4CC4A

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
265
structure length
262
Chain Sequence
ASESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSALSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
molecule keywords INLC PROTEIN
total genus 80
structure length 262
sequence length 265
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08191 LRR_adjacent LRR adjacent
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc4A02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4cc4A01
1M0ZA 3BCDA 3E6JA 2WQVA 1DS9A 2Z63A 5GMFA 1XKUA 3E2JA 1A9NA 4QXEA 2JE1A 3P72A 5GS0A 1M9LA 4P91A 3RGZA 3O6NA 3W3GA 2V70A 3JB9j 2OMZA 1PGVA 4M7EA 3W3LA 2OMXA 4U08A 2O6QA 5FTTB 1G9UA 2OMWA 2R9UA 3REZA 3RFEA 4B8CD 2OMVA 3VQ1A 4U06A 2JQDA 4Z61C 3W3MA 2Z66A 3WPIA 2UZYA 3ULAA 2P1NB 3CVRA 3WPGA 2P1OB 4RCWA 4XSQA 3OGLB 4R0AA 3ZYIA 1OOKG 4CNCA 2RR6A 2Z7XA 1NM4A 1FT8A 3O53A 4LXRA 4MN8B 4QC0A 5AZ5A 3WPBA 2C9RA 2BNHA 5IJBA 4PERA 4UFRA 2Z65A 5AWBA 3KJ4A 5CMNA 4YEBB 3C6PB 2BEXA 4QBZA 4R58A 2P1MB 4R6AA 4J4LA 2FT3A 2Z82A 2OMUA 1FQVA 1P8VA 4WYKA 4G8AA 3FAXA 4LSCA 4PKIG 1Z7XW 1JL5A 3TSRE 2Y5QA 4C2BB 1M42A 5A5CA 4TZHA 2Z64A 4R07A 3PMHG 1OTNA 2V9TB 5LFNA 1O6VA 4BSRA 1A4YA 1K5DC 3E4GA 2OMYA 3FXIA 3A79B 3M18A 4FMZA 4H09A 4L3FA 5GQRK 3VQ2A 4ECNA 3C6NB 1KOHA 3RIZA 4GT6A 3RW7A 3ULUA 4P8SA 1XCDA 5HDHA 5GS2B 1K5GC 4R6JA 4Z94G 1IX2A 3BCFA 1FS2A 1SQ0B 4Z8GA 4XGOA 4CC4A 4KNGA 4ECOA 3G06A 3WPHA 5B4PA 3RJ0A 4R09A 1P9AG 5AWDA 3RW6A 4BSSA 4U09A 4FHOA 4L3AA 5D3IA 4LSXC 4WP6A 4NKGA 1U0ND 4Z79A 1KOOA 4LI1A 3UL7A 2ID5A 1OT4A 4LSAA 4Q62A 1M9SA 3FAWA 4Y61B 4FDWA 3G3AA 2XOTA 1H6UA 4V2EA 4OQTA 5B0NA 4LSXA 4HQ1A 4Q3GA 3G04C 2C9QA 4CILA 2XWTC 2OMTA 4Q3IA 4AY9X 3E3ZA 1OTOA 5ICUA 4GLPA 4KT1A 2YA1A 1OTMA 4LI2A 2CA6A 1LTXA 3SB4A 4ARNA 2Z81A 3G39A 4IM6A 3GOZA 4I6JB 4PEQB 4PSJA 3OGKB 1GWBA 5CMPA 3W3NA 3ZYOA 2Q4GW 2A0ZA 4AQ1A 3UN9A 1DCEA 2JE0A 1OGQA 3W3KA 2O6SA 4U7LA 3DZEA 3RFSA 3OJAA 4CC4C 4BSUA 4ARRA 5IJCA 3WPFA 4NKHA 3CIYA 1M10B 3UL8A 2UZXA 3ZYNA 1WWLA 4BV4R 3CIGA 1W8AA 2P1QB 3WN4A 1IO0A 2WFHA 4M7EC 4J0MA 5AWAA 3C6OB 4R5CA 3UL9A 1O6TA 2RA1A 1QYYA 1XECA 5IYXC 2WQWA 2O6RA 4CNMA 4R5DA 2IFGA 4EZGA 4R08A 2WQUA 1D0BA 4AW4A 2Z7XB 4V2CA 3ULVA 2WQXA 4FD0A 4XOSA 4V2DA 1O6SA 1LYQA 3BC9A 5B0TA 4KXFB 3WPCA 3W3JA 1P8TA 1XWDC 4K17A 1XEUA 3WPEA 4R6FA 5GMHA 3M19A 2Z62A 1ZIWA 4CP6A 4FCGA 3OJAB 4PQ8A 2ASSB 2V9SA 1OZNA 5HZLB 2C9PA 4RCAB 4FS7A 3ZYJA 2ELLA 5IJDA 1H6TA 4LXSA 4RWTC 3BZ5A 4MQWX 3RFJA 2ASTB 4Z64C 5AWCA 3WPDA 2P1PB 1DFJI 3G3BA 3OGMB 4R6GA 1FO1A 3RGXA 5GMGA 4C2AB 1YRGA 2RA8A
chains in the Genus database with same CATH superfamily
3GHPA 3C9NA 1TVHB 1P6AB 3UYPA 2DL2A 1HSAB 3FL7A 5DRXA 3OQ3B 1CCZA 2OTUA 2AHIA 1MIEL 1L6PA 2GC7C 1FZJA 4N8UA 4OF8A 3RA7L 2QZ5A 3QRGL 5FO7B 4TNWK 5E6IB 4W4NA 3T6WA 3PWNA 5ILTL 3WSQH 1BAWA 2CR6A 4QRRD 1T2QH 1QI5A 4MTMA 1U6AL 2BWQA 5GJTH 1KENL 4PJBE 3C5ZA 2BC4B 3NRFA 5A2AA 2B59B 4NX0A 3D18A 1W80A 4XH2B 3UZVB 1FT8A 3U7YL 2GIXA 1GKOA 4PJEE 1NMBH 2XC8A 3FRUA 4HFUH 4I13B 4X6CB 3WY1A 4BUGA 2BEXA 4N0FA 1OB1B 3N40F 4JHWH 5HXMA 4LDLB 4XWOD 1W6WA 5LKNA 1WT5A 1KUMA 3TIEA 1EXHA 4B0MB 3DPDA 3HC4H 4UV7L 1CE6B 4OD3H 5DFTA 5C08E 1CLOH 2WINA 3TZVA 4OCXH 5TK2A 3HPLB 3PGCB 4DK5A 3MNVB 4ZNCD 4PCYA 4M7LH 3N85H 4IBLT 4F20A 5C0RL 4RQQA 3UBXG 4CN1A 2YWZA 5AOJA 4GUQA 3SE4C 1FNFA 3L3OA 2OYLA 1OD7A 4G5ZL 5DC2A 1TSHA 1TYJA 4Y5YC 1XF3B 3RI5K 1X7SA 2XQ0A 4MJIA 1OQXA 1GIGL 5SWQB 3FN9A 3P4MA 4GAJL 3O41B 4I3SL 4OR1A 3L3HA 5CN1A 2A83A 3JV4A 2EDWA 3ARZA 1U92B 3E8UH 3D05A 1KZQA 1QASA 4TLUA 3S37H 4Q3GA 3RA7H 3TIDB 4I0PD 4QXUL 4XPTH 4Q3IA 2AJZB 3U4BH 3L48A 4JPKH 3VXNB 1NAMH 4ZQTA 2OBGA 5HDBE 1DE4B 3QEUA 2YKLH 5IEHB 1QKZL 1NBQA 2VITB 3K8LA 4D9QD 4ES8A 4DFHA 3F7YB 1QSFD 2WCPA 1V5JA 4LF3A 4XB8A 5LBSL 5IHBA 1KELL 4FYRA 3QXDA 5DRZB 4HFUL 3G6DL 4OGAD 3UIZA 4TUJA 3RNKB 1E4KA 2EVIA 2QPFA 3V4VB 3G5XA 2DLTA 3GIVB 5AL8A 3T6QC 2EDEA 3EYVA 4AJWA 3QCVL 1PIFA 3QPXH 5ESQB 5IZ7A 3NEXA 3BAXA 4W81A 4Y4FA 3EOYG 4HD9A 1MVYA 3I74A 4FD0A 5DD5H 5IQ7L 3VFPB 2BP3A 3KR3H 4XI5C 2VCOA 2D2CC 3K4DA 3DX7B 3MBWB 4NCC1 2BS8A 4OCXL 3STLB 4JFEB 4GRLC 3UEQA 4AVKA 2BIOA 1GGBL 4WNQB 5HZLB 2YPKA 2XN9E 3CMGA 3F7LA 5CKAA 3NFNB 1FUNA 1H15B 4IRJB 1FV1B 4TLKA 4NLHA 4EI5A 1UJTA 4R8WL 3SO3B 4JR9L 1ZEAL 4KHXL 4PGDA 1DUZB 5AOIA 3OKOA 3LRKA 4ZMAT 4HJEA 3BWSA 3QO0B 3RWDA 3OC5A 4PTUB 2EYTA 4G8EA 1FZMB 2Z8RA 4Y16A 1HL5A 4P57B 1CFQB 3WMPA 4RNRA 4JPIB 1YEJL 2BSSB 3ARGA 4E9RA 2IGTA 3CCHB 3BVUA 4OV5A 4LLMA 1SBBA 3HE6D 2W92A 3A6CH 3N1PC 3O0LA 2JKTM 3F05A 4IM8A 3HBZA 3FCTA 5DMJB 4XO4A 2VAJA 3P9MA 1BJMA 3QZLA 1ZHKB 3EXLA 4L8CB 1XSIA 2P45B 2GBAA 2PABA 2Y0SA 3ARFC 3NIFE 3O4LD 4WCYH 4F2MA 5GSRB 2QR0B 2R1YA 4FFZA 2MCAA 3VQ2A 3MX0A 5IJVA 5TDOA 5J6HA 4HIEB 3TEXA 3NIDE 5BO1L 4H4NA 3BLPX 3H0TA 4FE9A 4AM0B 5CJXA 4Z7NB 4WHYG 1MHCA 4YDJA 3NMEA 2OPCA 1N64H 4K07A 1IE5A 4AV4A 3PP3K 4JKPH 2TRHA 3RFZB 2ZNWA 3BIBX 2IALB 2QPSA 1ACYL 4L0ZA 5LGHH 3HI6L 1A6PA 5L2KA 4RNRB 2OXHA 4EIGB 3BSGA 3OKLA 1AQ8A 1FJ1B 3G9VA 2WSDA 5BRZD 5GS0L 4N0CD 2GQHA 3OKMA 4MD4B 2VYRE 1TO4A 2RJMA 4PM1A 4A6YA 4A7VA 2W81C 3S5ZA 4WRLA 3VGDA 3EH1A 1TZGL 5J9PA 3QDJB 2NY6B 3D2TA 3U83A 2A6JB 1URLA 4YNYA 1QSEB 2ZCLH 2OSWA 2AXGB 3KE0A 4JPQA 3UFIA 5T1DL 3UL8A 2UZXA 4X6CA 4KITB 4EN3C 3MRGB 4S0TD 4RISH 3PAZA 1A7RL 3GI9H 4QHUB 2J57A 4MAZA 2VDRH 4GW1B 1OM3H 5A40E 5IP4A 3PLYA 1C12A 2BHFA 5KANG 4AZ8A 1EUUA 3ULVE 2EEFA 3B9VA 4JKKA 3ULVH 3O6MH 4N0RA 3U1SL 4KO9A 5DJZA 3H42H 1RZPA 4HD5A 4GFXA 2QGBA 2PYEE 5MHSD 4JLRA 2BSDA 3KJ6L 4RDQG 4RLDA 5CLXA 5KYWA 3ZKND 5J0BA 4APXA 4NLAA 5IOPA 1C8QA 4Z64C 4LLUB 3L54A 4PY7A 3ZQXA 1SFDA 5F96L 2DB8A 1A6ZA 5H35B 2EINB 4L05A 3L3IB 4G6ML 4PW4A 1HC1A 4JGUA 1NL0L 5FV2A 1KIRA 5IMOB 1U8MB 2YRLA 1AHWA 5T8IA 5TGBA 3GRGA 4GBXD 4PJAA 2BVQA 3I84A 2EIZB 2N59A 3MFGB 4AENB 2OL3H 1NCJA 4ZRGA 1PZ3A 4X7SL 4HAKA 4WTQA 4ZAKD 1DANU 2R2HA 4NQUA 2ZUVA 1KPRA 3WEBA 1J7VR 3O9WB 1TZGH 1JPGB 4W93A 3HR5B 2K6YA 2YEZB 2C9RA 1EO8H 5AVUB 3IU4L 3LV3A 5T33H 2VLLA 3GLZA 1VPOL 2OZ4A 5GZNC 3ARTA 5CEZD 3DNKA 4G1EA 5JYLA 2ZG2A 2Q10A 5E6RB 4NUGH 1IC5H 4MASA 3OM3B 3HUJB 4HZLA 5HJ3A 2CA3A 2YSSA 1NICA 1DQMH 5GZNA 2H8PA 4Q6IC 5C97A 3T3MB 4EPSA 2JIXD 5F88B 1WGVA 2F61A 5F72S 1OLLA 4FJ6A 3S4SB 4H8WC 4I0PA 1D5BB 4XNYH 4AQAA 1IC7H 1Q94A 3BGMA 4KC3B 1IX2A 4LIQE 1SOSA 2XG4A 1ROCA 3WNLA 4AQEB 5L8LB 1XF1A 4HUNB 1NM9A 1SEQH 1T5XB 3GGWB 5E95B 4WNQA 4N2BA 3HIZA 4KXDA 2EIJB 3SPJA 5B4MD 4APQB 4FQQA 1I7ZB 1XTLA 4MA8L 1TF4A 2DEYX 3HE6A 4GXVL 2P5PA 4HFWB 1JWUB 2Z8WC 5KUKA 4JFPB 1E28A 1WCQA 4WHTA 5AVSB 4LSXA 1L7IL 3MRBA 4N0UA 1BJ1H 1MN4A 1J9RA 5FS5A 2JIXB 3FO9A 2WBJB 3UPRB 5GGUA 1XR8A 4GLPA 4IKIA 4PTTA 3EDJA 1OKEA 4HF5H 3FFOA 4LMQI 1KYUA 3QORB 5SV4A 4IW4C 4N5UA 3IETB 3G9AB 1KBVA 4L4VE 4HAFA 1IBYA 1SM3L 4P5TD 1WAAA 4L29B 4UNTA 5LHDA 5JW3L 3SKOA 3CZSA 3T2OA 4A1RA 1HILB 4GMTL 5IVXF 4FA6A 3LEXB 1HHKB 2WLJA 3HJEA 4JGMA 1IV8A 5I74B 2O6RA 3GZKA 1ZANH 3HLAA 5T5FH 4MHHI 3OPZL 3FQWA 1NH6A 4M7ZB 2UZXB 3KZ8A 2BSEA 3N41F 1L6ZA 4LVNC 5TFSH 4FKEA 1PFOA 1RUAL 3MRDB 1BZ8A 2RFXA 1X7QB 4FS7A 3BP5A 5E1IA 2ZKXA 5T3XL 3D39E 4PRIB 2XRAH 2QV4A 3EGSB 5D4IA 1JGUL 3MNVA 5F0JB 2NY1B 3PXHA 3RB7A 2EDJA 4PWKA 3D12B 1CLZL 2NSMA 1CXEA 5SWSA 1OGTB 1FBIL 1OK0A 4YGVB 4KPHL 3HNSH 3M1BB 4YUEL 2VO5A 5DJ2A 2XTJC 4OD3L 1EHNA 3LSOB 1QBLL 3THML 2C9AA 4JX0A 1CF8L 3AGVA 3WFZA 4PJ7F 4O58H 3VRIB 4AIEA 2WXNA 3V0VB 2FEDD 2WWKO 1I1AC 5C0FB 2Z7XA 4M7ZC 4P5MA 2B15A 1L9QA 2GABA 3BE1L 5K39A 4BJLA 1JHTB 5TJWK 1KWGA 4IRJD 1XIWA 2Y25A 3LEYH 4M4RB 5JPNC 1XVSA 2OMUA 1LWRA 3B5GA 2YGNA 5LBSA 3ZRFC 3TSRE 1A6WH 4UUJB 3G5YA 2JXMA 4UT9L 5C09A 1JWSA 2FWUA 2ZG1A 2KPNA 2GAZA 2IPTL 5LGJA 2PO6D 3HRZB 4R7XA 1MSPA 4I5BB 4NO5B 1SLUA 4Z7QE 5FOBB 1U8PA 5ITBL 5LNDA 1RLWA 3GSQB 3RZCB 3BWUF 3QISA 4OZ4B 5HVHB 3MGAA 4ZOCA 1T21B 3A5VA 3HA0A 4KRPD 2ZICA 4KKAC 1U41A 4BH8A 4H8PA 3GBMH 1TJGL 1G9NL 1MFEH 4JLRB 4PJIB 4FG6D 3WKQA 2V17L 1LILA 4FXGC 4W4OC 1QI4A 2OJEA 1LP9E 5AOZA 3E6FB 3WHXB 5IFHH 4NC2B 2W9EH 1S7TA 3OJVC 5FW8A 1NAMA 3AREC 1KJ2H 3AXLB 4N2NA 1I7ZA 4AYBA 1GS6X 3VGBA 1QBLH 1WAAE 4Z7NE 1G1OA 2NXYC 2QQLL 1EVUA 2DTMH 4LNRB 1HT6A 1B0GA 5I1IL 2A77L 4JDVA 5FM5M 1QG3A 1JZ8A 5L88H 2QQQA 1EGJH 3QC6X 3ZT7A 4B5ZA 2VLKD 4R8WH 3RY6C 4XAWL 3DA0A 2CUMA 3AABA 4XCEA 5KBLA 1MJUH 1LE5B 3GSNH 2DH3A 4LVNB 3D51A 1A6WL 2WJ7A 4X50A 3ZTDC 4TUOA 2AQQA 4W9EC 5GPRA 1N6QL 3E8UL 1MIML 4I3GA 1BM7A 1LK3H 4P23D 1MCEA 2I7SA 3Q8EA 2UY7B 3C5JB 3LN9A 2GPZA 3FZUC 5F2FA 5DEGA 4NBZB 3OLIA 1GZPA 2YPKB 1U3NA 3WNMA 4UDUA 1UKTA 2I85A 5HJDA 4CSTA 3MA7A 3RPKA 3MLXH 3G3BA 3FXIC 4HUXA 3PJNA 2GT9B 4Y16D 2NY3B 3BMWA 1ZK9A 4QXEA 1RUPH 3QUMA 1IM9A 2V70A 3HPJB 5CM1A 4ODWB 3V5KB 1VERA 3VRLE 4PMEA 4DKAA 1TQUA 4WI0A 3W3MA 5BO1H 4LKCB 3BQUA 2N0KA 2F5AH 1WF5A 3D48R 1E3FA 2H5UA 1TTGA 3MRQB 4A6YL 1E4JA 4AC4A 4KGLA 1CLCA 4CBZA 3OXRA 1OAYL 3UZQA 1G6VK 5L2KD 2Z4QA 3SJVA 1XV8A 3QFJD 4HH9B 1ACYH 1QWUA 4PLOB 5EC2B 4QBZA 1QW8A 5JORB 1JZ5A 1N59B 1D5IL 2D3LA 3MO1A 1YG9A 4LAQL 3QDMD 2R69A 5CCHE 1MH5B 3TIDA 2JCCA 1ET8A 2B3IA 4XNQA 1O6VA 4XPBH 4CADB 5D7JD 1BMGA 2J55A 4MS8C 5CSZA 3E9TA 3HN5A 2QDVA 5E24E 1N6QH 4LCWA 1P7QB 2FBJH 3FRUB 2NQCA 3G5VB 4Z94G 4DCQB 1IM9B 3G6JF 1M1SA 1KTDA 2BJML 3HUJE 4P46C 2C7UA 4U09A 1INDH 4BSSA 1WQVT 3WTXA 2XCMC 2HMID 4ZO8A 2ZKHL 4I4WB 3QDMB 1WV7T 2YD7A 2F7PA 3NPSC 2Y2WA 1H6UA 1XFPA 2NXYB 2OXHB 3OXRB 3U1SH 2Y2YA 4CVUA 4GG6E 2XACC 3C2SA 3V4UL 2GHWB 1ZHLB 1XIWC 3LKSB 4U6VL 4FFZH 2CJTA 3E1F1 4GRLA 2BWIA 2AAVA 1BJ8A 5CJQL 4A2LA 4HALA 2AQ1A 1KPVA 3U0TB 3UP1A 5IWLA 1OQOA 1S7XB 4L9LB 4MQXC 4GH7B 4NN7B 4NQCE 3WELA 4EI5C 4ELMF 2EVHA 5KYYB 2QQNL 2R23B 4HSAC 5J1AA 4E41B 1AH1A 2GHZA 1WAEA 3WN4A 2VNCA 2WV3A 2FJSA 4MXWL 4QAMB 5EOQL 4H13C 3UCRA 5L2KE 3SDYL 5ENWA 1FGNH 5LWYH 1QPPA 1AMXA 3RWEA 3BO8A 2E7LC 4X8CA 2JTDA 1IBBA 3MDJA 4KO7A 4F15B 3SGDI 1DQJB 2V9SA 3Q8FA 4R4ND 1UJ3A 4G7SB 1OAZH 1H6TA 2PYFA 2WB1A 2DLEA 2P80A 3OAYK 4Z0BH 3GSXB 3RL2B 4F33B 4HPYL 1NCCL 5HPMB 3BZ4B 4Z7QB 2VH5H 1DS9A 3ZE0E 1NBYB 3GXNA 4YSTA 3SGEH 2PP9A 3R18A 3RGZA 2QSVA 5FKPA 2Q3XA 1P6FA 2O6QA 4AEFA 5D70H 4MNHA 3D08A 1DBBL 3FU7A 4MQ7B 5FYKD 1M3IA 4LCCB 3W2DL 1RJLA 4X7FC 2FECL 3TF4A 4OUOA 1PKQE 1FPTL 5DHYA 3M7FB 5HYFA 3TA4D 3RLSA 2ZAIA 4LLQB 3TVMC 1X9UA 3HPJA 4DUWA 5IB3A 5LCVA 2EO7A 3VA2C 4AQ8A 2QKIB 5DD0L 4Y4HD 5ICXA 1WCBB 4NP4L 2NXZD 4F15C 2CO3A 1GOHA 2YXFA 4JFHD 5JHAA 2ZD0A 1XGTB 3EG9B 3MA9L 3MLYH 1Z7XW 5E5UB 4YBLB 3LRMA 4ZDHB 3IAQA 2VSMB 3KPTA 2CBQA 5TF1H 3BUYB 4K3JH 1EDYA 2H3NB 3C8DA 1LDSA 3S34H 2H6OA 4L3CB 5D7JA 1GSKA 4M1CC 2YSTA 4XGOA 5B8CB 3GHBH 4Z7OE 1U93A 3N41B 1MJJB 1TZAA 5GGSB 1DL7L 2ENQA 4Z3TA 5IWLC 5L4MA 3IEAA 3JTTB 4WP6A 4HPYH 2NY0D 5DHYB 3CFJB 1XIWB 4M4RA 4DEPB 2AZUA 3CZKA 1AGBB 3ZKSD 2XOTA 1KJVA 2PWDA 4JRXE 3F7RA 4E68A 1GYAA 1QSFE 4PJHB 1HKLL 3T0AA 4HP5A 1IC5L 3Q01A 1TETL 3AB0B 5SX4I 1U6AH 2L7EA 2F54B 4IEFB 4IBZA 2BNQB 1Q9LA 1MFAH 2XXGA 4FQJL 3QNXA 3BDYH 1R5IA 3S37X 3MNMA 2XA3A 1NCIA 1QNIA 3OHMB 3NCJH 2W65B 4F37K 4ZPVB 5TE4L 1QFPA 1T66C 5DURB 1M9WA 4FQXC 2WMPA 2X6VA 4JN2B 3DV4B 1KCLA 3LS4H 4KKBD 2B1HH 1H8NA 2FEDC 5IBUB 2PCPA 2QQKH 4AMKL 4CBPA 3RKPA 4UT9A 3A4EA 5MENA 1BPVA 4OLVH 2H26A 3GI8L 4ICWA 1ML0A 4OCWL 4NPYB 2QZQA 3GKWH 4JDEB 3CFJA 4XN7A 4OCSL 3SPCA 4RZCA 3WKML 3D3VD 5E1QA 1LMKA 2V3DA 1YECH 3K5SA 4XVOA 3CFIC 2ETWA 2HJKB 32C2B 5AWCA 4HFWA 4Y5VC 1GS7A 1FAIL 1K4DB 1VFOA 1V7NH 3MRPA 4JQVA 3KH4A 4G80A 3AVEA 2AJXL 4I3SH 1YO4A 4KJYB 1J9TA 4OFKA 1FO0B 2C5DC 2EO1A 1CXKA 3HKFA 2QFRA 1I1AB 4M62L 5I5MA 4W9FC 1EFQA 1RP9A 1NAML 2YPLB 3N50A 4PRNA 4GNKB 2GJRA 5I82A 4J2XA 2VMCA 3BUPA 4P2QD 4NXSA 5FFGA 5DQDH 2XTJB 4F8PA 4L8DB 2FAUA 4Z78B 1WIUA 3AQZA 4HJ1A 4F5CA 1TQCB 5E8EA 5F7DB 3II3A 4RZCB 5E8DL 4NZDA 4JREC 5JUEH 3WDJA 2YMXH 1FZKB 3SDCA 3SDDA 3UGEA 4B96A 2VR7A 2VM4A 1M1XB 2VDOH 3H9YA 4B95C 4FNLH 3FRPA 1JYWA 1M05B 4BDVA 2QQKL 4ZMNA 1GZHA 3TO2A 3NDZE 1CICA 1KGYE 4OCMC 1M56B 5IUSA 1DJHA 1A4JB 1CYXA 4M29A 2WXMA 4EDXA 3GNMH 3O6LL 1ONQA 4PGCB 1JYNA 3DOSB 3DRQA 3T1WA 5I6OA 4DQOH 3KYKL 5L2KB 1SVCP 5H4YA 1Y1UA 2XETA 5D3IA 4NKGA 1L3NA 4A7GA 2FATH 4Q74A 2BHUA 3MSPA 5CEZL 5EPMA 4Q62A 4IKKA 1S9WB 2I5YL 2XPYA 4I2XA 1OGPA 2P5WB 2XA8L 4FQXA 4CU7A 1MNNA 1AO7E 2PCYA 4TSCL 4Q9CA 3EADA 2EXTA 4EKJA 4ZPTB 1J9QA 3BD4A 2X28A 4XZ4A 2B14A 3W9EB 2KHAA 3ARRA 1U8HB 4KJQD 1NOLA 4V1DA 4WUUA 1LTXA 4X7CC 3WNNA 3G04B 1OLZA 3BPCB 3OGKB 1QLEH 1TCMA 3SKMB 4QHUA 3MRHA 5F7EH 4YDKH 2VC2H 3D0LB 2YXMA 1CXFA 1ZV2A 1PY9A 2MWCA 3HS0A 1AKJA 3ZYNA 4QOKB 3F85A 4QJ5B 2E9IA 1W8EA 3V0GA 3FSOA 5A2IH 4G83A 2A9AA 3B2UD 5DQ9B 2K7PA 1X7TA 3A3YB 4B0MM 1EERB 1JRHL 2H1PL 1X9QA 4TM9A 4JFFD 3MCYA 3H9ZA 4PJGE 3CZFA 4ZPVA 1IAIM 2WCSA 1F3RB 4UYQA 2EDBA 2ED8A 1E4XL 1PQZB 3GRWL 2OSXA 2DYPA 5ADOH 1SZNA 5DT1L 2YUVA 4YLQT 4ICXA 3HE6B 4L8SC 2Y7OA 5FYKU 5C3TA 1BLNB 5I0WA 2A3TA 3CPUA 2J6EH 3J27A 3VVVA 5B39G 4NM8L 4WF7A 1MWAH 5ACMA 5KG9B 4QDGA 5BV7C 1A14L 4YSDA 1YEHH 4WV1B 3O6NA 5I19H 3UYRH 1UB5A 2VO8A 4HLJA 3CFDA 1R46A 2PPCA 3FB8A 1CVSC 4ADIA 2RBLA 1IGYA 3R8QA 4HK3J 3VWKD 3ULVD 2XFXA 5EOCJ 1KEMH 3L3OC 4PJIA 1I3VA 2XWBB 3LHPL 4XC3L 3FS9A 2GJ6D 1FLRH 4RX4D 1XD0A 4B9ZA 2X42A 2ICES 1ZVHA 2FQDA 4GG8B 4K23L 5FW7A 4M48L 5K9QG 3HHRB 5FB8B 2XV3A 3S5YA 3LRSA 3GMNA 2BSSA 1NLBL 2Q2EB 3V4UH 3RL1B 3EYSH 3MLSH 4KMLB 1BD2A 3MYJB 1A3RL 4F2EA 5D1XB 2FDBP 3G7TA 2XQBL 2WGNB 5EEYA 2UWEF 3GZOA 5DD5L 4MBRA 2VABA 1T2XA 5DSCA 4TRPH 1M7DB 1JHTA 1F8TL 5FECA 4MA3A 2VN3A 1XD1A 5HVWA 2MOQA 3Q13A 2Z91A 3QQ9C 1J0KA 4GSXA 3WIIH 3HZYA 3LB6C 2VUOA 5BUAA 3V7MA 1F11B 1J1XL 1KJMA 1HZHH 2CH8A 3NZ8A 4GQRA 3CVHA 3W39A 5HYSG 5I1JH 3QIBC 1ZEAH 4KHXH 4RQQB 5D1ZI 2TSAA 5ICZA 1I8MB 4OFYD 4Q7DA 3MUGB 3ZLQC 4HSCX 3N44B 4X7SH 3F7VB 1U2YA 3K74B 1QSFA 1YJDH 4R96A 4ZOAA 4NQEA 2ZXGA 2G75B 1NFDB 2DDQL 4XPAL 3ZDXE 3GM0A 4LSUH 3QJZA 2VQUA 3OJAA 5LAXB 3FUIA 4MBOA 1MZYA 2ESVA 3Q2CA 3AY4A 4OZHB 1JNNL 4PG2A 4BFEA 5I1CH 2IDFA 5GGVL 4JG1L 2APVA 4H5SB 1CZ8H 3LRHA 1T1ZB 5CMAA 5D7LE 3UCQA 4BSVA 4LHUA 3J8F7 5CSZB 2A6JA 2HB0A 2MKLC 2Y22A 1WHOA 3NZUA 4V2CB 2XKNB 3PHOA 2V3FA 4EO5A 3EJJX 5DHVA 1EJ6A 1U58A 1XCQA 2J21A 4ENZA 2YEVB 1RHHA 1TO5A 2A9NH 2ELLA 3N43F 3V5DA 4HV8A 2PYFB 1A7OH 4ZOBA 3BSZL 5IBTL 4I18A 1E3XA 4C2AB 1M53A 3GO1L 4FNSA 1CBVL 2XZCH 1SVBA 2MCG1 1N64L 1SMDA 2X4TB 1GPOH 1DFBH 3PJSA 4IRZH 9CGTA 3WUWG 4JKPL 5IOPB 3DXAB 2BRRH 1EZSA 3DIFA 2IDQA 1QRNA 1P69B 1X5GA 2WQSA 4MX7B 2OMVA 3KPRB 5J5EA 3G6JA 1U4FA 4LDEB 4APQA 4HWEH 7PAZA 2VLJB 4RFOH 4YDNA 5KYYA 1KTDB 2D9QB 1II4E 1G9MH 2J44A 2X6UA 3BAEL 3RY5A 4XCFL 4XR8C 1SXAA 3D52A 5FYJH 1E43A 3MZGB 4OKVA 4GMTH 1JF1A 2K9FB 3FW6A 1EAQA 1WWAX 3ZDYB 2IAAC 4NWTL 5J6SA 3ARGB 1T20B 3ROOA 5B39B 1NPNA 2AANA 2VH5L 4NBXB 5B8CC 4ZX3A 1OM9A 3FXIA 4LPXA 2OSYA 3NJNA 1S9VA 3CZFB 1OSPL 3WD5H 2YSSB 3LCYA 4P2QB 1FRGH 2DQGL 4NIYE 1PLCA 1D9KB 3AWGA 5IOKA 1TDQA 3PPSA 4HJTA 1BQLH 1S7UA 3HC0A 4QHLB 1WWBX 2HFTA 2JK5B 3LS5L 3PWUB 4F2ME 1A0QH 2G0KA 2OLDA 1OT4A 1Q0EA 2B1HL 3ZKNC 3S8GB 5EZOL 1C08B 5BQDA 5I8KH 3REVB 1NIDA 3AU1A 5ENWB 3ILQC 3ARGD 3LTVA 1IVLA 2EYRA 1G87A 4NFBA 5F1OB 3PL6A 1Q8MA 5C0GA 1KGUA 4OI9A 3V6OC 1N5YH 1NGQL 1QX1A 1I1FA 2NLJA 3ZHFA 3TA3A 4MXVE 3AGWA 3KLHD 4JCWA 5FKAA 2X89D 2Z4QB 3NG5A 3L17A 1E8XA 5AEAA 4WUKL 2DKSA 1PU0A 2CNYA 2HTKD 3F5WB 3GXUB 3O2DA 1RJYB 2XWDA 2DJUA 3VSVA 1ZHLA 2DYSB 3MN8A 3W9DA 4XNDA 5IQOA 2AVFA 3RWIA 1BEYL 2X4OB 4M56A 5D1QE 1P7BA 1QABA 2BNRD 5E51A 3HI5L 3MRGA 1QFOA 2ICWJ 2F0CA 1AYOA 3CX5K 2QKIA 1IC7L 2XKNA 3PHOB 4OB5H 1G9NH 1MFEL 4OZFG 2HWZH 2WLIB 2MOVA 1BZ9B 2AV1A 4AQ8C 1W16A 2CO6A 3BW9A 1XWVA 3CN4A 5JUEL 1ZA6B 1G7HB 2WZAA 3HZYB 4JO1L 3T77A 4BQ8A 2FJGB 3QG6B 5HYSA 1THAA 2V4LA 1YRKA 3TO4B 1EHLH 5IK3A 1IGJA 1CDGA 2H47C 4FNUA 1TCRB 3L95A 1GC1L 1W0YT 5H4ZA 3TPUB 2D7PA 5JXED 2JCCF 5CSBA 3PWPD 3VFPA 3A21A 5EC2A 5GJSL 3KLDA 3NAAH 4FXGB 3ATBA 1X9RA 3VFUB 5EA0H 1R47A 4JFED 3JWDC 3I6KB 4WEMB 1DQLH 1E5CA 1BIHA 3FH8A 2Y2TA 2ZOLB 1I9IL 3ISYA 1KCRH 4GAJH 4OJDH 1L9RA 5LBVA 4MJID 3IJEA 4LCCC 4IQHA 3UXFA 3ULUL 5C0EB 2YGVA 1AY1L 4HMCA 4IBSA 4ZUVB 5G5DA 4KRLB 4EUPH 2WQ8A 5CCGE 2JB5L 5T3XD 5T5FL 3Q2WA 4F27A 3FO2A 3QP3A 3OVUB 2P43B 4PS7A 4L4VD 3REWA 3FB8B 3HI5H 3TPKA 4M6ML 1P5UA 2EO9A 4WLCA 2GI0A 4XAKE 1YPZB 1S7QB 3QUXB 1Z9SB 4XT1C 3ZT6A 1WIPA 2P5EE 1D5ZA 1F2XK 3GRWA 4JPIA 4XP5H 5I5IA 2WP3O 4E9VA 2QTEA 4L0PB 5GXBB 1KJ2B 4J27A 4CJ1A 1FCCA 2B8OT 1YEDA 4QXGH 2LVCA 1NMCC 2M26A 3OKYA 5D96C 4KPHH 4K94H 4PJ6A 2PO6B 2J73A 1UWFA 2H3XC 1KG0B 1JFHA 3JTSA 1HESA 2APBA 4MMYB 2Q1EA 3A23A 4RGOH 2B5IC 2CG9X 5HGAA 2WXRA 4P8QA 5J57B 1E5ZA 2KLTA 1XXFC 2WIIA 1A6TB 4ENEC 4RRPG 4PJXA 4HUWA 3F8UB 3FT4A 4UANA 4AQ1A 2HRGA 5ADPL 2R2HB 1ZXKA 3GNML 1L5GA 5I71B 3X13B 4X2UA 1IIKA 1C5BH 3HUJF 3FU6A 4R7VA 3FF7A 3O3DA 1CLYL 3AACA 2WFHA 1FSKB 5JW4M 1UT9A 2X4UB 4QHKI 3FB7B 4N1EA 4Q2ZA 4RH4A 3VYOA 5EUOB 1U3HC 4ETQB 4ZMLA 3D6GA 1Q0YL 5GMHA 1ROWA 2J71A 2TSBA 2ZYRA 3O6FB 4OZHE 4XPTL 5E9NA 1TOXA 1JF6A 2NY1C 2OR9H 2V5SA 4FCGA 4G9FE 4U1JB 5FV1L 2IANE 3F62A 2UWEB 4X5XA 3DGGA 4HGMA 1QSED 1LGVA 2DQTH 1EFXB 3T4YB 5IR1B 3IT8D 1HKFA 1T6VN 3QULA 3TT3H 7TAAA 1AQDA 3SDCC 1BZQK 1ZOXA 3FT0A 3ML8A 3SDDC 4YIQA 5JXAH 4PJCE 5IB3B 1N6VA 3Q1SH 4MYWB 3EYFB 2R7EB 1TLKA 3WIHA 5JIQA 2YD8A 3IJSA 5I1DA 3FHAA 3M1CA 2APXA 3EDFA 5IQ7H 4HKJA 3U0PB 1Y18B 4MCZA 1FA4A 1TQSA 3NEOA 5J1SC 3DX4A 3GRWH 2WXOA 5F9OH 4RAVB 1OW0C 1CFTB 4QJ4B 2EVGA 4HEPG 4XMXA 1KJ3H 2R69H 3D39A 3QWRA 4PGBA 1J8HD 1IEBA 2CDEB 2VXVH 5T1LD 5INCB 3TONA 2BXYA 1DFXA 2E27L 3L1GA 3ZO0A 3WTSA 1BFOA 5C0BA 1GRWA 4YQXH 2E75C 4IRSA 5ISZD 4UTAL 4KDWA 3KPRD 3BH4A 3KWWB 2KLSA 1UXSB 1ED3A 1H0DB 1LE9A 1GCYA 1M4KA 1FFNA 3LIZA 5B4MC 2H2SD 3WTYA 4G7VH 4B7IA 2EE9A 2R0LH 5D1XC 4KNGA 2XX0A 2YC1B 5B21A 4B50A 8FABA 1MCFA 2QVIA 5D9SB 1WTGT 2G9HB 4OKVB 3BIKA 4LSAA 1R5VB 5FFLA 4UYPA 1QBMH 1YYLL 2VDLL 4M43L 4PBXA 4ZXBD 1IAIH 2IG2L 2VDQH 3TBTA 3HUJA 1TNNA 4HZLB 4M00A 5IHZB 2Z34A 3DXAA 3OL2A 1TQWA 2F53E 1WO2A 3SCMA 2BCMA 3D39B 4PRIE 5JIIA 4XNZB 3ULUF 4OCLC 1KIQA 1AZNA 4DO5A 1I8IB 3MKGA 2ATAA 3MV9D 3L5HA 4X5WA 5EIVA 4JL1A 3ZXAC 5FO2A 4YHNB 4EJ1C 1BYOA 3CXDL 4LT7A 4Z7OF 4MCYB 1FL5B 2QVKA 1SOXA 2LHAA 5KS9E 5B38A 1WTLA 1SYSA 4J0MA 1MF2L 2AJZA 1O6TA 1OTUC 1ZVNA 2B9AA 1PJ9A 2YQ2A 2MHAB 4MJHA 1G43A 2YEQA 4WHTB 3RW6A 1ZLVK 1Z9OA 4IRJC 5D1ZC 3K3QA 1P8TA 2D0GA 1VCBC 1HNYA 3SQBB 1NGZB 1I3GH 2DL9A 4LRIC 1JTPA 1UXLA 3IU4H 4QF1A 1Q9OB 2OL3B 3DSFH 5JR1L 4R7NA 4P2QA 1S8DA 1OK8A 2VUYA 3D9AH 4PJ9C 2MNJB 5JIDA 3ERXA 1F1GA 1RZ7L 2BVOA 2EE3A 3C6LC 4S11A 4DFIA 2XG5B 4DPAX 5E4OA 4KGJA 5L4IA 2GYSA 3MMEB 4I3RH 3WPIA 5L7XH 1NBZA 4JFDD 5EIIB 4HDIB 4N0FB 4LLYB 1V3LA 2BFGA 4HH8A 1X5HA 1B2WH 3CC5A 3TA3B 4GIPD 4M9PA 4K8RL 2NDGA 3FT3B 3TT1H 3L3DB 4IRZA 2NT0A 4LLVB 4MQXD 1CGTA 4WEBL 3WE6A 2IBBA 1MF2H 1UACL 3H3BC 1XGUA 1BOGB 4NFCA 2N01B 1E4WL 4FC3E 3M7OA 4KI5C 4KVCL 1MREH 1YNKH 4WI9A 4AEHL 2YLHA 1VFBB 3TV8A 4KQ3H 5CBAA 4FG6C 3IDIB 4WO4D 5HDOA 2JI1A 4PHZA 2ZX5A 5I30L 3ZL1A 4H0HB 4XC1L 5KVEE 2A0LC 3MBXH 3DV4A 3IE4A 1X5MA 4Y88A 3CSYB 1QUPA 4ZO6A 2JQZA 1X5AA 1T1YA 2H9GA 2K4AA 2CKBB 3WN5A 3V4LA 5KEZA 4GXUN 1OD9A 2NY4B 2R1XA 3MPCA 2Z92A 4IKNA 1ZANL 3IJYA 5DURD 1VKXA 4Y1TA 3WFEL 1AKPA 5AW5B 4WY7H 1MRDL 1QRNE 4LSVH 5L0QC 4OD1L 1VAHA 1D5XB 1ZWIB 1RZKH 2BHYA 4N2CA 4POZC 2BSRA 5EO0B 5HGBB 1MCDA 3H7LA 4P46D 3GSNB 2KC0A 2CDFA 5IB1A 2HWZL 5I8EA 4NCDA 1G6RA 2IWKA 1PZ2A 1MFDL 5KSAB 2ZYSA 4Y19A 1G7IA 3VGAC 4PGEB 1P5VB 5C7XL 5C9JA 5ABZA 1A7PH 3DZEA 2SEBA 4BM7A 3VXMB 1T04A 1HXMA 1W72L 4S2SA 1IC4L 4ZFOB 3SZ6A 3I6LE 4XCYB 2DS4A 3UJIH 3ULUA 4GXVH 4QRTB 1UM6H 1YEDB 1OF0A 5INCA 3IXAB 3HC4L 3RWFA 3T0EB 4WAFA 4H8HA 5T3ZD 5E8NA 1BP3B 2X1WL 4O5LL 1KPUA 1ASOA 1QD0A 3CIAA 4YEFA 5J13C 1I9IH 2HVKA 3GMMA 3KEDA 1WISA 1AFVL 2PR4L 4NO0B 4ES9A 2WLIA 3K6DA 1M57B 2X2YA 1DBAH 1UATA 3EJTA 2J8OA 5AW1B 1IM3B 4GUPA 1RSFA 3BCDA 2C3GA 3SDXF 2R2BB 1CR9L 1RIUL 4PRPE 2ZXBA 2C9XA 1GYVA 4L48A 2IPUK 4HGKC 3VXRB 2EECA 3KLAA 3HFFA 3LN5B 3VRJB 4BKSC 3V0FA 5DTFA 1P0SE 3OB0H 4L37B 4NQCD 3FHQA 2FD6H 1R3JA 1TJGH 1IGCH 2GUOA 2J12B 3F5WA 4V11A 2P5WA 4U6XA 3SD2A 4F9LC 2PR9A 5B38G 2GITA 4U1JA 1ES0B 1QACA 2XZAH 3QQDB 1NGXB 1I85C 2F53D 2ZOOA 5IW6A 4CDHA 1EFXD 5BW7C 1LLAA 2EDLA 1W72H 1S7SB 4HUKB 4OZFA 2IDCA 2JQAA 3KCWA 3N06B 3V10A 3LQAC 1PNCA 4OZGE 4DAGL 1HEHC 4G1MA 3NJKA 2N0MA 1OCCB 3LNFA 3ZTNL 2W07B 4M9OA 2NCEA 3PWJB 3CLWA 1CD0A 1XGZA 5EIQA 3DHUA 4NQCB 4KY1L 4WI2A 3VD3A 2XQYG 3WNPA 5K1VA 4WW2A 4CC4A 1YEFL 5GJSH 3K1DA 2YAFA 4MA1B 1KFAL 4NN6C 2KBGA 2NTFB 4X4ME 1HXKA 1T7YA 4V2BA 3SGJC 3F12A 1CFNA 3NACL 3HPLA 3FBKA 3PGCA 4NQXA 2A9BA 4K9EL 3MV7E 2GB2A 3TC9A 3UBFA 4HUVB 3AT8A 1JTOA 2GITB 2EIMB 1KLGA 3CX5J 3GBDA 3O2VL 2NUTA 3V8OA 4LHUD 4CILA 3QUML 1RCYA 1ZTXL 4OQ1A 3ZL4H 4ZYKA 4HCRL 1MCPH 2IAMD 1AVAA 3SB4A 5ITBH 4KJWD 3CFKB 2QTVA 2A7BA 2EEDA 2C7FA 2DYRB 1N5AA 4G9DA 1YYCA 1NCOA 4L23A 1UH3A 3HLKA 3RNQB 4JFPA 4LDOB 3AG1B 3JV0A 3MAWA 3LD8B 3TNNB 5DHVB 3TVMD 2E7BA 3AROA 4O4YL 3IVKB 5M94B 4Y8AA 2BY1A 1G7IB 1JG9A 4XWGH 4Z7UB 3FUFA 3QFGA 1NCAH 4CU8A 4OUUA 4P4RB 2ZOKA 3PWLA 4ZAKA 1MZZA 2CUAA 2F7IA 3ZHLA 3LNDA 4OZIE 3QCUL 3QXAA 4NQDA 5C08A 3ZTJH 2HA1A 3BDBA 4YZFE 3TCTA 4DP5X 1FF5A 3HMXA 4NS0A 5ES4B 1KBGL 4N8CL 5DJCB 4HUCA 3VO0A 3D0VA 4CGUB 4NNXA 5HYQB 1A8ZA 5L9DH 4DQOL 1X5JA 2FEEI 2Z31B 3KDMA 4DKFL 1HEZB 4Z7VF 4PYHA 4X5RA 4XAWH 3P4OA 1EAPB 3MBED 4LKXB 3OF6D 1K5NA 4YQXL 1ZA3A 4P91A 1Q0XL 1AQKH 1PGVA 1FG2B 1WFNA 4WWKB 3ZHDA 1CXHA 1KJVB 3S37L 5JO5A 2KZKA 1Y0LB 2WWMC 2A6IA 2ZG3A 3LQAH 1U2HA 3QUMH 4H20H 4WI0B 4HCRH 2NXZC 1AHKA 1CI3M 2AABH 3BW9B 4JPKL 3VXRE 2VERN 3RWHA 1AO7A 1GXEA 3ZE0B 1RI8A 1AOZA 3BAKA 2X38A 1MVUA 1CWVA 2RACA 3TO4C 2FZ3A 3B3IA 5BPPA 3F7VA 1OGAE 4OT1L 4M6NH 5LN8A 5IGXL 2X4OA 5C71A 2R8SH 1SDDB 2CK2A 4CL7A 4U6VH 3EFFA 5K9QI 1J12A 2V8LA 3TT3L 3WBDA 2GW5A 3LZFL 4U1LB 2PPDA 3TURA 5DWPA 4IYKA 1G1KA 3VWJD 5AG8A 5I16A 1SMAA 2WXJA 4HCFA 3WXVL 3DUUB 1KBGH 25C8H 3M17A 2P42B 5EO9B 1LEKB 2G3XA 3PNWB 3Q6FB 5ADOL 4OF6A 2JXMB 3INUH 4LP4A 4NBYB 4N20A 1P1ZA 4Q6YA 1YY9D 5DDHB 2G9HA 3NJXA 3PGDB 1ZVYA 1FE8H 3KM1A 2VMEA 5LXVA 2WWNA 2ZIDA 3QSKB 2WLYA 1CK0L 2X44D 1KLFB 1GVIA 2R29A 3FTSA 1YEHL 2J1ZA 3SQOL 5IV2B 2OV0A 3IDYC 3UTZB 3G04C 4IMKC 2E27H 4K5MA 3PREA 4MMXA 1L9SA 2EDNA 4P9MH 3ISRA 4D0CA 2DAVA 5EPMB 4MCMA 2V2WA 1PCSA 3SYCA 3WKYA 2ICCA 4ZG1A 1A3ZA 1T89C 3BJLA 5CINH 5EB9A 4NI6A 5KJRL 2ZPKL 2A74B 4QRSB 1EWHA 3IDUA 4U1SA 4K7PH 5E9AA 4EXKA 3LHPH 1OP3K 4KKBC 4FMFA 3KYOB 4HKXB 1T5WB 4PMFA 4JM2B 3KJ4B 4K15A 1RZ8A 4LEBA 5D70L 2VDKL 2BCKA 4RMQA 4ZTPH 3VACA 1FQ9C 2ZOUA 5FFOA 1NC2B 1HHIA 3EFDL 3EUUA 3FQXA 3P11L 5DD0H 4YFEA 3VVWA 1IBFA 4N0YH 3O9WD 1CL7L 1FFPA 1BQLL 3QZWG 4MRCA 5DEFA 5KBMA 5INDA 3A4DA 4OZGB 4IU3A 4YO0B 1TTUA 2W5PA 4JB9L 4TVUA 2WC7A 5EZOH 2A74C 3FTYA 3RURA 3V55A 1A9EA 4GXUM 4AVIA 3I2CH 5I1JL 1FZJB 3JB9j 1DBKH 4RBPK 4JN2A 4HHGA 2Y9RT 2CSPA 3I6KA 2VR6A 5DUPH 4EF3A 4PJDE 2GSIA 4FTVB 1UXSA 4JFOB 2FWLB 3FSZA 1TJMA 3D09A 5HYIA 4HF5L 3RI5F 1S9XA 2ZP0T 4CA4A 2VDOB 4ZFGL 3O11B 3NESA 2P8PA 2AXJA 1NM4A 3WHE1 4XX5A 1Y7VA 1I1YB 3SN6N 4LSUL 4ZS6C 3ME0B 1SN0A 3HAEG 4KAQH 5E6YA 1NGYB 3FQ2A 4C4BA 1PL3A 4J4LA 4J1UA 3CHOA 2FECI 3QS3A 1HOCA 1W72A 1J0ZA 1KGWA 1HH6A 4NT6A 4BD4A 2Z64A 2VDRL 3MYZA 2Z9TA 3VGFA 5E6ID 2LOEA 2I60H 4GT6A 5DC4B 5H37G 5B1JA 5CJBA 4YX2H 2WBXA 2J8HA 4HH9A 4JKLA 2V9TA 4Q56A 1LD9B 1XH3B 2IDSA 1UUSA 5E6SB 4X98B 4G6FB 1F2QA 4U6XB 3CSFA 1NSNL 4F1ZA 3W57A 4Z79A 5IW6B 1IAKB 1YLBB 5CD3B 3ECBA 2OR8A 4XBPB 1C1EH 4A2HA 2BZ7A 4XCNA 4L9LC 2DMHA 4OQTA 3I2CL 4R90H 4XCCL 3ZZ1A 2EUXA 5EF0A 5A16A 4XAKD 5C0IB 5IKCA 1FHGA 1KJMB 5EZIH 1UOWA 3NJVA 1OTOA 1HVXA 3VXNA 2PXYD 2W9LA 1EAJA 4G6KH 4IBTA 4JRYB 4AZ8B 3K5RA 3RUGA 1UZ8B 1AP2A 5DEZA 2J3SA 5DD6A 1WUNT 3QUYB 1C7TA 1XDTT 4C56E 3VXUD 2HLFC 1AO7B 3V0AC 2JE0A 3EJZC 2GFBB 1PLBA 4NXKA 3ULUH 3BXNA 3O2DH 1SLWA 2X3BA 4YR6A 3VWKC 1I8KB 3U7AA 4LLMB 1JGLH 5E08L 3K80A 3MR9B 5CGBA 3WTWA 4QRTA 2IC2A 1HQ4B 3WFEH 3QR0A 4C83A 4JO4L 3QJVB 2E86A 1IGCL 4PVNA 3POCA 1HCYA 3C6SA 3US1A 3UO1L 3B9KD 3CLEH 4WFGE 3OJMB 1PY0A 3MTXA 1QUNA 4KUZL 4PV9A 5DYFA 4JJOA 2PUQT 3IDJB 2YK1L 2I9TA 1Y6MR 4WW2B 3QQ3B 4ZW8A 3ZQWA 1B3IA 5ITFA 3T0DA 2RA8A 2YXVA 1H3UA 2YEZA 3RWEB 1Q4NX 2AV1B 3LY6A 2FUQA 1MW2A 4MCZB 1HIMH 1NEZG 2DWDB 1GJWA 4OLWL 2JSFA 3DXAE 2ZQKA 3M07A 4NRZA 3V95A 2VN5A 3ZE2B 4DZ8A 3OKMB 4QXTB 1ODAA 4X6FB 2IO5A 4FNPA 4KRPB 4DTGL 3AMLA 3AXHA 2EIBA 4DN3H 3ATEA 4PJFB 4QJ3B 3DLQR 4LL1A 4QMEA 1WA1X 3IF1A 1TJXA 4LL9A 1ETJA 3SYPA 5CGMA 1J8KA 1H8SA 3ROLA 2P1MB 1SXBA 2PWGA 1DBAL 2GY5A 2V5MA 4WU5B 3NIDB 1JHLL 3FAXA 1MJ7L 2WWOA 3A4FA 1MFVA 3ECVA 3HR5A 3DX9B 1NEZA 5A3ID 2VZ1A 3BT2L 4QHNA 3R1GL 4X4XB 1UT1A 2L0DA 2E56A 2FHFA 2JWYA 5GIRB 2YFOA 1P4IH 2EYTB 3DARA 1JZ7A 3CSPA 1KT2B 1HU8A 4RGMB 2HKHH 3P9LB 1KCSL 4D7BA 2HPTA 3O8XB 2GJ6B 4JFSA 3LDBB 1ZDQA 1BG1A 1JGUH 4OFDA 4I9WD 5CR8A 5D71H 5I17B 5J1TC 1RUQL 2ORBL 3PF2A 4I77L 4KROB 3OPUA 4JO1H 3GMRA 3P40A 3GGWA 3VFRB 4MXQC 4M8VA 4WEEA 5HYEA 3IXAA 4JHWL 4BV1A 1KTBA 2YQGA 3HVDA 3KR3L 1A6AA 1DVFA 2UVFA 4DP6X 3QUYC 3ALPA 5CU5A 3NDYE 2WSKA 5EF2A 4XZUB 4D0DA 1U91B 5DJ0A 1VFAB 3EGXB 3QQDA 4NM4H 2WZ5A 1BAGA 3VFSA 4AKQA 3O0RL 5I6NA 2XIIA 4DTGH 4D7PA 2YN5A 3O8XD 4Z7WB 5E8PB 5AOMA 4ZI8A 3O6LH 2X6AA 1WWCA 2MQGA 4JR9H 1CC3A 4PCKA 4WKXA 4UTCA 2IBZX 1MHCB 1OT2A 1SXCA 3BVVA 4YDJB 3S35H 1KC5H 3L45A 2GBUA 3HNVL 4DZBB 4YDVB 3PWJA 4KFMA 3AM8A 3SQBA 5JIMA 4X8GA 3T1FA 2L8AA 6TAAA 2X4PB 2VN7A 1YSOA 4TSCH 5DQJB 1XEUA 4R6FA 4GKZB 1ZTXH 2X7LB 2B3RA 3HE7C 2RCSL 1IC0A 2QLYA 3EZJB 2R0LL 4PJ8C 3ZL4L 1DSWA 4AQZA 4BSJA 4JHZA 2E6QA 3DTDA 3P4MB 4LIQL 1SJHB 1EEZA 4ZMQA 4Z7IA 4IHOB 1DVQA 4FXKA 1KGJA 2X0WA 1S7UB 2K45A 2F08A 5LBSH 4AMXA 1F13A 2WKOF 3G6DH 4X5XB 4KVPA 5SX4H 4PAZA 4PJ9B 5ECGA 4N8VA 4TKWA 1DLHB 1RAMA 1E28B 1AGDA 4K4KA 2ZUSA 4NENA 5AQ0A 2R29L 5K9OA 4G8EB 5BUGA 5DS1A 4MMXC 2FYYB 2BLFA 3BIKB 4AIOA 3BLBA 1WJ3A 3ZKXB 4KH9A 2WZ6A 3WU1A 1E4XH 3HG1D 4DP1X 3T3ME 5B4PA 3RU8L 2IPKA 3GMOA 4CU6A 5IJBA 2R0WH 4M7KH 2DQCH 5DUBB 4N6RB 1X9LA 3U4AA 2HN7A 4UDTB 3S0PA 4ILDA 1ZTMA 3BEWA 5KW9L 4AYFA 1ETA1 3R4RA 2AQTA 2ZSWB 4JFDE 3VI4E 1L0QA 4WSKA 4XRCB 1OXYA 3AWFA 3E4GA 4O9HH 3E6FA 3QUHA 5DFVD 3A79B 1JMXA 2CDEA 1IBDA 2CKNA 3BD5A 4ACTA 3SCMD 1FORH 1I3GL 1UTDA 3QUZB 2X1OA 3CXHJ 5HSFA 5BRZE 5EF1A 3WUZA 3AG3B 3QIWC 5AW9B 4YC2B 5GGVH 4RIRB 2RFXB 4RETB 1IMHC 4FFVC 1BVNT 1S5HA 4LNRA 5J56B 4LIQH 1F4XH 4WHYH 5I1DB 5FUCC 1ZA6A 4Y2NA 2BSRB 1E9PB 3NFPB 5EO0A 5AD0B 3KLAB 5C1MB 3DMMC 1COBA 2Z93B 1UURA 3T4AA 2AFNA 2FGZA 1NAKL 2UX6A 4GO6B 3EFDH 3Q1SL 2VMJA 5ICUA 1VEPA 1A9VA 1B9KA 4EIUA 1B2WL 2ZAGA 3K71A 3GXIA 3MJ7B 4JB9H 3P30H 1T6BX 4GSDH 4JM4H 3O41A 4S0SD 1L4IA 2UY7A 3GMNB 1U0QA 1I8IA 2DQCL 4YMPA 2HJLA 1VENA 5IBLC 3T0BA 1GGYA 2P80D 4ZNEA 1MHEB 5F97E 2GJJA 1FE8L 2WQUA 4BHUI 1MREL 3X1GA 3GBEA 3SY0A 4A7UA 1NOFA 4UM8A 4UTAH 1OARL 5K9JH 3MOQA 3KPLA 3GLEA 3T8XA 4Y4FC 4MMZC 4LOVA 2NTFA 2VJ0A 4ATWA 4JFYB 5CINL 3BAWA 2ASTB 3NZ8B 2JJTC 2F74B 2ZPKH 1Z32X 1EZLA 1ZAGA 3T5WA 5EEUA 1A65A 4BFOA 5C0CE 3E2JA 4YVNA 4TNWF 4XN4A 3WJMB 1YN6A 2EEAA 2H8PB 3EYQC 2BFVH 4JY5H 2XTJE 3U7WL 2V2XA 3UADA 2VE6B 3VD1A 4LXFA 3NGBB 1SUJA 5HI4D 3L4ZA 1KG0A 5CEXA 3L9RB 2YD3A 4ZUTA 3CXFA 4UT6H 1XTMA 1GC1C 3E9UA 5F7UA 4D0BB 4WI6A 1KYFA 5EU7C 1PF3A 4C59B 1JPGA 4J8QA 4BH7B 1B0GB 3F01A 1OVZA 4P06A 1IARB 4XX1G 1Z0NA 2VR9A 5GGRA 2D3NA 3GF8A 3UBXB 5I1KL 4GKSB 4DGWC 3SD5A 3L3GA 3PMHG 1SYVA 2XVKA 3EJCA 4XX1E 1ZGLP 1Z9MA 3WPBA 4W9ZA 3M18A 5BXFA 4J4PD 1EHAA 5HHPB 3KL3A 4JFDB 1UH4A 4UIMA 4ZSOE 3VI4B 4ZMYA 4J39A 4P2AA 1NCHA 3PRZA 4OM1H 3A6OA 4XXWA 2DQ6A 3K4ZA 3BD3A 4I2XB 3C5JA 4WGVB 2AERT 1R5WA 3AZUA 2HX8A 3ASNB 2IDUA 4BQ6A 4QHLA 4IIZA 4PH8A 5FYJL 5CEXB 3MLPA 3QIUD 4W9GC 4F8OA 5HDBB 4LVOC 1NPUA 3FUKA 1WD9A 3MRBB 5I0DA 2EDOA 3V4VL 1NCDH 2VZUA 3T0ED 1E30A 2DQIL 2ZJSL 1R5VA 2GK0A 1TZ8A 5L2JA 4YSQA 2GEQA 2MRYA 5T3XH 2AKRA 1NZRA 3BFOA 2Q86B 3UN9A 2E6JA 4BK4A 2YS4A 2HT2D 2X6BA 4XN5A 1Q1JL 3G6AB 4KK5C 3PHQB 3KPMA 3ARBD 3OZ9H 4C8XA 3JQOB 1GGIH 1YUHA 4MD4A 4A6YB 3C6OB 3JBG7 1PDKB 2C3VA 2CE6A 1JERA 2GSGB 4AZUA 2DYPB 1BVLA 2XN9B 5DYOA 1BF5A 2APFA 4PI2A 1MI5E 2F5BL 1QSVA 5EA0L 4UOW1 2LLNA 4JY4A 4P07A 2WXKA 2ZUQC 3WI9A 4I9WE 4X4XA 4ZXBC 4TQPA 4CMMA 1F58L 2VIRA 1Z6JT 5ALCH 3QI9A 2DWEB 2WO3B 3LZLA 5DJ8B 4RWTC 3BP5B 4ODTH 1OTUD 2HH0L 5E7BA 3UTSD 2X9YA 1NGPL 1C5CL 3OLDA 5EDXA 1FNGA 2NNRA 2XA8H 1NC4A 4URTB 32C2A 1LEGB 4KDTC 2VR8A 2NQ3A 3DECA 5AVYB 1G1YA 3FRPG 2YPVH 4A38A 5CFAA 3NOIA 4XMLL 4X9GA 4OJAA 4JFFA 4PRHD 4JO4H 1Z2KA 3ETBF 3DUSB 5E4IA 1MCHA 2I69A 2UXTA 2JF1A 5C0FA 1U33A 2Z8SA 3QUKA 2HSIA 2R4RL 3QDGD 5IFHL 1Q1JH 1QPKA 1EPFA 1JV5A 4JBSA 5F88A 3KBEA 2RR3A 1IAOA 3BESR 3O6KL 4YDIH 1AZRA 4MFHA 1UWEH 3H4HA 1AS6A 1XCWA 3TTYA 2IXQA 1RSYA 4ZMWA 1G9EA 3CFBA 2WXFA 3KXFA 1E5BA 2BS9A 4X8JB 4WKZB 3VYPA 4QXWA 1A5FL 3WIFA 2B0SL 4OLVL 5DHEA 4KKPA 4OCWH 1TMQA 2X4RA 2Y3AA 4OLWH 4PRIA 3BSHA 2F19L 1MFNA 5DMYA 3FO1A 5DT1H 3DMMD 4Z7QF 4M1GL 5EEZA 3DBXA 2F53B 1DQLL 4DP9X 4GG6A 3BN9C 1MHPL 4UZUA 1TMCB 5DHXB 1P6WA 4TTGA 3MRMA 3FB6B 3CK0H 4H25B 3ZE1F 4HPOL 5AB1A 1FNEA 3UTSE 1CDUA 1UD3A 1YUKB 4LVHC 1NFDE 4UT9H 3H53A 3VI3A 3IWVA 4JRFA 3U2IA 3LZOA 4XO5A 5IB4B 2NCMA 3V6OA 3RFZC 2VMDA 3LKPA 5IROC 2WPGA 4Z5RA 3L5WB 4EIBA 2ZOLA 4C57C 5HHXH 4KI5D 4KH2A 3WIHL 3L1FA 5F89B 2YAOA 5DQDL 4AY0A 3OGCA 4LPCA 5IJDC 3DJTA 3U7YH 3RFSA 2IBZY 4MD5B 1TENA 3SPHA 3CIGA 1A64A 5AVXB 2VM9A 4CVXB 4R7DB 5D71L 1F5WA 2Y1VA 3JWDH 4CNMA 4LRIA 2P5WD 4X5QA 3FBQA 1OAQH 4W9LC 4J3OG 1J0IA 1ZKAA 2QEJA 3FKUS 2APWA 4QXGL 4BZ1H 3DYMA 4G8IB 4EDWH 2OMTB 5DJDA 4G6JH 3L4CA 2ZXDA 4J5VA 2ITDA 3FPXA 3E6HA 3T0EE 3ET9F 2F19H 4OU3A 1QRND 1FH2A 2UWEA 3EYQD 2X87A 3RFJA 1G7JB 4JO2H 1KYAA 1DFJI 2G5BB 2ZTBA 2DMGA 1YRGA 3KPRE 4M03A 5DVLA 2EC9U 3LYRA 1FVEA 4N0CC 2XXFA 2FATL 3ABLB 4XPBL 1RPKA 3DUUA 3EO0B 2OTWB 3T71A 3WLWC 4WWOA 5FF6A 3GSNL 4BK8A 4PR5B 3ARVA 1UH2A 4M7JL 5ACLA 5BO0D 4WVRA 2Q76B 4OW6A 2BOCB 1PZUB 4X5PA 3LV3B 1KNOB 2PKDA 4JUSA 4NFDA 5B22A 1JXFA 3X13A 1LO0H 1YN7A 4OUUB 5EU7E 1NGZA 1KBBA 2CR3A 2AKRB 4PERA 3MJ8B 5EN2A 1RUML 2JI2A 4JG1H 3FB5B 2NW3A 3IDYB 1TNMA 3MLTA 4JVWA 3QJQB 3BWAB 2Y5QA 3BFQG 1HINH 2FSEA 4HJUA 4XWGL 1T0MB 1H6EA 4J3OH 2P26A 4WWKD 4MA7H 1RZFH 3DIVA 4MQ7A 5F8RC 3P11H 3P30L 5I26A 3PV7A 2VDQB 1AJ7L 1SJHA 3ELQA 1GGUA 2VXUH 1ZSDB 1RZ8B 1AC0A 5CBEA 3VDBA 4P3CL 4XCNB 5CIPA 1GGBH 4E9LA 1GAFL 4GRMB 4CMMB 3TZVC 5D8JH 5M7QA 3DETD 3HTLX 4LCWE 3RGVC 4AT6A 1DE4A 3QEUB 1WG3A 4G6AC 5L9DL 3OMZA 4HMDA 2CJUL 2ATKA 3OKDB 3V6FA 2NMSA 3D30A 1JNJA 2ZXAA 4G8GD 2HKFL 1KTLA 5KW9H 1DDTA 3HC3H 1YHPA 3CDGB 5G2NA 5JMOC 1EA9C 4EOWL 4NRZB 5FYLL 5EMYA 1ODUA 4DZ8B 2AK4D 1BXVA 5EEVA 2N7AA 5I73B 1K8IB 4KK5D 4H20L 4N3UA 2ITCB 2CA6A 5AAWA 1G9ML 3BAEH 3GOZA 1MKFA 3U79A 3GMLB 1R3HB 2YJQA 4XCFH 1J05B 1LO0L 1BSIA 2BC4A 5LBGA 4A2GA 1D7BA 5C0AB 3CWGA 2XFGB 2ZX9A 4R3SB 4UQDA 3WN5B 4YXHH 2J56A 4U49A 2AJSH 4RVBA 1N12A 3PCYA 4U1SB 2K7QA 5CSGA 3VG9B 4M5YL 4WFHD 3EBGA 1W2KT 5J7CC 2A73A 1FPTH 5E1AA 4U1MB 1XZ0A 4UTBL 2E4FA 3VXSD 2DM3A 2NNAB 3L5XL 3K2UH 4QR7A 5DJXA 5FYKH 4FXLA 1SHWA 2ZKMX 5F7LB 3HS8A 5I6XC 1V7MH 5AAPA 5DD3H 3QYMA 2XWCA 4J3WA 2J1KA 1AYRA 4AWJC 2D4DA 2UZIH 1BQRA 2CR0A 5DK0B 1XCQB 2ZKYA 3EG9A 1A0QL 1HXYA 3FONB 4J4PC 2HKAA 5SWSE 3QEHB 5I1LA 1LNUB 2OJZL 3HG1A 3IXTB 4Y2OA 5KYNA 3UAAA 4F2FA 4MXWH 3L3HB 3L3IA 3S34L 3NIGF 1KXHA 4EOWH 2EE2A 3GJFB 4PHXA 3AJ7A 1IAKA 4ZYKB 4ONFH 1RIVH 3OAZK 3ROLB 4BXSV 2XIBA 2G3MA 4KKLD 2EIDA 2R51A 2VIRB 4MB4A 2AW2A 2ZWSA 4OLXH 3UTSB 5DUJA 5AAMA 5GS1B 4OIFA 1IBZA 2W59A 1SDYA 4FZEL 1YNLL 3B8SA 3V4VH 1A7RH 4JHVA 3MLWL 4R0LC 1K5DC 3CVHB 4ZOEA 4E0RA 5I1HL 5HDHA 4HEME 4I3RL 5F0MB 1A2YB 5DMGC 2CHNA 4OB5L 5ISZE 1BIIB 1RPUA 3RJ0A 2XBDA 3MRLB 4HIHB 5GGQH 3MBWA 1BQUA 1MI5A 4KTYA 5CILL 4DUVA 6FABH 4N2EA 3DI3B 3I9GH 3BRDA 1B0IA 1EZVY 3BGAA 3GO1H 3K6SB 5F9WC 1D2OA 4XHJC 1CYGA 4KUCF 1J5OH 4GRMA 3PGFL 3TT1L 2BRRL 1DBML 4B3VA 1OAXL 2XICA 3OZKA 1JNLH 4DVBB 4F80A 1S9YB 5HDLA 2CLRA 3GWJA 4NJ9L 3QQNA 1EX0A 3QWNA 3QDMA 1C5CH 4BA0A 2FWOA 2IEPA 1O75A 3GHBL 3WG7B 4LESA 3RUGB 2K3TA 4YHLH 4BV4R 2WAHA 2X4PA 3OR7B 1RZIA 4AKOA 1U8CA 3UL9A 1J05A 4M62H 1BIIA 1FN4B 3DPBB 5F8QC 3C6LA 5BRZA 5B3JF 3MLUL 2YQ3A 4O2FA 1HL9A 2R0ZL 3RL1A 3S4SG 1CJYA 3CE1A 4IHBA 1TETH 4IHOA 4OIIL 2ZJSH 1YY8A 1ZE3C 3FCBA 4HUUB 4Z76B 4UAHA 1SQMA 3C6SB 1QNZH 1XCTA 3LJ3A 3WUWA 1E0OB 2YBRB 3DX2A 4Y4KB 2G2PA 3MFFA 1OE3A 5LGKA 5LLIC 5CLTA 1LQBC 1ZJAA 3OKOB 4XN1A 3MV8A 4Y1SA 3CFDB 43C9A 1IO4C 3MRQA 4DO6A 1GGIL 4R90L 4XCCH 1BAFH 3NP3A 4YAQA 3QEGH 1GCFA 4YSAA 4ORZC 4WU7B 3R06B 2HT3C 3OKNB 1ZRUA 4JJHA 1M6UA 1JNLL 4KZCA 4N6RA 4M7LL 1UKSA 3MNWB 2CIIB 3KYKH 1FCGA 3C6LB 3OC8A 4Y8DC 4BGLA 1TFHA 4WFFD 4ZFZA 3GINA 4H0IA 3P1VA 2G75A 1C5BL 1DSYA 1YEIL 4LBAA 2WKLA 2ADYA 4PJXF 4PJIF 2CLVA 2O5NA 3DUHA 1DVSA 4ORGB 4OLUH 4AIZB 4P5MB 5I24A 3IDNA 3EJZD 4TZHA 1X5YA 4BSRA 3T8MA 1MCPL 4HDIA 3RWGA 4X4YB 4GUCA 1CMOA 3HHSA 5C8JA 2DF3A 3UTTE 1B0RB 4B9FA 4NB7A 2OR9L 1FNLA 3RIAK 3SBWC 2NOYA 3GMPB 5HGHA 1JPEA 5LXGH 4DNLA 3WPHA 1K4DA 1T2QL 1DBJL 4KKCC 4OIIH 2L7JA 4R09A 1RHHB 1B3JA 4KUZH 3EH4B 2R2BA 5IVOA 1KT2A 1Z5LA 3CLFL 1QNZL 2YAMA 3FB5A 1A3LL 4FL4C 3V5HB 1HE8A 5EFIB 3VXUA 1ZE3H 2VDLB 2B4CC 4NO2B 4OJYA 1U92A 4O02A 1YQ2A 2WUBH 1TU2A 3MV11 2WCGA 5A2BA 2WQRA 5IVNA 2FQFA 4LPYA 1AQMA 3ECBB 3CZLA 3JWOH 2VWEE 4ELKB 2JLLA 2V9UA 2AK4E 3QUXD 2R0WL 2XPZA 4BK5A 1U91A 5DJ0B 1SGKA 1JN6A 1ORQB 1E4XI 3CZNA 4UQIM 4ODSH 3QHFL 3MRKA 4AT6B 1QO3A 4ZW7A 4DW2L 2MKWA 4A37A 4M7JH 5BZWB 4HC1H 2AV7B 2CPCA 3F6LA 3N55A 3O3BA 2Y36L 1DQJA 1L9NA 2G60H 1A1MA 4TPRL 4W1TA 3U82B 2P47B 1RZIB 3T3PE 2KERA 3TGXA 2CBTA 2QPEB 4MJ6A 3KPPA 2D31A 1DJYA 4YBQC 3MUHL 1HHGB 2K8MA 4XC3H 5DLLA 5I23A 4RCAB 1RUMH 1KCSH 1XZWA 4GO9A 4MNQB 1I4FA 5E6IC 4NQSB 4OLEA 4KV5F 3CBJB 3B7TA 4ODVL 3FCTB 4B9GA 2QSQA 3FCUB 3SO5A 4YSEA 1MEXH 3IMUA 2W0LA 4PRNB 2YIHA 5T1LB 4ZPTA 1GZPB 3SSGA 3W9EA 2JE1A 2BO0A 3LIUA 4R2GC 3WAKA 5AKTA 5ISZB 5BW7A 5EBLA 3CFMA 1BOYA 5EBWA 3I9AA 2PW1A 5DO2D 5TQ0L 1XZ0B 4R83A 1FZMA 3VSQA 1QPXA 1RZJC 1TTRA 3GB7A 4GSDL 5A6LA 4TQIA 5IK3B 2CHZA 4FJZA 4UQ9A 4DEWA 1ZJBA 2XZQH 2YRPA 3K6OA 4N8CH 1JUFA 5HVGB 2Q7AA 3PHAA 1S5IH 2VLLB 3GXDA 4WK2B 1OE1A 4B9PA 4ETYA 1S2EA 3EJQA 4HHWA 1G7LB 2CJ3A 5D55A 3GSRB 1OCWL 5F93C 1GOFA 3I9PA 3QWQB 1NGWB 3CUPA 4NM8H 4F8TA 1INQB 2OJ1A 1A14H 2NY0C 4X0KB 1AQKL 1U42A 1RUKL 1AOHA 3GD1C 3B9DA 5IROA 4IOFC 4IRSB 2BIPA 3QORD 5TQ2H 3ZK0A 1YY8B 2VN6A 5LB1A 2QGDA 1UA6L 1ZLWK 3MLXL 2PETA 5EU6D 2E3VA 4K3EH 4K23H 2B5IB 5FA4B 4JY6A 4JG9A 2G4GA 3OJDB 4QHMB 5LN4A 4C56B 4N8PA 4YFLI 2Y7NA 1PKQA 1UVQA 5G4MA 1AAJA 3KJ6H 2Q3AA 4FG0A 4Y4HC 2R29H 1UC6A 3LPPA 1CL7H 1HDMB 5KTEL 5A3IC 3OAUH 1A7OL 1WK0A 5D5MF 2DIEA 3VFMB 1M2VA 2AZAA 1YUHB 2CIIA 5GS0D 3N5AA 4XPFL 3JSSA 2FX7H 3P9MB 1NL0H 1TJHL 3QWRD 4K7FA 4PP1D 1HILA 1U36A 3NQKA 4W9IC 1M10B 4ZFOL 1DR9A 1T7ZA 4H7VA 4NZUH 4YC2C 3L2NA 3L8QA 4U31A 3FT4B 1J1XH 3SJVD 4GFTB 4QLWA 1SEBA 4WFFE 3N42F 4PB9L 1PZ5A 4D9RD 5LGHL 4GRWH 2NY5C 4OAWA 2BOCA 1FIGL 1J87A 1F4HA 1BBJB 4NKMB 2YJLA 4TQHA 2JLPA 1PEZA 2XKSA 2NX5E 4IBVA 5F9JB 4IU2B 3VU1A 3QUYD 2DN7A 5T33L 3EAKA 1GYUA 4LE8A 3FQ1A 3TA3D 2X3AA 4E9XA 4AH2B 3DVNB 2NYYD 3HRZC 1ZIBA 4H40A 4H8WH 2CO7B 3WGVB 4S10A 4F7CB 1ZHBA 2YN3A 4L4TE 2HLAA 4PJFE 3VFGL 2I26N 4N87A 4MJ5A 5AENA 2ITDB 3GI9L 5FR3A 1SJEB 3LNGA 1S7TB 2VQTA 1V3JA 3C09B 4HOXA 3S4SA 2DJMA 2UZYA 2Z31C 4J3OC 4AE0A 3JTSB 1OOKG 4CNCA 1P4UA 3M8OH 4U3SB 2PNDA 1MUJA 2P8PB 3B2UC 5EDSA 4JM4L 1YQVL 1VB9A 1YMME 2LV4A 1GR7A 2IXQB 3CVCA 1QFHA 2AQPA 3NEEA 4U1HA 5FA3A 3SGDH 4X7TB 4NKMA 2UZIL 1TJHH 3S5LA 1ET7A 1U8JB 1CBVH 1DBMH 3K72A 4KTEH 3P3RA 2Y7LA 2GJ6E 4KKCD 5KSVB 3MREA 3WJJC 3DX8A 4IGBD 2F5BH 1FGNL 3HG3A 5D93C 5LWYL 4PTTB 3RZCA 3QH3A 2Y7QA 4F8NA 5K9JL 3G5ZB 4Q2ZB 4DUXA 5DQJA 3I50H 2MOGA 4WUKH 5EF3A 2NDFA 1E8ZA 4LPVA 5JW3H 4ODTL 4DP8X 4AXWB 1JZ3A 4L3AA 4MXQD 4L1SA 5FM5O 3RVVC 5DFWH 3HNTH 3PWUA 3KYAA 3QG7L 2A1WH 1KV7A 3EHBD 3H9SE 2DWEA 4YJZL 4K9EC 4HA1A 1IFHH 3MFFB 5LNGA 3PWVB 2BVTA 3E3ZA 1ACXA 12E8H 1Q9KB 1DVTA 2CZNA 5ERWA 2LTQB 2QADD 4OJEH 4QRPB 3P9WB 2MSPA 3Q05A 1RJCA 3LH2L 4JFFE 1NOAA 4GW1A 2VLRA 1OPOA 4M6AA 1TQTA 4ODBD 3GXTA 3UP6A 4BSUA 1I9JH 4DPBX 5I8EB 3T77B 5GGQL 4MXVF 3C5SA 4RAVA 4G8IA 4DAGH 1KOAA 4QGYA 4ZJ9A 2B2XL 3ULVA 3LAFA 4U0RC 4FYTA 4KK9D 1GSMA 4FQ2L 4EXPX 4O58L 2JB6B 1NBYA 3FTGA 1I3RA 1QEXA 4JEGB 4KY1H 4QRRB 4PYGA 2Z92B 3AS1A 3OAWA 1BBDH 4X6CE 5HGAB 2EKSA 4DOHE 4RMUA 2Z31A 4PV8A 4FA7B 2QADB 2WBWB 2ZWKA 3UERA 2BOLA 1KFAH 3SBRA 4BQ9A 3B8YA 4N1HB 1OOWA 4Z76A 2P3YA 3AREA 1ERNA 1UGNA 2VR4A 4FAAB 2BNUB 3GK8L 5K59E 5I1AB 3H8NA 1EFXA 3T4YA 3QDGA 1MVFA 3GRBA 4U6YA 2XJKA 5JDSA 3W11D 4UU9A 2A73B 5E1AB 1F3DJ 4CNIB 2CRIA 3QIWD 3BT2H 4CVWA 2MCPL 4D9QE 2DI7A 1R17A 3QXUA 3ZR6A 3U30B 4P57A 4J12A 1JGLL 5E08H 2CWRA 2N3JA 2XFXB 2XQYK 4N26A 4AYID 4OCRL 5H37H 5JHLL 2VOTA 3MJGX 4XXCA 4PWHA 3ARFD 4PRAB 3MV8E 2XPGB 3P3TA 4XP5L 5JPMC 1FNEB 4A2MA 4GBXC 3BHBB 2J8UF 5D2NA 5KBNC 3A24A 2AEQH 1CLVA 2FX9L 1ESOA 2NY3D 2WXLA 2WLLA 4HS8L 4JZJA 4ODXB 5JHDE 2H32H 1BX2B 3AXLA 3H9SA 1RV6X 3N3EA 4OJCA 2FIRT 1XF5A 4KFZC 4R07A 4RGOL 1H5BA 3C60A 4RWHA 4KJPD 1VKXB 4F9PA 1PYWA 3I75B 3VGEA 3QIBD 5J4MA 1AGDB 4S0HA 3RHWK 2AJ3B 5E5LA 4OBSA 3EGSA 1MOEA 4FI8A 5HHMD 2NRDA 4BH8B 1BA9A 5ALCL 4G1EB 3S35L 1UXMA 2PWHA 2WN3A 3IDIA 2Y6SC 4GXFA 4L37A 5I17A 5DJDB 2WB7A 3P2TA 1J8HB 3DSNB 5C6TH 4P3WA 4F92B 5HHME 1DQKA 4FQHB 1IQWL 5TPWL 1HI6A 3JUZA 3H6JA 3QQ9D 5I18L 3FYIB 1CFMA 4Q0XL 2VL5B 2Q7NA 1B90A 1XAKA 5EOTA 4Z23A 3IJYB 4TMPA 1UGKA 5F44A 4PP1C 2GSMB 2F18A 5FGRA 5JOPD 4HIJA 4QTIL 3NJFA 4X9FA 3F58L 2HLEB 3NABL 5DJYB 2A0ZA 2D3VA 3WY2A 4GSUA 5C0EA 4QRAA 1E5AA 4ARRA 2O26U 3L5WA 4ZMTA 2Q76A 1RUPL 1S5HB 4NKHA 1E2VA 2TRYA 4U1MA 4YL9A 3U6RB 3BVTA 3CLFH 1XSOA 5C0CA 3V5KA 3ZQ9A 3EYUH 4LBEA 3MU3A 2V7NA 2D2OA 1T7WA 1N2RA 3TS8A 4A6YH 5JW5A 3E80A 2IAMB 2O6FA 3TIEB 1CGSL 4KRMB 1VESA 3VWKB 4PVLA 4I0KA 5F1NB 3MRLA 1PDKA 4GMSH 4ZFZB 2WK2A 4QF1B 4XO8A 2DTML 3UZEC 3NIFB 4IDJH 1VFMA 1JV2B 4YEEA 1EANA 2XWZA 3I3DA 3E6JA 1XL4A 3CZUB 3TJEH 3HI1A 4Z7AA 4FQ1H 1LHZA 2HT2C 1A4AA 1L9OA 5C07D 3QDJA 1XF4A 5D2LF 3RVTC 4PJBF 4RMSA 4GY4A 2VLJA 1KWKA 1T0NB 2QSCL 3EGXA 2KLRA 3DX6A 3QIUC 2O6DA 5JW4N 1GA2A 4PSRA 2W88A 2LR4A 1BW8A 4P0DA 5HHOA 5C0CB 2IWEA 2A9ML 4NUMA 5J89A 1DJGA 2G9KA 5CP3H 4N3TA 3TNMB 1XHHA 1JK9A 4A63A 4TF4A 1MHHA 2VKXA 3CVIL 4P5KB 1XR8B 3W3GA 1U8PB 4LF3B 4TOYH 1JNHA 2UVEA 2O5YH 2VMFA 2XWBA 1M7UA 4LCIL 3SDAD 2ITEA 2MQ3A 2IGFL 5CZKA 4QXTA 4KI5E 1AR1B 2D31B 3BWAA 3FPYA 3ZDXB 5KTEH 2YOAA 1YEGH 5CFHA 1QSEE 2OJEB 3ARQA 4WK4B 3RFRA 1IGTA 2H26B 2Q7YA 3WL9A 4YSRA 1R3LA 4N90E 1G7MB 1LO2L 1NUFA 1RXLA 4D0BA 2Y06H 4OJFL 1NFKA 3B9KA 3ESPA 4WTWA 2NY7L 2CHXA 3EYOA 3JWNH 4QEGA 4YLCA 4X7TA 3WXWL 1YNTF 4M3JA 1IJ9A 5GGUB 4U6HB 2D7MA 3X1FA 2Y1ZA 5C08D 1KCVH 1NLDH 3S3CB 1JWMA 4ZW6A 1BVNP 5I19L 4BEIA 4Q9RL 3MRMB 2XT1B 4XBMA 4ONFL 1J0JA 2LABA 4B5EA 4WO4B 3UGXA 4OBRA 1RUKH 4J3TA 4P2RD 3EFOA 3DSFL 5JR1H 4MNGB 4Q52A 5IG7A 1T7XA 1GGTA 3QWOB 3KVQA 3WS3B 5GZOA 3DUSA 3SPIA 4UDTA 5HVFB 3ILPA 3FT2B 2UYLA 4GEIA 3ULUE 1D3CA 3O6FC 3T08A 3HE7A 4PUBL 2HX7A 3CDYA 3GTVA 5AWAA 3DC0A 4R5CA 5JA8B 5FGSA 1MFUA 1QATA 4M6NL 4K0OA 4MMZB 4R84A 4FA8A 3EYSL 2WXHA 3ESUF 3H3PL 2Z3FA 3GMPA 5CU9A 2ENSA 3SODB 1KTRL 2XXMB 1JBJA 2WXPA 1NAKH 2JE8A 2D4FA 4FFZL 3W11C 4HKBA 1JHKH 5D1QB 1FYTD 4LSQH 4QRPD 1ASQA 4PRDA 5KSBB 5ESVA 2VXUL 1IL1A 1T3FB 1WS7A 3VCLB 2ROYA 5C0AD 4XODA 2HJFB 3Q8AA 4AGNA 2HXAA 4RAUA 1RIHL 1C1EL 1AGEB 3CXDH 2FX7L 2NSQA 5KVGL 2FZ3B 3LZNA 2AVGA 4XP6H 2OCFD 3VFTB 5HJGA 1NLDL 3HBPA 5EN3A 4FQHA 1HHGA 1M7IA 5JW4Q 1J86A 4Z61C 5BS0D 1NC2D 4XC1H 2JB6A 4FHJA 4Y2DC 4E9WA 1GW0A 4UDUB 1E7UA 1FYTB 3QFDB 1VACB 3CVDA 2BCKB 2PW2B 1WSST 5F7BA 4HXAL 3QG7H 1CIUA 2ZXEB 1IIIA 4EUPB 2AXFA 3SE9L 1WVZA 3FTVA 3SBWA 2PMZA 3K8MA 4P5RA 1FQVA 4C2BB 4U3XA 3ES6B 1O6SB 2DBLH 3ECWA 3HAEB 3QIWB 1AMYA 2H0JA 3HRPA 1YPZE 5FGBA 3W38A 12E8L 3VMOA 1O7SA 4CMHB 1TZHA 4H09A 2E9GA 1MFAL 1X44A 4FQJH 4UT7L 5CEZE 2ISDA 3ULVL 4LOUC 4V1DD 3LOWA 2NPLX 5C7XH 4NQDB 1J5HA 1MRCL 3BZFB 1P5VA 1UQSB 4HIIB 1ZXQA 3LN4B 5HDRA 2AJYL 1KCUH 1A4BA 4UT6L 5TE4H 1Q9WB 1XAUA 3OB8A 3BSZH 1OZUA 2DLFH 1C16A 4MRBA 2EEXA 4PJIE 3GFUA 4MVBD 5KVGH 4C4KT 3MA9H 2ICWB 2YXWA 1KPVB 3GKWL 1UACH 4QCIB 4JDEA 4L1BA 4YHMH 3FQUA 4TLSA 3QNZB 3TZVD 3WY4A 4XMUA 1G5AA 1CICD 4U1GC 1TSRA 4GOSA 2QVMA 5GS2D 4YK4C 2Z81A 5JIHA 1L6XA 2VLRD 3SO3C 5BZWA 1F1DA 2ICEC 2NY1D 3ULVF 1LM8V 1ADWA 3F2LA 2C1OA 5IHZA 3L4VA 4IU3B 4YO0A 2V8MA 4NWTH 2CGRL 5I71C 4RCAA 1JL8A 3KYMB 2VZOA 5EUKA 3QZWB 3TXAA 1HKLH 3W0WB 1IFHL 1CFBA 4UT7H 3EXJA 1VZIA 1N10A 3K4AA 4A7SA 1A3QA 1HHHA 1N67A 3NCFB 1ZT1A 4N68A 1AS8A 4ABWA 3DRTB 1E4HA 1RQ5A 3MCKB 3T9WA 4GRWF 2JCCB 2LLLA 1A8JH 2CRZA 4LHJB 5I1EL 2FX9H 4PVMA 1TTAA 3QXTA 4A39A 4JGNA 3OHXB 1A7PL 5CILH 1J10A 3TVMB 6FABL 1I1YA 4NN5C 3ZTNH 5AYUH 5FM8A 3L7EA 2PTUA 1U95B 1CFVL 4HKZB 5D7HA 5A7BA 1JXGA 4PJ5E 3ALXA 5SWSB 1Q9LB 1A4JA 4EDXB 5EZIL 4HCGA 3ILDA 4D0CB 3AQXA 5E6ZA 4GB9A 3LPFA 4QY8B 4JQIH 1HSBA 4AXWA 3NK4A 1WITA 4HCIA 1EH9A 4HWNA 1RP8A