 4M9OA 5TTRA 1IKNA 1Z5LA 1N26A 5A2JH 1E5BA 4XP6L 1MCCA 2GIYA 2FSDA 3BWAA 1G1OA 1BLIA 4YR6B 5AVRB 4JFYB 4KH9A 3PUUA 3D4GA 3FQXA 2CQVA 2HFFA 4JFDA 1E27A 1IC0A 1WAAF 2OJEA 3NP3A 4OT1H 4LCUA 1KEGL 1BQLH 4JFUA 3CFBB 4UQ2B 4CDHA 4KKAD 2OZ4A 2I9LB 1I3RB 1TCMA 4HOXA 2CLZA 3QXDB 4HS6B 4FFTA 2D0FA 4UNTA 4GINA 2BK8A 3KLSA 5ICYB 1SY6L 3RW7A 2AJVL 4MA1C 3O41B 3VTTA 1J1OL 2A77L 2HWZL 3SCMA 2IBZY 4XN9A 4HX1A 3UZEA 2Z92A 4U09A 4FXGA 4XPBH 2XTJE 3WI9A 4G42A 5AVQB 1HEZB 1A3LL 5GJTL 4Y88A 4GAGH 4UINH 2CXGA 3IE9A 2W88A 3U4BH 5BUGA 4QHMA 1TQBB 1RIUH 1DSFH 4XNQB 5AKTA 1BQHB 1SEBA 4XB3A 1AR1D 2A9DA 2B08A 4G80B 5ES4B 1RULH 4JQIL 2WQ8A 5CZVL 3OR7B 3ZK0A 3WTWA 2WPGA 4M7KL 1BWWA 5ID0A 1AQKH 1E50A 3MBEB 4DZ8A 4I48A 2EZ0C 1U8PB 3HBQA 3L4ZA 3VFTB 1U8IA 4JO8A 4ZMVA 2BFVH 4MMZA 1PEWA 4G6FB 4JCWA 3RFZC 4XPAH 3S0PA 3LD8C 4PJGB 4AM0B 1VADA 2IWFA 5SX5K 2BM3A 2KERA 3D50A 1ITBB 4XXDA 3KWWB 1A4BA 3HC4H 4UB0L 4WW1A 3TIDB 2R9HC 4IOFD 2C9AA 4NO5B 3VNZA 3WMPA 2IANB 4AVJA 6PAZA 4PGEA 3DOIA 5F6HI 3L5XH 3I3EA 2JWYA 2WIIA 2ADGB 4NQSA 3FQRA 4PJBA 5E8NB 1TKWB 2PTTA 3L5WB 4X6CA 3SJVE 3WTTA 5B38A 3P2BA 4QHNA 3GJEB 4UQAA 2JKTM 3BDXA 3N42B 1OY3B 1WVZA 2ZNWA 2VW6A 3V0FA 4AYMC 1EZLA 3VU1A 1B9ZA 5AG9A 2CJSA 4WFED 5I16A 3WDHA 3MOBL 5ID1A 2ADIA 4JCLA 1MCEA 2X4TB 5GIRA 3AW5A 2IPKA 5E1IA 3SDCB 1WC7A 1JPGB 1AD9A 5AKRA 3VG0H 4WTXA 3QFJA 5F1OB 2NUTA 3ZE0F 4ZUVA 3IWUA 3GDCA 1DS9A 1QW9A 3DC0A 3I6GA 4OCXL 5ICZB 3D0LB 4H1LG 4PWKA 3LN4A 2RQEA 1CICD 1KOAA 3GKWH 5E8OB 3LSOB 2GSMB 2IALA 5EORL 4Q8BA 3OKKA 3AGWA 3EJTA 5E95B 4ZJ9A 3X1FA 2AEOA 3WO3B 1D6VL 4X7SL 4HSAC 3MODH 2AEWA 2OCJA 2WXIA 3LQZB 1HILB 3NZHH 2XTJB 1BIIA 3E3QC 2ORBH 3OG6B 5F3BB 2MEJB 2ZPKL 3AQYA 3BZFA 3JV5A 3O3DB 1PAZA 2WWOA 2WB1A 3GUFA 1CB4A 1HS6A 1X5IA 3STBA 1FO0H 4EI5C 4OIAA 1D7BA 5IROC 4XBPB 2UVEA 4OU3A 2O5XH 4YXHH 2HMIC 1FIGL 2HT2D 3KWTA 5E1GA 1Q0YL 3FH8A 5F88A 4MCYA 2OTPA 4TZHA 1CUOA 2EDMA 3QYNA 1MCSA 4OJDH 3WJLC 1R3JA 5F1SA 3WENA 1CYGA 3PP4L 1BLNB 1OF2A 1WISA 2ZKHH 4CN1A 2UY7B 4OSUH 1QZNA 3LRSB 4G43A 4LEBA 4EJ1C 1Y7VA 2HUEA 2P52A 3WNPA 1UFUA 4NZTM 2FJGA 4D8PA 5BOJA 1E4WL 4K5OA 2NY4C 3NFSH 1HYSC 2B14A 1KELH 2APFA 3SJVB 1JXFA 2CHXA 1FL3A 2DIEA 3JWNH 2F7OA 3O3EB 4UTBH 3WIIH 2RA1A 3EW3B 4FEMA 1DJYA 2K8QA 4HC1H 4G6KH 4KWUA 1IVLA 1DVZA 1CIDA 4XOCA 1X5JA 3T3PE 1IC5L 1AKJA 5HI5D 1AAJA 4GS7B 4QRFA 3C9NB 3FRUA 1SMAA 1SYVA 4C56E 2EIJB 3FBKA 2XA3A 1X5FA 4QRAA 4L1TA 1HAWA 5KWYC 1BVZA 4GIPD 5CGYC 1R3IH 4BA8A 3RWEA 4TUKH 4NKOA 3V4PL 4P5KB 4E41D 2ZONA 3BVNA 3R19A 1PD6A 4QAMB 1E8WA 2WLKA 3TH3T 4K5PA 5MHSE 3FTZA 3HE6C 1LDPL 3O6FD 4CRPA 1AFVL 5ITBH 1OSZB 3K2KA 3Q5TA 2BH0A 1NCIA 5GGSY 5GSVB 1FNEB 3VXSA 3KPRA 2KLSA 3FQUA 3QPQD 5L8KB 5EEXA 3FZUC 3ARPA 4PSRA 3PIQB 3DJRA 4FI8A 3LRGA 3B4NA 5DQJB 3OG4B 2ZTBA 3L5JA 1A4JA 2WCGA 1UD8A 5LKNA 4XX1G 5IB3B 1ZEAL 3QI9C 4P2OA 4PRBB 2I9LA 1I1CA 2IPTH 4YBHA 5C0RH 5DC2A 2WYIA 3VFMA 5L9DH 1G7HA 5IMOB 2DYSB 1LL1A 3FB7B 1GGYA 4YZWA 4GY4A 2MCMA 3TGXA 3DMMB 5ICYA 2WBJB 2J25A 1E28A 4QAWA 3Q2CA 3FQTA 1ETZB 2GIMA 2IAAC 4G6ML 3O41A 2UX7A 4YDJA 4XODA 2H7WA 2VR7A 2O26U 2VLKE 2BX5A 4LCYB 4I8DA 1FGVH 3I9GH 4OUUA 4YFLI 4NJAL 5EULV 1CD1B 1GOGA 1YEHH 4U06A 2X70B 5I1KH 3ZYNA 2B4CC 1KC5L 1N18A 3NJXA 4ONHA 1ZVSB 2CXKA 4I18B 2IQ9L 2VXTL 3V4PB 5FUCE 3TF7C 2UY6A 4L9LC 1JF1A 4IBVA 3D9AL 2DQGH 4IW4C 4BQ9A 4BZ2L 1ZJAA 3MZTA 1G0YR 2YPVA 4LSQL 4MB5A 4N8VB 2VGLM 3WY2A 1NFDF 1QHQA 5HHOA 5CEZD 1M6OB 3SPJA 3OMZA 3QJFB 3T3PB 3ZJAA 1WCBB 1EFXA 4PRPE 4XXWC 3SDDD 1MFEL 1RJCA 3ABLB 4X42A 4CJ1A 4HD5A 1A7BA 2DKUA 2DQCH 2CK2A 3FYEB 4C56B 2Y7NA 1TZ8A 2VLRA 4ZUWA 1PZUB 1KIRB 4FQ1H 4XPHH 4RVBA 4MSWB 4M8VA 4UT9H 4Y19D 1WS8A 3D39E 5CINL 1UA6H 1MUJA 4OFYD 4G5AA 5C0BA 2KZKA 2V5SA 3QIWB 1NC4D 1ZSDB 3F6LA 4LOVA 4PG9B 2WANA 4P2RD 3T0ED 4FTVA 3DV6B 2IXQA 4GAFB 4YHOL 5I73B 4JRXD 2ALWA 1XAUA 1NAMH 1T7XA 5BRZE 1OCCB 3ZKSD 5E00B 3CU1A 1F6AB 1UOKA 3QWNA 1P9MC 4Y4HB 1WE5A 2G3ZA 2J6EL 4HJJH 2ZUQB 5EPMB 4WUUE 1DJIA 2Y5QA 3DPDA 5BZWB 1SVCP 2WZPD 4F93B 4EZKA 1JP5A 3P0YL 1RZGA 2F58L 3GSOB 2WN3A 1OARL 3MBXL 1OAQH 1QA9A 1JF5A 1Z9SB 1QR1B 1WIPA 5GMFA 2FD6L 2N3JA 4LP5A 3RPIA 5AW9B 3PL6A 1MNUL 3WO4C 2VLKB 1TQUA 2DEYX 2L7QA 2OQJB 4R7DB 5E8PB 1N0XH 1R5IA 1S5HB 4HH8A 1U3NA 3ZE2F 4GAJH 1NFKA 2GEQA 1TZAA 2K7PA 3QZNA 2EEXA 3O3DA 3RJOA 4Y4FC 3ISRA 3KXFD 3MDJA 3RFJA 4MJID 1D9KC 4KI1A 1S7WA 4JZNB 3CIAA 5F7MC 5DA4A 3Q0HA 3SE4A 3BRFA 3NGBB 1DQJB 3V7MA 4U6VH 1SJVA 5IT2L 5CLYA 5CJ8A 4WNQA 4Y16D 2FQGA 3U2IA 1L0QA 5HJ3B 3ZDYE 1QLFB 3BZ4A 1XIWD 4JR9L 4PRPB 1Q0XH 4FC3E 2ZOTA 5ETUB 3CK0H 3ZMNA 2BLFA 1Z9OA 1T7YA 1TYJA 4M29A 1ZHKB 3L8QA 1KTLA 4U6XB 1BMZA 3RU8H 4M7ZB 3TO2B 5J6HA 4QRBA 3LRSA 1XKUA 3VWKA 2E7LC 1XSJA 5E4EB 5DLML 1FPTL 4OBRA 1D6EB 1FGNH 1NEZB 3CLEL 3SYAA 3D39B 1KB5L 4LQ1A 1J5OL 3FOLB 4P9ML 5F9JA 2ZWZA 4ZSOA 2NXZB 5DS8B 1S9YA 4X9GA 1NCNA 5DJYB 4Y5YB 3BN9D 1EO8L 4R3SB 2Z7YA 3QUZD 4LKCA 4HPOH 5E08L 4YSTA 3B9VA 3CZEA 3SE9H 3AITA 1I8IB 1Z9LA 4NHUB 5BRZB 2H8PA 1MCOH 4F2MA 4I3RL 4KKLD 1HZHH 3FFOA 2AJUH 3ZDZE 3FSWA 2Y5TB 4WW2C 1T83C 3IS1X 1KT2A 3QH3B 5EOCH 4NXKA 1WBYA 3MRKB 1EAOA 4WUUB 4A2GA 5AOKA 4WHTA 2YXFA 1PD0A 2W9EH 4Q74A 4MX7B 3QIUB 2W95A 3P11H 2O4EA 3EDDA 2J56A 4YDKL 4AZ8B 4ETYA 1A1OB 1DANT 1QLRA 5C8JB 3O9WA 1LNUB 2J3SA 1KIQA 2DYPD 5CBAB 2WKOF 5IEKA 4QKTA 4JQXC 1AY1L 2Z3FA 4NQTA 2JJTA 2P47B 2FIKA 4XCNB 2BJML 2BOBB 1UM5H 3D3VA 2LFEA 2I32A 5ALBH 2WMPA 2Y25A 1QFWL 3S36H 2G2NA 2E4FA 3L9EA 1TO4A 1KB5B 5MI0B 2ZP8A 3PWJA 1XT5A 1HJBC 1JGEA 5CUSL 3G5VA 1NCUA 4IKJA 1H6TA 1HQRB 4PD4J 4BFJA 3HE7A 1CXEA 3HLKA 1C16B 3ZDYB 1NAKL 2JIXB 1GVIA 4IGBB 2J1WA 2AI0H 4WFGD 4E9WA 5KSAB 4P49A 4BQBA 4Z7OE 4J12A 3L4YA 1JGVH 3MV8E 4NRZB 5CJQH 1XCQB 1C5BH 4JO2L 1OL0A 3BPOB 4KTEL 4PP1D 1T5WA 3Q5OA 1SMDA 2YN5A 4OLYH 2ZYHA 3HRZB 2X4UB 4B9YA 3ESUF 1U8CA 3GMNA 1JL8A 1RZ7L 1AXSA 1E2ZA 1GH7A 1UYWL 5DMIH 1YYML 3QG7L 4MB3A 3ARBB 3ZHLA 4HSCX 3WNNA 1PF3A 4UAOB 4MLIA 4UOQA 3SOBL 3JTTB 2EZ0D 1VACB 2X2UA 4GEJA 4IRJB 3K6IA 4YDZA 3ATDA 4O9HL 2Y6SC 4ZNEE 3ZDZB 5EV7A 4JRYA 5SWQA 3MRHB 3R8BB 2ZOLB 3FSZA 5K1NA 3IS0X 2R9HD 1OPGL 2P80A 4U3CA 1RUAL 2DYRB 2J7LA 2YBRB 5I1IL 3G5XB 2JCCF 3PDDA 4U3SA 1JMXA 1MJ8L 4FLSA 1H3XA 4F7TB 1TZHA 4DGWC 4HU8A 3L4XA 1AGFB 5JORA 1G43A 2YZ8A 5FR3A 4X8XA 1RJZA 4KVCH 1AMYA 3G6JE 4MZIA 1EPFA 4K9EC 1NM9A 1FAIH 1JRHI 5C1MB 5JUEH 2AJSH 4PG9A 2R23B 3C09B 4JQVC 3TVMB 4HF5L 4Z0BH 3FC8A 4H7VA 4DZBA 2ZP9A 5E6SB 2V9SA 3CFEB 4FE9A 4F20A 4NGHH 4HYTB 3LV3A 2F7QA 3QQXA 4UANA 4WSGA 2E56A