4U06A

Structure of leptospira interrogans lrr protein lic10831
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
TYRDLTKALQNPLEVRVLDLSRQELKTLPIEIGKLKNLQRLYLHYNQLTVLPQEIEQLKNLQLLYLRSNRLTTLPKEIEQLKNLQVLDLGSNQLTVLPQEIGQLKNLQLLYLHSNRLTTLSKDIEQLQNLKSLDLSNNQLTTLPNEIEQLKNLKSLYLSENQFATFPKEIGQLQNLKVLFLNNNQITILPNEIAKLKKLQYLYLSDNQLITLPKEIEQLKNLQTLDLSYNQLMILPKEVGQLENLQTLDLRNNQLKTLPKEIEQLKNLQTLFLSNNQLTILPQEIGKLKNLLWLSLVYNQLTTLPNEIEQLKNLQTLYLNNNQFSSQEKKRIRKLLPKCQIYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords LIC10831
publication title Structural characterization of a novel subfamily of leucine-rich repeat proteins from the human pathogen Leptospira interrogans.
pubmed doi rcsb
source organism Leptospira interrogans serovar copenhageni str. fiocruz l1-130
total genus 135
structure length 344
sequence length 344
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4u06A00
4YEBB 4NKGA 4ARRA 3JB9j 3M19A 2OMUA 4CC4C 4Y61B 4Z94G 2Z7XA 4XGOA 5HDHA 4PQ8A 4GT6A 2BEXA 3UN9A 4C2AB 2A0ZA 1XEUA 4Z64C 3C6PB 3KJ4A 1K5DC 1D0BA 5AZ5A 3G3AA 4PEQB 4V2EA 4PKIG 1FT8A 2Z82A 4PERA 5AWDA 4LXRA 1OGQA 3RW7A 4CP6A 3G39A 3REZA 2UZYA 5B0TA 3ULAA 4UFRA 4L3FA 4PSJA 1OTNA 1P8VA 1DFJI 4EZGA 3W3MA 2OMZA 4QXEA 4QBZA 1QYYA 4R07A 4I6JB 4V2DA 2P1OB 4CNMA 4FMZA 3UL7A 1KOOA 4R6AA 4RWTC 2P1MB 4NKHA 5IJBA 4CNCA 2JE1A 3WPHA 1XECA 2ELLA 3O53A 1LTXA 3GOZA 1FQVA 2O6RA 4QC0A 2XWTC 1OOKG 5GS2B 1WWLA 3WPEA 4U06A 4BV4R 4OQTA 3ULVA 4IM6A 4HQ1A 3RFSA 4Q62A 4J0MA 1FO1A 1M10B 3P72A 4WYKA 4AW4A 1SQ0B 4XOSA 3G06A 4KXFB 2RR6A 2WQWA 1YRGA 1M9SA 3W3JA 3G3BA 4R08A 4LI1A 3ZYNA 2P1NB 2WQVA 3WN4A 4R6GA 5GMGA 4WP6A 2CA6A 5LFNA 1XKUA 4Z79A 1ZIWA 3WPIA 1Z7XW 4R0AA 1XCDA 4GLPA 4G8AA 4R6FA 4BSUA 4R09A 1G9UA 2WFHA 3OGMB 3RGZA 4FDWA 5B4PA 1U0ND 2IFGA 4ECNA 3W3KA 5D3IA 4ECOA 3CIGA 2JE0A 3VQ2A 4LSXA 1W8AA 2P1QB 1O6SA 4Z61C 5B0NA 5CMNA 2V9SA 4J4LA 1OTMA 3C6OB 2OMYA 2UZXA 4P91A 2Z66A 4TZHA 3RW6A 1FS2A 2R9UA 1H6UA 3W3LA 3ZYJA 3VQ1A 1K5GC 2XOTA 3ULUA 3E6JA 3RGXA 2Q4GW 5IYXC 3UL8A 3CIYA 3SB4A 4FCGA 1KOHA 2OMTA 5IJCA 4R5CA 4LI2A 1M9LA 4Q3GA 3E3ZA 5AWCA 3ZYIA 3WPDA 2Z81A 2ASSB 2JQDA 1O6VA 3ZYOA 1A4YA 3WPFA 4RCAB 1JL5A 4U09A 4C2BB 1P9AG 3OGLB 3RFEA 3DZEA 2V70A 3WPCA 4V2CA 2WQUA 3OJAB 5AWBA 1XWDC 3O6NA 3W3GA 3WPBA 3RJ0A 4LSAA 2OMWA 2FT3A 4H09A 1IO0A 3RFJA 4CC4A 2BNHA 4B8CD 3CVRA 5HZLB 4FHOA 3OJAA 5GQRK 3OGKB 4MN8B 2OMVA 4CILA 2ID5A 2P1PB 2Z63A 5AWAA 1DCEA 4RCWA 3A79B 3UL9A 4ARNA 3FXIA 4LSXC 2Z62A 2Z64A 3PMHG 1P8TA 5GS0A 1DS9A 4R58A 4MQWX 2Y5QA 4L3AA 4BSRA 4AY9X 2WQXA 4Q3IA 2Z65A 1OZNA 5FTTB 4KT1A 3WPGA 4KNGA 3TSRE 5GMHA 3C6NB 4U08A 1O6TA 4LXSA 4LSCA 3BZ5A 2ASTB 4FD0A 4XSQA 3E4GA 5CMPA 4P8SA 2OMXA 5A5CA 1OTOA 4FS7A 5GMFA 3E2JA 2O6QA 1PGVA 1A9NA 4M7EC 4R5DA 4U7LA 4M7EA 5IJDA 2V9TB 2RA8A 4BSSA 2O6SA 4K17A 1GWBA 1M0ZA 2Z7XB 3M18A 3G04C 3RIZA 4Z8GA 3W3NA 1H6TA 4R6JA
chains in the Genus database with same CATH superfamily
4YEBB 4NKGA 4ARRA 3JB9j 3M19A 2OMUA 4CC4C 4Y61B 4Z94G 2Z7XA 4XGOA 5HDHA 4PQ8A 4GT6A 2BEXA 3UN9A 4C2AB 2A0ZA 1XEUA 4Z64C 3C6PB 3KJ4A 1K5DC 1D0BA 5AZ5A 3G3AA 4PEQB 4V2EA 4PKIG 1FT8A 2Z82A 4PERA 5AWDA 4LXRA 1OGQA 3RW7A 4CP6A 3G39A 3REZA 2UZYA 5B0TA 3ULAA 4UFRA 4L3FA 4PSJA 1OTNA 1P8VA 1DFJI 4EZGA 3W3MA 2OMZA 4QXEA 4QBZA 1QYYA 4R07A 4I6JB 4V2DA 2P1OB 4CNMA 4FMZA 3UL7A 1KOOA 4R6AA 4RWTC 2P1MB 4NKHA 5IJBA 4CNCA 2JE1A 3WPHA 1XECA 2ELLA 3O53A 1LTXA 3GOZA 1FQVA 2O6RA 4QC0A 2XWTC 1OOKG 5GS2B 1WWLA 3WPEA 4U06A 4BV4R 4OQTA 3ULVA 4IM6A 4HQ1A 3RFSA 4Q62A 4J0MA 1FO1A 1M10B 3P72A 4WYKA 4AW4A 1SQ0B 4XOSA 3G06A 4KXFB 2RR6A 2WQWA 1YRGA 1M9SA 3W3JA 3G3BA 4R08A 4LI1A 3ZYNA 2P1NB 2WQVA 3WN4A 4R6GA 5GMGA 4WP6A 2CA6A 5LFNA 1XKUA 4Z79A 1ZIWA 3WPIA 1Z7XW 4R0AA 1XCDA 4GLPA 4G8AA 4R6FA 4BSUA 4R09A 1G9UA 2WFHA 3OGMB 3RGZA 4FDWA 5B4PA 1U0ND 2IFGA 4ECNA 3W3KA 5D3IA 4ECOA 4NZRM 3CIGA 2JE0A 3VQ2A 4LSXA 1W8AA 2P1QB 1O6SA 4Z61C 5B0NA 5CMNA 2V9SA 4J4LA 1OTMA 3C6OB 2OMYA 2UZXA 4P91A 2Z66A 4TZHA 3RW6A 1FS2A 2R9UA 1H6UA 4NZTM 3W3LA 3ZYJA 3VQ1A 1K5GC 2XOTA 3ULUA 3E6JA 3RGXA 2Q4GW 5IYXC 3UL8A 3CIYA 3SB4A 4FCGA 1KOHA 2OMTA 5IJCA 4R5CA 4LI2A 1M9LA 4Q3GA 3E3ZA 5AWCA 3ZYIA 3WPDA 2Z81A 2ASSB 2JQDA 1O6VA 3ZYOA 1A4YA 3WPFA 4RCAB 1JL5A 4U09A 4C2BB 1P9AG 3OGLB 3RFEA 3DZEA 2V70A 3WPCA 4V2CA 2WQUA 3OJAB 5AWBA 1XWDC 3O6NA 3W3GA 3WPBA 3RJ0A 4LSAA 2OMWA 2FT3A 4H09A 1IO0A 3RFJA 4CC4A 2BNHA 4B8CD 3CVRA 5HZLB 4FHOA 3OJAA 5GQRK 3OGKB 4MN8B 2OMVA 4CILA 2ID5A 2P1PB 2Z63A 5AWAA 1DCEA 4RCWA 3A79B 3UL9A 4ARNA 3FXIA 4LSXC 2Z62A 2Z64A 3PMHG 1P8TA 5GS0A 1DS9A 4R58A 4MQWX 2Y5QA 4L3AA 4BSRA 4AY9X 2WQXA 4Q3IA 2Z65A 1OZNA 5FTTB 4KT1A 3WPGA 4KNGA 3TSRE 5GMHA 3C6NB 4U08A 1O6TA 4LXSA 4LSCA 3BZ5A 2ASTB 4FD0A 4XSQA 3E4GA 5CMPA 4P8SA 2OMXA 5A5CA 1OTOA 4FS7A 5GMFA 3E2JA 2O6QA 1PGVA 1A9NA 4M7EC 4R5DA 4U7LA 4M7EA 5IJDA 2V9TB 2RA8A 4BSSA 2O6SA 4K17A 1GWBA 1M0ZA 2Z7XB 3M18A 3G04C 3RIZA 4Z8GA 3W3NA 1H6TA 4R6JA
chains in the Genus database with same CATH topology
4YEBB 4NKGA 4ARRA 3JB9j 3M19A 2OMUA 4CC4C 4Y61B 4Z94G 2Z7XA 4XGOA 5HDHA 4PQ8A 4GT6A 2BEXA 3UN9A 4C2AB 2A0ZA 1XEUA 4Z64C 3C6PB 3KJ4A 1K5DC 1D0BA 5AZ5A 3G3AA 4PEQB 4V2EA 4PKIG 1FT8A 2Z82A 4PERA 5AWDA 4LXRA 1OGQA 3RW7A 4CP6A 3G39A 3REZA 2UZYA 5B0TA 3ULAA 4UFRA 4L3FA 4PSJA 1OTNA 1P8VA 1DFJI 4EZGA 3W3MA 2OMZA 4QXEA 4QBZA 1QYYA 4R07A 4I6JB 4V2DA 2P1OB 4CNMA 4FMZA 3UL7A 1KOOA 4R6AA 4RWTC 2P1MB 4NKHA 5IJBA 4CNCA 2JE1A 3WPHA 1XECA 2ELLA 3O53A 1LTXA 3GOZA 1FQVA 2O6RA 4QC0A 2XWTC 1OOKG 5GS2B 1WWLA 3WPEA 4U06A 4BV4R 4OQTA 3ULVA 4IM6A 4HQ1A 3RFSA 4Q62A 4J0MA 1FO1A 1M10B 3P72A 4WYKA 4AW4A 1SQ0B 4XOSA 3G06A 4KXFB 2RR6A 2WQWA 1YRGA 1M9SA 3W3JA 3G3BA 4R08A 4LI1A 3ZYNA 2P1NB 2WQVA 3WN4A 4R6GA 5GMGA 4WP6A 2CA6A 5LFNA 1XKUA 4Z79A 1ZIWA 3WPIA 1Z7XW 4R0AA 1XCDA 4GLPA 4G8AA 4R6FA 4BSUA 4R09A 1G9UA 2WFHA 3OGMB 3RGZA 4FDWA 5B4PA 1U0ND 2IFGA 4ECNA 3W3KA 5D3IA 4ECOA 3CIGA 2JE0A 3VQ2A 4LSXA 1W8AA 2P1QB 1O6SA 4Z61C 5B0NA 5CMNA 2V9SA 4J4LA 1OTMA 3C6OB 2OMYA 2UZXA 4P91A 2Z66A 4TZHA 3RW6A 1FS2A 2R9UA 1H6UA 3W3LA 3ZYJA 3VQ1A 1K5GC 2XOTA 3ULUA 3E6JA 3RGXA 2Q4GW 5IYXC 3UL8A 3CIYA 3SB4A 4FCGA 1KOHA 2OMTA 5IJCA 4R5CA 4LI2A 1M9LA 4Q3GA 3E3ZA 5AWCA 3ZYIA 3WPDA 2Z81A 2ASSB 2JQDA 1O6VA 3ZYOA 1A4YA 3WPFA 4RCAB 1JL5A 4U09A 4C2BB 1P9AG 3OGLB 3RFEA 3DZEA 2V70A 3WPCA 4V2CA 2WQUA 3OJAB 5AWBA 1XWDC 3O6NA 3W3GA 3WPBA 3RJ0A 4LSAA 2OMWA 2FT3A 4H09A 1IO0A 3RFJA 4CC4A 2BNHA 4B8CD 3CVRA 5HZLB 4FHOA 3OJAA 5GQRK 3OGKB 4MN8B 2OMVA 4CILA 2ID5A 2P1PB 2Z63A 5AWAA 1DCEA 4RCWA 3A79B 3UL9A 4ARNA 3FXIA 4LSXC 2Z62A 2Z64A 3PMHG 1P8TA 5GS0A 1DS9A 4R58A 4MQWX 2Y5QA 4L3AA 4BSRA 4AY9X 2WQXA 4Q3IA 2Z65A 1OZNA 5FTTB 4KT1A 3WPGA 4KNGA 3TSRE 5GMHA 3C6NB 4U08A 1O6TA 4LXSA 4LSCA 3BZ5A 2ASTB 4FD0A 4XSQA 3E4GA 5CMPA 4P8SA 2OMXA 5A5CA 1OTOA 4FS7A 5GMFA 3E2JA 2O6QA 1PGVA 1A9NA 4M7EC 4R5DA 4U7LA 4M7EA 5IJDA 2V9TB 2RA8A 4BSSA 2O6SA 4K17A 1GWBA 1M0ZA 2Z7XB 3M18A 3G04C 3RIZA 4Z8GA 3W3NA 1H6TA 4R6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEB B;  4NKG A;  4ARR A;  3JB9 j;  3M19 A;  2OMU A;  4CC4 C;  4Y61 B;  4Z94 G;  2Z7X A;  4XGO A;  5HDH A;  4PQ8 A;  4GT6 A;  2BEX A;  3UN9 A;  4C2A B;  2A0Z A;  1XEU A;  4Z64 C;  3C6P B;  3KJ4 A;  1K5D C;  1D0B A;  5AZ5 A;  3G3A A;  4PEQ B;  4V2E A;  4PKI G;  1FT8 A;  2Z82 A;  4PER A;  5AWD A;  4LXR A;  1OGQ A;  3RW7 A;  4CP6 A;  3G39 A;  3REZ A;  2UZY A;  5B0T A;  3ULA A;  4UFR A;  4L3F A;  4PSJ A;  1OTN A;  1P8V A;  1DFJ I;  4EZG A;  3W3M A;  2OMZ A;  4QXE A;  4QBZ A;  1QYY A;  4R07 A;  4I6J B;  4V2D A;  2P1O B;  4CNM A;  4FMZ A;  3UL7 A;  1KOO A;  4R6A A;  4RWT C;  2P1M B;  4NKH A;  5IJB A;  4CNC A;  2JE1 A;  3WPH A;  1XEC A;  2ELL A;  3O53 A;  1LTX A;  3GOZ A;  1FQV A;  2O6R A;  4QC0 A;  2XWT C;  1OOK G;  5GS2 B;  1WWL A;  3WPE A;  4U06 A;  4BV4 R;  4OQT A;  3ULV A;  4IM6 A;  4HQ1 A;  3RFS A;  4Q62 A;  4J0M A;  1FO1 A;  1M10 B;  3P72 A;  4WYK A;  4AW4 A;  1SQ0 B;  4XOS A;  3G06 A;  4KXF B;  2RR6 A;  2WQW A;  1YRG A;  1M9S A;  3W3J A;  3G3B A;  4R08 A;  4LI1 A;  3ZYN A;  2P1N B;  2WQV A;  3WN4 A;  4R6G A;  5GMG A;  4WP6 A;  2CA6 A;  5LFN A;  1XKU A;  4Z79 A;  1ZIW A;  3WPI A;  1Z7X W;  4R0A A;  1XCD A;  4GLP A;  4G8A A;  4R6F A;  4BSU A;  4R09 A;  1G9U A;  2WFH A;  3OGM B;  3RGZ A;  4FDW A;  5B4P A;  1U0N D;  2IFG A;  4ECN A;  3W3K A;  5D3I A;  4ECO A;  3CIG A;  2JE0 A;  3VQ2 A;  4LSX A;  1W8A A;  2P1Q B;  1O6S A;  4Z61 C;  5B0N A;  5CMN A;  2V9S A;  4J4L A;  1OTM A;  3C6O B;  2OMY A;  2UZX A;  4P91 A;  2Z66 A;  4TZH A;  3RW6 A;  1FS2 A;  2R9U A;  1H6U A;  3W3L A;  3ZYJ A;  3VQ1 A;  1K5G C;  2XOT A;  3ULU A;  3E6J A;  3RGX A;  2Q4G W;  5IYX C;  3UL8 A;  3CIY A;  3SB4 A;  4FCG A;  1KOH A;  2OMT A;  5IJC A;  4R5C A;  4LI2 A;  1M9L A;  4Q3G A;  3E3Z A;  5AWC A;  3ZYI A;  3WPD A;  2Z81 A;  2ASS B;  2JQD A;  1O6V A;  3ZYO A;  1A4Y A;  3WPF A;  4RCA B;  1JL5 A;  4U09 A;  4C2B B;  1P9A G;  3OGL B;  3RFE A;  3DZE A;  2V70 A;  3WPC A;  4V2C A;  2WQU A;  3OJA B;  5AWB A;  1XWD C;  3O6N A;  3W3G A;  3WPB A;  3RJ0 A;  4LSA A;  2OMW A;  2FT3 A;  4H09 A;  1IO0 A;  3RFJ A;  4CC4 A;  2BNH A;  4B8C D;  3CVR A;  5HZL B;  4FHO A;  3OJA A;  5GQR K;  3OGK B;  4MN8 B;  2OMV A;  4CIL A;  2ID5 A;  2P1P B;  2Z63 A;  5AWA A;  1DCE A;  4RCW A;  3A79 B;  3UL9 A;  4ARN A;  3FXI A;  4LSX C;  2Z62 A;  2Z64 A;  3PMH G;  1P8T A;  5GS0 A;  1DS9 A;  4R58 A;  4MQW X;  2Y5Q A;  4L3A A;  4BSR A;  4AY9 X;  2WQX A;  4Q3I A;  2Z65 A;  1OZN A;  5FTT B;  4KT1 A;  3WPG A;  4KNG A;  3TSR E;  5GMH A;  3C6N B;  4U08 A;  1O6T A;  4LXS A;  4LSC A;  3BZ5 A;  2AST B;  4FD0 A;  4XSQ A;  3E4G A;  5CMP A;  4P8S A;  2OMX A;  5A5C A;  1OTO A;  4FS7 A;  5GMF A;  3E2J A;  2O6Q A;  1PGV A;  1A9N A;  4M7E C;  4R5D A;  4U7L A;  4M7E A;  5IJD A;  2V9T B;  2RA8 A;  4BSS A;  2O6S A;  4K17 A;  1GWB A;  1M0Z A;  2Z7X B;  3M18 A;  3G04 C;  3RIZ A;  4Z8G A;  3W3N A;  1H6T A;  4R6J A; 
#chains in the Genus database with same CATH topology
 4YEB B;  4NKG A;  4ARR A;  3JB9 j;  3M19 A;  2OMU A;  4CC4 C;  4Y61 B;  4Z94 G;  2Z7X A;  4XGO A;  5HDH A;  4PQ8 A;  4GT6 A;  2BEX A;  3UN9 A;  4C2A B;  2A0Z A;  1XEU A;  4Z64 C;  3C6P B;  3KJ4 A;  1K5D C;  1D0B A;  5AZ5 A;  3G3A A;  4PEQ B;  4V2E A;  4PKI G;  1FT8 A;  2Z82 A;  4PER A;  5AWD A;  4LXR A;  1OGQ A;  3RW7 A;  4CP6 A;  3G39 A;  3REZ A;  2UZY A;  5B0T A;  3ULA A;  4UFR A;  4L3F A;  4PSJ A;  1OTN A;  1P8V A;  1DFJ I;  4EZG A;  3W3M A;  2OMZ A;  4QXE A;  4QBZ A;  1QYY A;  4R07 A;  4I6J B;  4V2D A;  2P1O B;  4CNM A;  4FMZ A;  3UL7 A;  1KOO A;  4R6A A;  4RWT C;  2P1M B;  4NKH A;  5IJB A;  4CNC A;  2JE1 A;  3WPH A;  1XEC A;  2ELL A;  3O53 A;  1LTX A;  3GOZ A;  1FQV A;  2O6R A;  4QC0 A;  2XWT C;  1OOK G;  5GS2 B;  1WWL A;  3WPE A;  4U06 A;  4BV4 R;  4OQT A;  3ULV A;  4IM6 A;  4HQ1 A;  3RFS A;  4Q62 A;  4J0M A;  1FO1 A;  1M10 B;  3P72 A;  4WYK A;  4AW4 A;  1SQ0 B;  4XOS A;  3G06 A;  4KXF B;  2RR6 A;  2WQW A;  1YRG A;  1M9S A;  3W3J A;  3G3B A;  4R08 A;  4LI1 A;  3ZYN A;  2P1N B;  2WQV A;  3WN4 A;  4R6G A;  5GMG A;  4WP6 A;  2CA6 A;  5LFN A;  1XKU A;  4Z79 A;  1ZIW A;  3WPI A;  1Z7X W;  4R0A A;  1XCD A;  4GLP A;  4G8A A;  4R6F A;  4BSU A;  4R09 A;  1G9U A;  2WFH A;  3OGM B;  3RGZ A;  4FDW A;  5B4P A;  1U0N D;  2IFG A;  4ECN A;  3W3K A;  5D3I A;  4ECO A;  4NZR M;  3CIG A;  2JE0 A;  3VQ2 A;  4LSX A;  1W8A A;  2P1Q B;  1O6S A;  4Z61 C;  5B0N A;  5CMN A;  2V9S A;  4J4L A;  1OTM A;  3C6O B;  2OMY A;  2UZX A;  4P91 A;  2Z66 A;  4TZH A;  3RW6 A;  1FS2 A;  2R9U A;  1H6U A;  4NZT M;  3W3L A;  3ZYJ A;  3VQ1 A;  1K5G C;  2XOT A;  3ULU A;  3E6J A;  3RGX A;  2Q4G W;  5IYX C;  3UL8 A;  3CIY A;  3SB4 A;  4FCG A;  1KOH A;  2OMT A;  5IJC A;  4R5C A;  4LI2 A;  1M9L A;  4Q3G A;  3E3Z A;  5AWC A;  3ZYI A;  3WPD A;  2Z81 A;  2ASS B;  2JQD A;  1O6V A;  3ZYO A;  1A4Y A;  3WPF A;  4RCA B;  1JL5 A;  4U09 A;  4C2B B;  1P9A G;  3OGL B;  3RFE A;  3DZE A;  2V70 A;  3WPC A;  4V2C A;  2WQU A;  3OJA B;  5AWB A;  1XWD C;  3O6N A;  3W3G A;  3WPB A;  3RJ0 A;  4LSA A;  2OMW A;  2FT3 A;  4H09 A;  1IO0 A;  3RFJ A;  4CC4 A;  2BNH A;  4B8C D;  3CVR A;  5HZL B;  4FHO A;  3OJA A;  5GQR K;  3OGK B;  4MN8 B;  2OMV A;  4CIL A;  2ID5 A;  2P1P B;  2Z63 A;  5AWA A;  1DCE A;  4RCW A;  3A79 B;  3UL9 A;  4ARN A;  3FXI A;  4LSX C;  2Z62 A;  2Z64 A;  3PMH G;  1P8T A;  5GS0 A;  1DS9 A;  4R58 A;  4MQW X;  2Y5Q A;  4L3A A;  4BSR A;  4AY9 X;  2WQX A;  4Q3I A;  2Z65 A;  1OZN A;  5FTT B;  4KT1 A;  3WPG A;  4KNG A;  3TSR E;  5GMH A;  3C6N B;  4U08 A;  1O6T A;  4LXS A;  4LSC A;  3BZ5 A;  2AST B;  4FD0 A;  4XSQ A;  3E4G A;  5CMP A;  4P8S A;  2OMX A;  5A5C A;  1OTO A;  4FS7 A;  5GMF A;  3E2J A;  2O6Q A;  1PGV A;  1A9N A;  4M7E C;  4R5D A;  4U7L A;  4M7E A;  5IJD A;  2V9T B;  2RA8 A;  4BSS A;  2O6S A;  4K17 A;  1GWB A;  1M0Z A;  2Z7X B;  3M18 A;  3G04 C;  3RIZ A;  4Z8G A;  3W3N A;  1H6T A;  4R6J A; 
#chains in the Genus database with same CATH homology
 4YEB B;  4NKG A;  4ARR A;  3JB9 j;  3M19 A;  2OMU A;  4CC4 C;  4Y61 B;  4Z94 G;  2Z7X A;  4XGO A;  5HDH A;  4PQ8 A;  4GT6 A;  2BEX A;  3UN9 A;  4C2A B;  2A0Z A;  1XEU A;  4Z64 C;  3C6P B;  3KJ4 A;  1K5D C;  1D0B A;  5AZ5 A;  3G3A A;  4PEQ B;  4V2E A;  4PKI G;  1FT8 A;  2Z82 A;  4PER A;  5AWD A;  4LXR A;  1OGQ A;  3RW7 A;  4CP6 A;  3G39 A;  3REZ A;  2UZY A;  5B0T A;  3ULA A;  4UFR A;  4L3F A;  4PSJ A;  1OTN A;  1P8V A;  1DFJ I;  4EZG A;  3W3M A;  2OMZ A;  4QXE A;  4QBZ A;  1QYY A;  4R07 A;  4I6J B;  4V2D A;  2P1O B;  4CNM A;  4FMZ A;  3UL7 A;  1KOO A;  4R6A A;  4RWT C;  2P1M B;  4NKH A;  5IJB A;  4CNC A;  2JE1 A;  3WPH A;  1XEC A;  2ELL A;  3O53 A;  1LTX A;  3GOZ A;  1FQV A;  2O6R A;  4QC0 A;  2XWT C;  1OOK G;  5GS2 B;  1WWL A;  3WPE A;  4U06 A;  4BV4 R;  4OQT A;  3ULV A;  4IM6 A;  4HQ1 A;  3RFS A;  4Q62 A;  4J0M A;  1FO1 A;  1M10 B;  3P72 A;  4WYK A;  4AW4 A;  1SQ0 B;  4XOS A;  3G06 A;  4KXF B;  2RR6 A;  2WQW A;  1YRG A;  1M9S A;  3W3J A;  3G3B A;  4R08 A;  4LI1 A;  3ZYN A;  2P1N B;  2WQV A;  3WN4 A;  4R6G A;  5GMG A;  4WP6 A;  2CA6 A;  5LFN A;  1XKU A;  4Z79 A;  1ZIW A;  3WPI A;  1Z7X W;  4R0A A;  1XCD A;  4GLP A;  4G8A A;  4R6F A;  4BSU A;  4R09 A;  1G9U A;  2WFH A;  3OGM B;  3RGZ A;  4FDW A;  5B4P A;  1U0N D;  2IFG A;  4ECN A;  3W3K A;  5D3I A;  4ECO A;  3CIG A;  2JE0 A;  3VQ2 A;  4LSX A;  1W8A A;  2P1Q B;  1O6S A;  4Z61 C;  5B0N A;  5CMN A;  2V9S A;  4J4L A;  1OTM A;  3C6O B;  2OMY A;  2UZX A;  4P91 A;  2Z66 A;  4TZH A;  3RW6 A;  1FS2 A;  2R9U A;  1H6U A;  3W3L A;  3ZYJ A;  3VQ1 A;  1K5G C;  2XOT A;  3ULU A;  3E6J A;  3RGX A;  2Q4G W;  5IYX C;  3UL8 A;  3CIY A;  3SB4 A;  4FCG A;  1KOH A;  2OMT A;  5IJC A;  4R5C A;  4LI2 A;  1M9L A;  4Q3G A;  3E3Z A;  5AWC A;  3ZYI A;  3WPD A;  2Z81 A;  2ASS B;  2JQD A;  1O6V A;  3ZYO A;  1A4Y A;  3WPF A;  4RCA B;  1JL5 A;  4U09 A;  4C2B B;  1P9A G;  3OGL B;  3RFE A;  3DZE A;  2V70 A;  3WPC A;  4V2C A;  2WQU A;  3OJA B;  5AWB A;  1XWD C;  3O6N A;  3W3G A;  3WPB A;  3RJ0 A;  4LSA A;  2OMW A;  2FT3 A;  4H09 A;  1IO0 A;  3RFJ A;  4CC4 A;  2BNH A;  4B8C D;  3CVR A;  5HZL B;  4FHO A;  3OJA A;  5GQR K;  3OGK B;  4MN8 B;  2OMV A;  4CIL A;  2ID5 A;  2P1P B;  2Z63 A;  5AWA A;  1DCE A;  4RCW A;  3A79 B;  3UL9 A;  4ARN A;  3FXI A;  4LSX C;  2Z62 A;  2Z64 A;  3PMH G;  1P8T A;  5GS0 A;  1DS9 A;  4R58 A;  4MQW X;  2Y5Q A;  4L3A A;  4BSR A;  4AY9 X;  2WQX A;  4Q3I A;  2Z65 A;  1OZN A;  5FTT B;  4KT1 A;  3WPG A;  4KNG A;  3TSR E;  5GMH A;  3C6N B;  4U08 A;  1O6T A;  4LXS A;  4LSC A;  3BZ5 A;  2AST B;  4FD0 A;  4XSQ A;  3E4G A;  5CMP A;  4P8S A;  2OMX A;  5A5C A;  1OTO A;  4FS7 A;  5GMF A;  3E2J A;  2O6Q A;  1PGV A;  1A9N A;  4M7E C;  4R5D A;  4U7L A;  4M7E A;  5IJD A;  2V9T B;  2RA8 A;  4BSS A;  2O6S A;  4K17 A;  1GWB A;  1M0Z A;  2Z7X B;  3M18 A;  3G04 C;  3RIZ A;  4Z8G A;  3W3N A;  1H6T A;  4R6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...