3UN9A

Crystal structure of an immune receptor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
294
Chain Sequence
RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGARVVVSLTVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NLR family member X1
publication title Structure and Functional Characterization of the RNA-Binding Element of the NLRX1 Innate Immune Modulator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 110
structure length 294
sequence length 304
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3un9A01
3ZYJA 1PGVA 3A79B 4BSSA 1JL5A 3RFSA 4NKGA 3W3KA 3WPBA 3O53A 4GLPA 1WWLA 4WP6A 4B8CD 4R6GA 2OMYA 2O6SA 5B0NA 5AWAA 4J4LA 1DS9A 2V9TB 3OJAB 3OGKB 1OGQA 2JE0A 4UFRA 4OQTA 4KNGA 2OMWA 3RGZA 4RCAB 4XSQA 4PSJA 1OTMA 2Z63A 4QBZA 2UZYA 2BNHA 1LTXA 4LI1A 3RJ0A 2ASTB 1XECA 2OMVA 4FD0A 3E6JA 4U09A 2OMZA 3C6PB 2OMUA 3WPEA 5GS2B 5AWBA 3FXIA 4I6JB 3W3MA 3OGLB 2UZXA 1FO1A 3G06A 3UN9A 4L3FA 4AY9X 3RGXA 3WPFA 2Z64A 2ID5A 2XOTA 4RCWA 2Z66A 4Q3IA 1YRGA 3ZYOA 4CC4A 4LSXC 4CNMA 5AWCA 4LXSA 4R09A 4BSRA 2Y5QA 3UL7A 4CNCA 4MQWX 5IYXC 4R0AA 2ASSB 1XWDC 5IJBA 1P8TA 3E2JA 1GWBA 2P1PB 3E3ZA 4BSUA 4XOSA 3ULAA 4CILA 5HZLB 1H6TA 2A0ZA 2Z82A 4G8AA 3PMHG 4AW4A 3JB9j 4R08A 4TZHA 4Y61B 2P1OB 5HDHA 1O6TA 4FMZA 4H09A 3WN4A 1U0ND 3O6NA 3P72A 1XCDA 3RW7A 3WPGA 1M10B 4NKHA 4M7EA 1M9LA 4PQ8A 4QXEA 1DFJI 2Z81A 3WPCA 4U06A 3RFJA 2OMXA 1OOKG 5GS0A 1O6SA 4CP6A 4V2EA 3W3GA 4LSAA 4FCGA 2P1MB 3C6NB 2JE1A 1P8VA 2WQXA 5FTTB 4WYKA 4ARRA 2P1NB 4ECNA 4U08A 2Q4GW 3CIYA 4P8SA 3G3AA 2Z7XA 1P9AG 1G9UA 3G3BA 4QC0A 4MN8B 4CC4C 4R58A 4Z64C 3ZYNA 2P1QB 5LFNA 4LSCA 4GT6A 1M9SA 2V9SA 4Z8GA 3CIGA 1SQ0B 5CMPA 1OTOA 4KXFB 1QYYA 4U7LA 4V2DA 4ECOA 1H6UA 2XWTC 1XKUA 5GMHA 1ZIWA 2WFHA 3SB4A 5GMGA 4R6AA 5AZ5A 4L3AA 1IO0A 1FQVA 4FS7A 2O6QA 3CVRA 3OGMB 3RFEA 4ARNA 4K17A 2WQUA 5IJCA 5AWDA 5A5CA 1FS2A 3W3NA 4FDWA 2BEXA 1Z7XW 3ULVA 3G39A 1KOHA 3W3JA 4R07A 2CA6A 5GMFA 4V2CA 4M7EC 1M0ZA 3WPIA 4J0MA 5D3IA 2WQWA 3M18A 4LI2A 3KJ4A 1K5DC 3C6OB 1O6VA 1W8AA 2WQVA 1FT8A 3TSRE 2Z7XB 2V70A 4Q3GA 3VQ2A 1DCEA 1K5GC 3OJAA 4XGOA 2Z65A 4KT1A 5IJDA 3ZYIA 4EZGA 4Z79A 4PERA 2R9UA 3UL8A 2Z62A 3WPDA 2ELLA 3RW6A 3E4GA 4Q62A 4RWTC 4YEBB 1XEUA 2RR6A 4FHOA 3ULUA 1OZNA 2JQDA 5CMNA 4HQ1A 4LXRA 3DZEA 3G04C 4BV4R 3VQ1A 1D0BA 5B0TA 1OTNA 4PEQB 4R5DA 4C2BB 3REZA 3BZ5A 4R6JA 3RIZA 3UL9A 4R5CA 1KOOA 4P91A 4Z94G 2FT3A 4LSXA 1A9NA 4R6FA 3WPHA 4PKIG 3GOZA 4C2AB 3W3LA 1A4YA 2RA8A 2OMTA 3M19A 4IM6A 5GQRK 2IFGA 2O6RA 4Z61C 5B4PA
chains in the Genus database with same CATH superfamily
3ZYJA 1PGVA 3A79B 4BSSA 1JL5A 3RFSA 4NKGA 3W3KA 3WPBA 3O53A 4GLPA 1WWLA 4WP6A 4B8CD 4R6GA 2OMYA 2O6SA 5B0NA 5AWAA 4J4LA 1DS9A 2V9TB 3OJAB 3OGKB 1OGQA 2JE0A 4UFRA 4OQTA 4KNGA 2OMWA 3RGZA 4RCAB 4XSQA 4PSJA 1OTMA 2Z63A 4QBZA 2UZYA 2BNHA 1LTXA 4LI1A 3RJ0A 2ASTB 1XECA 2OMVA 4FD0A 3E6JA 4U09A 2OMZA 3C6PB 2OMUA 3WPEA 5GS2B 5AWBA 3FXIA 4I6JB 3W3MA 3OGLB 2UZXA 4NZTM 1FO1A 3G06A 4NZRM 3UN9A 4L3FA 4AY9X 3RGXA 3WPFA 2Z64A 2ID5A 2XOTA 4RCWA 2Z66A 4Q3IA 1YRGA 3ZYOA 4CC4A 4LSXC 4CNMA 5AWCA 4LXSA 4R09A 4BSRA 2Y5QA 3UL7A 4CNCA 4MQWX 5IYXC 4R0AA 2ASSB 1XWDC 5IJBA 1P8TA 3E2JA 1GWBA 2P1PB 3E3ZA 4BSUA 4XOSA 3ULAA 4CILA 5HZLB 1H6TA 2A0ZA 2Z82A 4G8AA 3PMHG 4AW4A 3JB9j 4R08A 4TZHA 4Y61B 2P1OB 5HDHA 1O6TA 4FMZA 4H09A 3WN4A 1U0ND 3O6NA 3P72A 1XCDA 3RW7A 3WPGA 1M10B 4NKHA 4M7EA 1M9LA 4PQ8A 4QXEA 1DFJI 2Z81A 3WPCA 4U06A 3RFJA 2OMXA 1OOKG 5GS0A 1O6SA 4CP6A 4V2EA 3W3GA 4LSAA 4FCGA 2P1MB 3C6NB 2JE1A 1P8VA 2WQXA 5FTTB 4WYKA 4ARRA 2P1NB 4ECNA 4U08A 2Q4GW 3CIYA 4P8SA 3G3AA 2Z7XA 1P9AG 1G9UA 3G3BA 4QC0A 4MN8B 4CC4C 4R58A 4Z64C 3ZYNA 2P1QB 5LFNA 4LSCA 4GT6A 1M9SA 2V9SA 4Z8GA 3CIGA 1SQ0B 5CMPA 1OTOA 4KXFB 1QYYA 4U7LA 4V2DA 4ECOA 1H6UA 2XWTC 1XKUA 5GMHA 1ZIWA 2WFHA 3SB4A 5GMGA 4R6AA 5AZ5A 4L3AA 1IO0A 1FQVA 4FS7A 2O6QA 3CVRA 3OGMB 3RFEA 4ARNA 4K17A 2WQUA 5IJCA 5AWDA 5A5CA 1FS2A 3W3NA 4FDWA 2BEXA 1Z7XW 3ULVA 3G39A 1KOHA 3W3JA 4R07A 2CA6A 5GMFA 4V2CA 4M7EC 1M0ZA 3WPIA 4J0MA 5D3IA 2WQWA 3M18A 4LI2A 3KJ4A 1K5DC 3C6OB 1O6VA 1W8AA 2WQVA 1FT8A 3TSRE 2Z7XB 2V70A 4Q3GA 3VQ2A 1DCEA 1K5GC 3OJAA 4XGOA 2Z65A 4KT1A 5IJDA 3ZYIA 4EZGA 4Z79A 4PERA 2R9UA 3UL8A 2Z62A 3WPDA 2ELLA 3RW6A 3E4GA 4Q62A 4RWTC 4YEBB 1XEUA 2RR6A 4FHOA 3ULUA 1OZNA 2JQDA 5CMNA 4HQ1A 4LXRA 3DZEA 3G04C 4BV4R 3VQ1A 1D0BA 5B0TA 1OTNA 4PEQB 4R5DA 4C2BB 3REZA 3BZ5A 4R6JA 3RIZA 3UL9A 4R5CA 1KOOA 4P91A 4Z94G 2FT3A 4LSXA 1A9NA 4R6FA 3WPHA 4PKIG 3GOZA 4C2AB 3W3LA 1A4YA 2RA8A 2OMTA 3M19A 4IM6A 5GQRK 2IFGA 2O6RA 4Z61C 5B4PA
chains in the Genus database with same CATH topology
3ZYJA 1PGVA 3A79B 4BSSA 1JL5A 3RFSA 4NKGA 3W3KA 3WPBA 3O53A 4GLPA 1WWLA 4WP6A 4B8CD 4R6GA 2OMYA 2O6SA 5B0NA 5AWAA 4J4LA 1DS9A 2V9TB 3OJAB 3OGKB 1OGQA 2JE0A 4UFRA 4OQTA 4KNGA 2OMWA 3RGZA 4RCAB 4XSQA 4PSJA 1OTMA 2Z63A 4QBZA 2UZYA 2BNHA 1LTXA 4LI1A 3RJ0A 2ASTB 1XECA 2OMVA 4FD0A 3E6JA 4U09A 2OMZA 3C6PB 2OMUA 3WPEA 5GS2B 5AWBA 3FXIA 4I6JB 3W3MA 3OGLB 2UZXA 1FO1A 3G06A 3UN9A 4L3FA 4AY9X 3RGXA 3WPFA 2Z64A 2ID5A 2XOTA 4RCWA 2Z66A 4Q3IA 1YRGA 3ZYOA 4CC4A 4LSXC 4CNMA 5AWCA 4LXSA 4R09A 4BSRA 2Y5QA 3UL7A 4CNCA 4MQWX 5IYXC 4R0AA 2ASSB 1XWDC 5IJBA 1P8TA 3E2JA 1GWBA 2P1PB 3E3ZA 4BSUA 4XOSA 3ULAA 4CILA 5HZLB 1H6TA 2A0ZA 2Z82A 4G8AA 3PMHG 4AW4A 3JB9j 4R08A 4TZHA 4Y61B 2P1OB 5HDHA 1O6TA 4FMZA 4H09A 3WN4A 1U0ND 3O6NA 3P72A 1XCDA 3RW7A 3WPGA 1M10B 4NKHA 4M7EA 1M9LA 4PQ8A 4QXEA 1DFJI 2Z81A 3WPCA 4U06A 3RFJA 2OMXA 1OOKG 5GS0A 1O6SA 4CP6A 4V2EA 3W3GA 4LSAA 4FCGA 2P1MB 3C6NB 2JE1A 1P8VA 2WQXA 5FTTB 4WYKA 4ARRA 2P1NB 4ECNA 4U08A 2Q4GW 3CIYA 4P8SA 3G3AA 2Z7XA 1P9AG 1G9UA 3G3BA 4QC0A 4MN8B 4CC4C 4R58A 4Z64C 3ZYNA 2P1QB 5LFNA 4LSCA 4GT6A 1M9SA 2V9SA 4Z8GA 3CIGA 1SQ0B 5CMPA 1OTOA 4KXFB 1QYYA 4U7LA 4V2DA 4ECOA 1H6UA 2XWTC 1XKUA 5GMHA 1ZIWA 2WFHA 3SB4A 5GMGA 4R6AA 5AZ5A 4L3AA 1IO0A 1FQVA 4FS7A 2O6QA 3CVRA 3OGMB 3RFEA 4ARNA 4K17A 2WQUA 5IJCA 5AWDA 5A5CA 1FS2A 3W3NA 4FDWA 2BEXA 1Z7XW 3ULVA 3G39A 1KOHA 3W3JA 4R07A 2CA6A 5GMFA 4V2CA 4M7EC 1M0ZA 3WPIA 4J0MA 5D3IA 2WQWA 3M18A 4LI2A 3KJ4A 1K5DC 3C6OB 1O6VA 1W8AA 2WQVA 1FT8A 3TSRE 2Z7XB 2V70A 4Q3GA 3VQ2A 1DCEA 1K5GC 3OJAA 4XGOA 2Z65A 4KT1A 5IJDA 3ZYIA 4EZGA 4Z79A 4PERA 2R9UA 3UL8A 2Z62A 3WPDA 2ELLA 3RW6A 3E4GA 4Q62A 4RWTC 4YEBB 1XEUA 2RR6A 4FHOA 3ULUA 1OZNA 2JQDA 5CMNA 4HQ1A 4LXRA 3DZEA 3G04C 4BV4R 3VQ1A 1D0BA 5B0TA 1OTNA 4PEQB 4R5DA 4C2BB 3REZA 3BZ5A 4R6JA 3RIZA 3UL9A 4R5CA 1KOOA 4P91A 4Z94G 2FT3A 4LSXA 1A9NA 4R6FA 3WPHA 4PKIG 3GOZA 4C2AB 3W3LA 1A4YA 2RA8A 2OMTA 3M19A 4IM6A 5GQRK 2IFGA 2O6RA 4Z61C 5B4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYJ A;  1PGV A;  3A79 B;  4BSS A;  1JL5 A;  3RFS A;  4NKG A;  3W3K A;  3WPB A;  3O53 A;  4GLP A;  1WWL A;  4WP6 A;  4B8C D;  4R6G A;  2OMY A;  2O6S A;  5B0N A;  5AWA A;  4J4L A;  1DS9 A;  2V9T B;  3OJA B;  3OGK B;  1OGQ A;  2JE0 A;  4UFR A;  4OQT A;  4KNG A;  2OMW A;  3RGZ A;  4RCA B;  4XSQ A;  4PSJ A;  1OTM A;  2Z63 A;  4QBZ A;  2UZY A;  2BNH A;  1LTX A;  4LI1 A;  3RJ0 A;  2AST B;  1XEC A;  2OMV A;  4FD0 A;  3E6J A;  4U09 A;  2OMZ A;  3C6P B;  2OMU A;  3WPE A;  5GS2 B;  5AWB A;  3FXI A;  4I6J B;  3W3M A;  3OGL B;  2UZX A;  1FO1 A;  3G06 A;  3UN9 A;  4L3F A;  4AY9 X;  3RGX A;  3WPF A;  2Z64 A;  2ID5 A;  2XOT A;  4RCW A;  2Z66 A;  4Q3I A;  1YRG A;  3ZYO A;  4CC4 A;  4LSX C;  4CNM A;  5AWC A;  4LXS A;  4R09 A;  4BSR A;  2Y5Q A;  3UL7 A;  4CNC A;  4MQW X;  5IYX C;  4R0A A;  2ASS B;  1XWD C;  5IJB A;  1P8T A;  3E2J A;  1GWB A;  2P1P B;  3E3Z A;  4BSU A;  4XOS A;  3ULA A;  4CIL A;  5HZL B;  1H6T A;  2A0Z A;  2Z82 A;  4G8A A;  3PMH G;  4AW4 A;  3JB9 j;  4R08 A;  4TZH A;  4Y61 B;  2P1O B;  5HDH A;  1O6T A;  4FMZ A;  4H09 A;  3WN4 A;  1U0N D;  3O6N A;  3P72 A;  1XCD A;  3RW7 A;  3WPG A;  1M10 B;  4NKH A;  4M7E A;  1M9L A;  4PQ8 A;  4QXE A;  1DFJ I;  2Z81 A;  3WPC A;  4U06 A;  3RFJ A;  2OMX A;  1OOK G;  5GS0 A;  1O6S A;  4CP6 A;  4V2E A;  3W3G A;  4LSA A;  4FCG A;  2P1M B;  3C6N B;  2JE1 A;  1P8V A;  2WQX A;  5FTT B;  4WYK A;  4ARR A;  2P1N B;  4ECN A;  4U08 A;  2Q4G W;  3CIY A;  4P8S A;  3G3A A;  2Z7X A;  1P9A G;  1G9U A;  3G3B A;  4QC0 A;  4MN8 B;  4CC4 C;  4R58 A;  4Z64 C;  3ZYN A;  2P1Q B;  5LFN A;  4LSC A;  4GT6 A;  1M9S A;  2V9S A;  4Z8G A;  3CIG A;  1SQ0 B;  5CMP A;  1OTO A;  4KXF B;  1QYY A;  4U7L A;  4V2D A;  4ECO A;  1H6U A;  2XWT C;  1XKU A;  5GMH A;  1ZIW A;  2WFH A;  3SB4 A;  5GMG A;  4R6A A;  5AZ5 A;  4L3A A;  1IO0 A;  1FQV A;  4FS7 A;  2O6Q A;  3CVR A;  3OGM B;  3RFE A;  4ARN A;  4K17 A;  2WQU A;  5IJC A;  5AWD A;  5A5C A;  1FS2 A;  3W3N A;  4FDW A;  2BEX A;  1Z7X W;  3ULV A;  3G39 A;  1KOH A;  3W3J A;  4R07 A;  2CA6 A;  5GMF A;  4V2C A;  4M7E C;  1M0Z A;  3WPI A;  4J0M A;  5D3I A;  2WQW A;  3M18 A;  4LI2 A;  3KJ4 A;  1K5D C;  3C6O B;  1O6V A;  1W8A A;  2WQV A;  1FT8 A;  3TSR E;  2Z7X B;  2V70 A;  4Q3G A;  3VQ2 A;  1DCE A;  1K5G C;  3OJA A;  4XGO A;  2Z65 A;  4KT1 A;  5IJD A;  3ZYI A;  4EZG A;  4Z79 A;  4PER A;  2R9U A;  3UL8 A;  2Z62 A;  3WPD A;  2ELL A;  3RW6 A;  3E4G A;  4Q62 A;  4RWT C;  4YEB B;  1XEU A;  2RR6 A;  4FHO A;  3ULU A;  1OZN A;  2JQD A;  5CMN A;  4HQ1 A;  4LXR A;  3DZE A;  3G04 C;  4BV4 R;  3VQ1 A;  1D0B A;  5B0T A;  1OTN A;  4PEQ B;  4R5D A;  4C2B B;  3REZ A;  3BZ5 A;  4R6J A;  3RIZ A;  3UL9 A;  4R5C A;  1KOO A;  4P91 A;  4Z94 G;  2FT3 A;  4LSX A;  1A9N A;  4R6F A;  3WPH A;  4PKI G;  3GOZ A;  4C2A B;  3W3L A;  1A4Y A;  2RA8 A;  2OMT A;  3M19 A;  4IM6 A;  5GQR K;  2IFG A;  2O6R A;  4Z61 C;  5B4P A; 
#chains in the Genus database with same CATH topology
 3ZYJ A;  1PGV A;  3A79 B;  4BSS A;  1JL5 A;  3RFS A;  4NKG A;  3W3K A;  3WPB A;  3O53 A;  4GLP A;  1WWL A;  4WP6 A;  4B8C D;  4R6G A;  2OMY A;  2O6S A;  5B0N A;  5AWA A;  4J4L A;  1DS9 A;  2V9T B;  3OJA B;  3OGK B;  1OGQ A;  2JE0 A;  4UFR A;  4OQT A;  4KNG A;  2OMW A;  3RGZ A;  4RCA B;  4XSQ A;  4PSJ A;  1OTM A;  2Z63 A;  4QBZ A;  2UZY A;  2BNH A;  1LTX A;  4LI1 A;  3RJ0 A;  2AST B;  1XEC A;  2OMV A;  4FD0 A;  3E6J A;  4U09 A;  2OMZ A;  3C6P B;  2OMU A;  3WPE A;  5GS2 B;  5AWB A;  3FXI A;  4I6J B;  3W3M A;  3OGL B;  2UZX A;  4NZT M;  1FO1 A;  3G06 A;  4NZR M;  3UN9 A;  4L3F A;  4AY9 X;  3RGX A;  3WPF A;  2Z64 A;  2ID5 A;  2XOT A;  4RCW A;  2Z66 A;  4Q3I A;  1YRG A;  3ZYO A;  4CC4 A;  4LSX C;  4CNM A;  5AWC A;  4LXS A;  4R09 A;  4BSR A;  2Y5Q A;  3UL7 A;  4CNC A;  4MQW X;  5IYX C;  4R0A A;  2ASS B;  1XWD C;  5IJB A;  1P8T A;  3E2J A;  1GWB A;  2P1P B;  3E3Z A;  4BSU A;  4XOS A;  3ULA A;  4CIL A;  5HZL B;  1H6T A;  2A0Z A;  2Z82 A;  4G8A A;  3PMH G;  4AW4 A;  3JB9 j;  4R08 A;  4TZH A;  4Y61 B;  2P1O B;  5HDH A;  1O6T A;  4FMZ A;  4H09 A;  3WN4 A;  1U0N D;  3O6N A;  3P72 A;  1XCD A;  3RW7 A;  3WPG A;  1M10 B;  4NKH A;  4M7E A;  1M9L A;  4PQ8 A;  4QXE A;  1DFJ I;  2Z81 A;  3WPC A;  4U06 A;  3RFJ A;  2OMX A;  1OOK G;  5GS0 A;  1O6S A;  4CP6 A;  4V2E A;  3W3G A;  4LSA A;  4FCG A;  2P1M B;  3C6N B;  2JE1 A;  1P8V A;  2WQX A;  5FTT B;  4WYK A;  4ARR A;  2P1N B;  4ECN A;  4U08 A;  2Q4G W;  3CIY A;  4P8S A;  3G3A A;  2Z7X A;  1P9A G;  1G9U A;  3G3B A;  4QC0 A;  4MN8 B;  4CC4 C;  4R58 A;  4Z64 C;  3ZYN A;  2P1Q B;  5LFN A;  4LSC A;  4GT6 A;  1M9S A;  2V9S A;  4Z8G A;  3CIG A;  1SQ0 B;  5CMP A;  1OTO A;  4KXF B;  1QYY A;  4U7L A;  4V2D A;  4ECO A;  1H6U A;  2XWT C;  1XKU A;  5GMH A;  1ZIW A;  2WFH A;  3SB4 A;  5GMG A;  4R6A A;  5AZ5 A;  4L3A A;  1IO0 A;  1FQV A;  4FS7 A;  2O6Q A;  3CVR A;  3OGM B;  3RFE A;  4ARN A;  4K17 A;  2WQU A;  5IJC A;  5AWD A;  5A5C A;  1FS2 A;  3W3N A;  4FDW A;  2BEX A;  1Z7X W;  3ULV A;  3G39 A;  1KOH A;  3W3J A;  4R07 A;  2CA6 A;  5GMF A;  4V2C A;  4M7E C;  1M0Z A;  3WPI A;  4J0M A;  5D3I A;  2WQW A;  3M18 A;  4LI2 A;  3KJ4 A;  1K5D C;  3C6O B;  1O6V A;  1W8A A;  2WQV A;  1FT8 A;  3TSR E;  2Z7X B;  2V70 A;  4Q3G A;  3VQ2 A;  1DCE A;  1K5G C;  3OJA A;  4XGO A;  2Z65 A;  4KT1 A;  5IJD A;  3ZYI A;  4EZG A;  4Z79 A;  4PER A;  2R9U A;  3UL8 A;  2Z62 A;  3WPD A;  2ELL A;  3RW6 A;  3E4G A;  4Q62 A;  4RWT C;  4YEB B;  1XEU A;  2RR6 A;  4FHO A;  3ULU A;  1OZN A;  2JQD A;  5CMN A;  4HQ1 A;  4LXR A;  3DZE A;  3G04 C;  4BV4 R;  3VQ1 A;  1D0B A;  5B0T A;  1OTN A;  4PEQ B;  4R5D A;  4C2B B;  3REZ A;  3BZ5 A;  4R6J A;  3RIZ A;  3UL9 A;  4R5C A;  1KOO A;  4P91 A;  4Z94 G;  2FT3 A;  4LSX A;  1A9N A;  4R6F A;  3WPH A;  4PKI G;  3GOZ A;  4C2A B;  3W3L A;  1A4Y A;  2RA8 A;  2OMT A;  3M19 A;  4IM6 A;  5GQR K;  2IFG A;  2O6R A;  4Z61 C;  5B4P A; 
#chains in the Genus database with same CATH homology
 3ZYJ A;  1PGV A;  3A79 B;  4BSS A;  1JL5 A;  3RFS A;  4NKG A;  3W3K A;  3WPB A;  3O53 A;  4GLP A;  1WWL A;  4WP6 A;  4B8C D;  4R6G A;  2OMY A;  2O6S A;  5B0N A;  5AWA A;  4J4L A;  1DS9 A;  2V9T B;  3OJA B;  3OGK B;  1OGQ A;  2JE0 A;  4UFR A;  4OQT A;  4KNG A;  2OMW A;  3RGZ A;  4RCA B;  4XSQ A;  4PSJ A;  1OTM A;  2Z63 A;  4QBZ A;  2UZY A;  2BNH A;  1LTX A;  4LI1 A;  3RJ0 A;  2AST B;  1XEC A;  2OMV A;  4FD0 A;  3E6J A;  4U09 A;  2OMZ A;  3C6P B;  2OMU A;  3WPE A;  5GS2 B;  5AWB A;  3FXI A;  4I6J B;  3W3M A;  3OGL B;  2UZX A;  1FO1 A;  3G06 A;  3UN9 A;  4L3F A;  4AY9 X;  3RGX A;  3WPF A;  2Z64 A;  2ID5 A;  2XOT A;  4RCW A;  2Z66 A;  4Q3I A;  1YRG A;  3ZYO A;  4CC4 A;  4LSX C;  4CNM A;  5AWC A;  4LXS A;  4R09 A;  4BSR A;  2Y5Q A;  3UL7 A;  4CNC A;  4MQW X;  5IYX C;  4R0A A;  2ASS B;  1XWD C;  5IJB A;  1P8T A;  3E2J A;  1GWB A;  2P1P B;  3E3Z A;  4BSU A;  4XOS A;  3ULA A;  4CIL A;  5HZL B;  1H6T A;  2A0Z A;  2Z82 A;  4G8A A;  3PMH G;  4AW4 A;  3JB9 j;  4R08 A;  4TZH A;  4Y61 B;  2P1O B;  5HDH A;  1O6T A;  4FMZ A;  4H09 A;  3WN4 A;  1U0N D;  3O6N A;  3P72 A;  1XCD A;  3RW7 A;  3WPG A;  1M10 B;  4NKH A;  4M7E A;  1M9L A;  4PQ8 A;  4QXE A;  1DFJ I;  2Z81 A;  3WPC A;  4U06 A;  3RFJ A;  2OMX A;  1OOK G;  5GS0 A;  1O6S A;  4CP6 A;  4V2E A;  3W3G A;  4LSA A;  4FCG A;  2P1M B;  3C6N B;  2JE1 A;  1P8V A;  2WQX A;  5FTT B;  4WYK A;  4ARR A;  2P1N B;  4ECN A;  4U08 A;  2Q4G W;  3CIY A;  4P8S A;  3G3A A;  2Z7X A;  1P9A G;  1G9U A;  3G3B A;  4QC0 A;  4MN8 B;  4CC4 C;  4R58 A;  4Z64 C;  3ZYN A;  2P1Q B;  5LFN A;  4LSC A;  4GT6 A;  1M9S A;  2V9S A;  4Z8G A;  3CIG A;  1SQ0 B;  5CMP A;  1OTO A;  4KXF B;  1QYY A;  4U7L A;  4V2D A;  4ECO A;  1H6U A;  2XWT C;  1XKU A;  5GMH A;  1ZIW A;  2WFH A;  3SB4 A;  5GMG A;  4R6A A;  5AZ5 A;  4L3A A;  1IO0 A;  1FQV A;  4FS7 A;  2O6Q A;  3CVR A;  3OGM B;  3RFE A;  4ARN A;  4K17 A;  2WQU A;  5IJC A;  5AWD A;  5A5C A;  1FS2 A;  3W3N A;  4FDW A;  2BEX A;  1Z7X W;  3ULV A;  3G39 A;  1KOH A;  3W3J A;  4R07 A;  2CA6 A;  5GMF A;  4V2C A;  4M7E C;  1M0Z A;  3WPI A;  4J0M A;  5D3I A;  2WQW A;  3M18 A;  4LI2 A;  3KJ4 A;  1K5D C;  3C6O B;  1O6V A;  1W8A A;  2WQV A;  1FT8 A;  3TSR E;  2Z7X B;  2V70 A;  4Q3G A;  3VQ2 A;  1DCE A;  1K5G C;  3OJA A;  4XGO A;  2Z65 A;  4KT1 A;  5IJD A;  3ZYI A;  4EZG A;  4Z79 A;  4PER A;  2R9U A;  3UL8 A;  2Z62 A;  3WPD A;  2ELL A;  3RW6 A;  3E4G A;  4Q62 A;  4RWT C;  4YEB B;  1XEU A;  2RR6 A;  4FHO A;  3ULU A;  1OZN A;  2JQD A;  5CMN A;  4HQ1 A;  4LXR A;  3DZE A;  3G04 C;  4BV4 R;  3VQ1 A;  1D0B A;  5B0T A;  1OTN A;  4PEQ B;  4R5D A;  4C2B B;  3REZ A;  3BZ5 A;  4R6J A;  3RIZ A;  3UL9 A;  4R5C A;  1KOO A;  4P91 A;  4Z94 G;  2FT3 A;  4LSX A;  1A9N A;  4R6F A;  3WPH A;  4PKI G;  3GOZ A;  4C2A B;  3W3L A;  1A4Y A;  2RA8 A;  2OMT A;  3M19 A;  4IM6 A;  5GQR K;  2IFG A;  2O6R A;  4Z61 C;  5B4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...