4U06A

Structure of leptospira interrogans lrr protein lic10831
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
TYRDLTKALQNPLEVRVLDLSRQELKTLPIEIGKLKNLQRLYLHYNQLTVLPQEIEQLKNLQLLYLRSNRLTTLPKEIEQLKNLQVLDLGSNQLTVLPQEIGQLKNLQLLYLHSNRLTTLSKDIEQLQNLKSLDLSNNQLTTLPNEIEQLKNLKSLYLSENQFATFPKEIGQLQNLKVLFLNNNQITILPNEIAKLKKLQYLYLSDNQLITLPKEIEQLKNLQTLDLSYNQLMILPKEVGQLENLQTLDLRNNQLKTLPKEIEQLKNLQTLFLSNNQLTILPQEIGKLKNLLWLSLVYNQLTTLPNEIEQLKNLQTLYLNNNQFSSQEKKRIRKLLPKCQIYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIC10831
publication title Structural characterization of a novel subfamily of leucine-rich repeat proteins from the human pathogen Leptospira interrogans.
pubmed doi rcsb
source organism Leptospira interrogans serovar copenhageni str. fiocruz l1-130
molecule tags Unknown function
total genus 135
structure length 344
sequence length 344
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4u06A00
3RGZA 4LSAA 2WQXA 3WPIA 3RFEA 3RW6A 4AY9X 4M7EA 4LXSA 5IJCA 3WPFA 3ZYOA 5IJDA 2WFHA 3E6JA 3O6NA 4G8AA 2V9TB 3A79B 1OTNA 3OGKB 2UZXA 3RJ0A 1K5DC 4B8CD 4V2CA 1M9LA 2Z7XB 3ZYJA 5GQRK 5GMFA 1XEUA 2JE0A 4V2EA 2ASTB 4CNCA 3ZYNA 3CVRA 1OGQA 3E4GA 4YEBB 3BZ5A 5GS2B 1SQ0B 3UL9A 2ELLA 2RR6A 4CP6A 4PEQB 4LI1A 4ECNA 5B4PA 4LSXC 1M0ZA 2XOTA 3G3BA 4R07A 3SB4A 4WYKA 2ASSB 2BEXA 3WPBA 1P8VA 4U06A 2OMZA 2BNHA 4TZHA 4ECOA 2P1QB 3WPDA 1O6TA 4I6JB 4Z79A 4PERA 5A5CA 4FS7A 3G04C 2P1MB 3C6OB 4OQTA 4QC0A 3OGMB 4CC4C 4C2AB 4Z61C 2IFGA 2Z65A 4MN8B 3CIYA 3G06A 1KOOA 3WPEA 4QXEA 2O6SA 2JE1A 2Q4GW 4Z94G 4EZGA 2WQWA 4FD0A 4J0MA 3ULVA 5CMPA 3DZEA 3OGLB 2JQDA 2CA6A 5B0TA 1M9SA 2OMUA 1FS2A 4AW4A 3OJAB 3G3AA 4H09A 4CNMA 1GWBA 3JB9j 1FO1A 1O6SA 1H6TA 4FDWA 1WWLA 1Z7XW 4GLPA 3WN4A 3C6PB 5AWCA 1YRGA 4PKIG 4M7EC 4LSCA 5FTTB 2Z64A 2P1NB 3W3JA 4PQ8A 1ZIWA 4Z8GA 1A9NA 2OMVA 4PSJA 4RCAB 5AWBA 1OOKG 5B0NA 4K17A 1QYYA 1KOHA 1P8TA 5LFNA 1D0BA 3PMHG 2ID5A 4CILA 4Y61B 4U7LA 1FT8A 3OJAA 3ULAA 3O53A 3W3NA 4KT1A 3WPGA 4R6JA 1DCEA 1K5GC 1XKUA 4WP6A 1A4YA 1PGVA 3M19A 2Z63A 4BV4R 3KJ4A 3E3ZA 4NKHA 4C2BB 2V70A 2O6RA 5HZLB 4KXFB 2Y5QA 4R6FA 3RIZA 1M10B 1DS9A 4BSSA 5GMHA 1P9AG 4P8SA 2RA8A 4J4LA 3ZYIA 3RFSA 4R08A 3REZA 4BSRA 1XCDA 5HDHA 1H6UA 1U0ND 1IO0A 1OZNA 3TSRE 3ULUA 1JL5A 4L3AA 4R6GA 2OMWA 3UN9A 1LTXA 4R58A 4V2DA 3C6NB 1FQVA 2O6QA 4ARNA 1W8AA 3M18A 4MQWX 2OMTA 2R9UA 2Z82A 4Q62A 4R5DA 1OTMA 2V9SA 2WQVA 2XWTC 4LSXA 4UFRA 4XOSA 3RW7A 2OMXA 5IYXC 4R5CA 1G9UA 1O6VA 2Z66A 3W3KA 3G39A 3WPCA 1XECA 4LXRA 3UL8A 4LI2A 4GT6A 4HQ1A 3GOZA 5AZ5A 4R0AA 3P72A 5IJBA 4IM6A 4FMZA 3VQ1A 4Q3GA 4XGOA 3E2JA 3W3GA 4XSQA 3CIGA 2FT3A 2WQUA 2Z62A 4FHOA 5GMGA 4L3FA 1XWDC 2P1PB 4Q3IA 4CC4A 4RWTC 4R09A 3RGXA 4U08A 3W3MA 5GS0A 3UL7A 4NKGA 3W3LA 2P1OB 2Z7XA 3VQ2A 4R6AA 4P91A 3RFJA 4BSUA 3FXIA 4U09A 2Z81A 1OTOA 2UZYA 1DFJI 5D3IA 5AWDA 4ARRA 4FCGA 4QBZA 2A0ZA 4KNGA 3WPHA 5AWAA 4RCWA 4Z64C 5CMNA 2OMYA
chains in the Genus database with same CATH superfamily
3RGZA 4LSAA 2WQXA 3WPIA 3RFEA 3RW6A 4AY9X 4M7EA 4LXSA 5IJCA 3WPFA 3ZYOA 5IJDA 4NZRM 2WFHA 3E6JA 3O6NA 4G8AA 2V9TB 3A79B 1OTNA 3OGKB 2UZXA 3RJ0A 1K5DC 4B8CD 4V2CA 1M9LA 2Z7XB 3ZYJA 5GQRK 5GMFA 1XEUA 2JE0A 4V2EA 2ASTB 4CNCA 3ZYNA 3CVRA 1OGQA 3E4GA 4YEBB 3BZ5A 5GS2B 1SQ0B 3UL9A 2ELLA 2RR6A 4CP6A 4PEQB 4LI1A 4ECNA 5B4PA 4LSXC 1M0ZA 2XOTA 3G3BA 4NZTM 4R07A 3SB4A 4WYKA 2ASSB 2BEXA 3WPBA 1P8VA 4U06A 2OMZA 2BNHA 4TZHA 4ECOA 2P1QB 3WPDA 1O6TA 4I6JB 4Z79A 4PERA 5A5CA 4FS7A 3G04C 2P1MB 3C6OB 4OQTA 4QC0A 3OGMB 4CC4C 4C2AB 4Z61C 2IFGA 2Z65A 4MN8B 3CIYA 3G06A 1KOOA 3WPEA 4QXEA 2O6SA 2JE1A 2Q4GW 4Z94G 4EZGA 2WQWA 4FD0A 4J0MA 3ULVA 5CMPA 3DZEA 3OGLB 2JQDA 2CA6A 5B0TA 1M9SA 2OMUA 1FS2A 4AW4A 3OJAB 3G3AA 4H09A 4CNMA 1GWBA 3JB9j 1FO1A 1O6SA 1H6TA 4FDWA 1WWLA 1Z7XW 4GLPA 3WN4A 3C6PB 5AWCA 1YRGA 4PKIG 4M7EC 4LSCA 5FTTB 2Z64A 2P1NB 3W3JA 4PQ8A 1ZIWA 4Z8GA 1A9NA 2OMVA 4PSJA 4RCAB 5AWBA 1OOKG 5B0NA 4K17A 1QYYA 1KOHA 1P8TA 5LFNA 1D0BA 3PMHG 2ID5A 4CILA 4Y61B 4U7LA 1FT8A 3OJAA 3ULAA 3O53A 3W3NA 4KT1A 3WPGA 4R6JA 1DCEA 1K5GC 1XKUA 4WP6A 1A4YA 1PGVA 3M19A 2Z63A 4BV4R 3KJ4A 3E3ZA 4NKHA 4C2BB 2V70A 2O6RA 5HZLB 4KXFB 2Y5QA 4R6FA 3RIZA 1M10B 1DS9A 4BSSA 5GMHA 1P9AG 4P8SA 2RA8A 4J4LA 3ZYIA 3RFSA 4R08A 3REZA 4BSRA 1XCDA 5HDHA 1H6UA 1U0ND 1IO0A 1OZNA 3TSRE 3ULUA 1JL5A 4L3AA 4R6GA 2OMWA 3UN9A 1LTXA 4R58A 4V2DA 3C6NB 1FQVA 2O6QA 4ARNA 1W8AA 3M18A 4MQWX 2OMTA 2R9UA 2Z82A 4Q62A 4R5DA 1OTMA 2V9SA 2WQVA 2XWTC 4LSXA 4UFRA 4XOSA 3RW7A 2OMXA 5IYXC 4R5CA 1G9UA 1O6VA 2Z66A 3W3KA 3G39A 3WPCA 1XECA 4LXRA 3UL8A 4LI2A 4GT6A 4HQ1A 3GOZA 5AZ5A 4R0AA 3P72A 5IJBA 4IM6A 4FMZA 3VQ1A 4Q3GA 4XGOA 3E2JA 3W3GA 4XSQA 3CIGA 2FT3A 2WQUA 2Z62A 4FHOA 5GMGA 4L3FA 1XWDC 2P1PB 4Q3IA 4CC4A 4RWTC 4R09A 3RGXA 4U08A 3W3MA 5GS0A 3UL7A 4NKGA 3W3LA 2P1OB 2Z7XA 3VQ2A 4R6AA 4P91A 3RFJA 4BSUA 3FXIA 4U09A 2Z81A 1OTOA 2UZYA 1DFJI 5D3IA 5AWDA 4ARRA 4FCGA 4QBZA 2A0ZA 4KNGA 3WPHA 5AWAA 4RCWA 4Z64C 5CMNA 2OMYA
chains in the Genus database with same CATH topology
3RGZA 4LSAA 2WQXA 3WPIA 3RFEA 3RW6A 4AY9X 4M7EA 4LXSA 5IJCA 3WPFA 3ZYOA 5IJDA 2WFHA 3E6JA 3O6NA 4G8AA 2V9TB 3A79B 1OTNA 3OGKB 2UZXA 3RJ0A 1K5DC 4B8CD 4V2CA 1M9LA 2Z7XB 3ZYJA 5GQRK 5GMFA 1XEUA 2JE0A 4V2EA 2ASTB 4CNCA 3ZYNA 3CVRA 1OGQA 3E4GA 4YEBB 3BZ5A 5GS2B 1SQ0B 3UL9A 2ELLA 2RR6A 4CP6A 4PEQB 4LI1A 4ECNA 5B4PA 4LSXC 1M0ZA 2XOTA 3G3BA 4R07A 3SB4A 4WYKA 2ASSB 2BEXA 3WPBA 1P8VA 4U06A 2OMZA 2BNHA 4TZHA 4ECOA 2P1QB 3WPDA 1O6TA 4I6JB 4Z79A 4PERA 5A5CA 4FS7A 3G04C 2P1MB 3C6OB 4OQTA 4QC0A 3OGMB 4CC4C 4C2AB 4Z61C 2IFGA 2Z65A 4MN8B 3CIYA 3G06A 1KOOA 3WPEA 4QXEA 2O6SA 2JE1A 2Q4GW 4Z94G 4EZGA 2WQWA 4FD0A 4J0MA 3ULVA 5CMPA 3DZEA 3OGLB 2JQDA 2CA6A 5B0TA 1M9SA 2OMUA 1FS2A 4AW4A 3OJAB 3G3AA 4H09A 4CNMA 1GWBA 3JB9j 1FO1A 1O6SA 1H6TA 4FDWA 1WWLA 1Z7XW 4GLPA 3WN4A 3C6PB 5AWCA 1YRGA 4PKIG 4M7EC 4LSCA 5FTTB 2Z64A 2P1NB 3W3JA 4PQ8A 1ZIWA 4Z8GA 1A9NA 2OMVA 4PSJA 4RCAB 5AWBA 1OOKG 5B0NA 4K17A 1QYYA 1KOHA 1P8TA 5LFNA 1D0BA 3PMHG 2ID5A 4CILA 4Y61B 4U7LA 1FT8A 3OJAA 3ULAA 3O53A 3W3NA 4KT1A 3WPGA 4R6JA 1DCEA 1K5GC 1XKUA 4WP6A 1A4YA 1PGVA 3M19A 2Z63A 4BV4R 3KJ4A 3E3ZA 4NKHA 4C2BB 2V70A 2O6RA 5HZLB 4KXFB 2Y5QA 4R6FA 3RIZA 1M10B 1DS9A 4BSSA 5GMHA 1P9AG 4P8SA 2RA8A 4J4LA 3ZYIA 3RFSA 4R08A 3REZA 4BSRA 1XCDA 5HDHA 1H6UA 1U0ND 1IO0A 1OZNA 3TSRE 3ULUA 1JL5A 4L3AA 4R6GA 2OMWA 3UN9A 1LTXA 4R58A 4V2DA 3C6NB 1FQVA 2O6QA 4ARNA 1W8AA 3M18A 4MQWX 2OMTA 2R9UA 2Z82A 4Q62A 4R5DA 1OTMA 2V9SA 2WQVA 2XWTC 4LSXA 4UFRA 4XOSA 3RW7A 2OMXA 5IYXC 4R5CA 1G9UA 1O6VA 2Z66A 3W3KA 3G39A 3WPCA 1XECA 4LXRA 3UL8A 4LI2A 4GT6A 4HQ1A 3GOZA 5AZ5A 4R0AA 3P72A 5IJBA 4IM6A 4FMZA 3VQ1A 4Q3GA 4XGOA 3E2JA 3W3GA 4XSQA 3CIGA 2FT3A 2WQUA 2Z62A 4FHOA 5GMGA 4L3FA 1XWDC 2P1PB 4Q3IA 4CC4A 4RWTC 4R09A 3RGXA 4U08A 3W3MA 5GS0A 3UL7A 4NKGA 3W3LA 2P1OB 2Z7XA 3VQ2A 4R6AA 4P91A 3RFJA 4BSUA 3FXIA 4U09A 2Z81A 1OTOA 2UZYA 1DFJI 5D3IA 5AWDA 4ARRA 4FCGA 4QBZA 2A0ZA 4KNGA 3WPHA 5AWAA 4RCWA 4Z64C 5CMNA 2OMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGZ A;  4LSA A;  2WQX A;  3WPI A;  3RFE A;  3RW6 A;  4AY9 X;  4M7E A;  4LXS A;  5IJC A;  3WPF A;  3ZYO A;  5IJD A;  2WFH A;  3E6J A;  3O6N A;  4G8A A;  2V9T B;  3A79 B;  1OTN A;  3OGK B;  2UZX A;  3RJ0 A;  1K5D C;  4B8C D;  4V2C A;  1M9L A;  2Z7X B;  3ZYJ A;  5GQR K;  5GMF A;  1XEU A;  2JE0 A;  4V2E A;  2AST B;  4CNC A;  3ZYN A;  3CVR A;  1OGQ A;  3E4G A;  4YEB B;  3BZ5 A;  5GS2 B;  1SQ0 B;  3UL9 A;  2ELL A;  2RR6 A;  4CP6 A;  4PEQ B;  4LI1 A;  4ECN A;  5B4P A;  4LSX C;  1M0Z A;  2XOT A;  3G3B A;  4R07 A;  3SB4 A;  4WYK A;  2ASS B;  2BEX A;  3WPB A;  1P8V A;  4U06 A;  2OMZ A;  2BNH A;  4TZH A;  4ECO A;  2P1Q B;  3WPD A;  1O6T A;  4I6J B;  4Z79 A;  4PER A;  5A5C A;  4FS7 A;  3G04 C;  2P1M B;  3C6O B;  4OQT A;  4QC0 A;  3OGM B;  4CC4 C;  4C2A B;  4Z61 C;  2IFG A;  2Z65 A;  4MN8 B;  3CIY A;  3G06 A;  1KOO A;  3WPE A;  4QXE A;  2O6S A;  2JE1 A;  2Q4G W;  4Z94 G;  4EZG A;  2WQW A;  4FD0 A;  4J0M A;  3ULV A;  5CMP A;  3DZE A;  3OGL B;  2JQD A;  2CA6 A;  5B0T A;  1M9S A;  2OMU A;  1FS2 A;  4AW4 A;  3OJA B;  3G3A A;  4H09 A;  4CNM A;  1GWB A;  3JB9 j;  1FO1 A;  1O6S A;  1H6T A;  4FDW A;  1WWL A;  1Z7X W;  4GLP A;  3WN4 A;  3C6P B;  5AWC A;  1YRG A;  4PKI G;  4M7E C;  4LSC A;  5FTT B;  2Z64 A;  2P1N B;  3W3J A;  4PQ8 A;  1ZIW A;  4Z8G A;  1A9N A;  2OMV A;  4PSJ A;  4RCA B;  5AWB A;  1OOK G;  5B0N A;  4K17 A;  1QYY A;  1KOH A;  1P8T A;  5LFN A;  1D0B A;  3PMH G;  2ID5 A;  4CIL A;  4Y61 B;  4U7L A;  1FT8 A;  3OJA A;  3ULA A;  3O53 A;  3W3N A;  4KT1 A;  3WPG A;  4R6J A;  1DCE A;  1K5G C;  1XKU A;  4WP6 A;  1A4Y A;  1PGV A;  3M19 A;  2Z63 A;  4BV4 R;  3KJ4 A;  3E3Z A;  4NKH A;  4C2B B;  2V70 A;  2O6R A;  5HZL B;  4KXF B;  2Y5Q A;  4R6F A;  3RIZ A;  1M10 B;  1DS9 A;  4BSS A;  5GMH A;  1P9A G;  4P8S A;  2RA8 A;  4J4L A;  3ZYI A;  3RFS A;  4R08 A;  3REZ A;  4BSR A;  1XCD A;  5HDH A;  1H6U A;  1U0N D;  1IO0 A;  1OZN A;  3TSR E;  3ULU A;  1JL5 A;  4L3A A;  4R6G A;  2OMW A;  3UN9 A;  1LTX A;  4R58 A;  4V2D A;  3C6N B;  1FQV A;  2O6Q A;  4ARN A;  1W8A A;  3M18 A;  4MQW X;  2OMT A;  2R9U A;  2Z82 A;  4Q62 A;  4R5D A;  1OTM A;  2V9S A;  2WQV A;  2XWT C;  4LSX A;  4UFR A;  4XOS A;  3RW7 A;  2OMX A;  5IYX C;  4R5C A;  1G9U A;  1O6V A;  2Z66 A;  3W3K A;  3G39 A;  3WPC A;  1XEC A;  4LXR A;  3UL8 A;  4LI2 A;  4GT6 A;  4HQ1 A;  3GOZ A;  5AZ5 A;  4R0A A;  3P72 A;  5IJB A;  4IM6 A;  4FMZ A;  3VQ1 A;  4Q3G A;  4XGO A;  3E2J A;  3W3G A;  4XSQ A;  3CIG A;  2FT3 A;  2WQU A;  2Z62 A;  4FHO A;  5GMG A;  4L3F A;  1XWD C;  2P1P B;  4Q3I A;  4CC4 A;  4RWT C;  4R09 A;  3RGX A;  4U08 A;  3W3M A;  5GS0 A;  3UL7 A;  4NKG A;  3W3L A;  2P1O B;  2Z7X A;  3VQ2 A;  4R6A A;  4P91 A;  3RFJ A;  4BSU A;  3FXI A;  4U09 A;  2Z81 A;  1OTO A;  2UZY A;  1DFJ I;  5D3I A;  5AWD A;  4ARR A;  4FCG A;  4QBZ A;  2A0Z A;  4KNG A;  3WPH A;  5AWA A;  4RCW A;  4Z64 C;  5CMN A;  2OMY A; 
#chains in the Genus database with same CATH topology
 3RGZ A;  4LSA A;  2WQX A;  3WPI A;  3RFE A;  3RW6 A;  4AY9 X;  4M7E A;  4LXS A;  5IJC A;  3WPF A;  3ZYO A;  5IJD A;  4NZR M;  2WFH A;  3E6J A;  3O6N A;  4G8A A;  2V9T B;  3A79 B;  1OTN A;  3OGK B;  2UZX A;  3RJ0 A;  1K5D C;  4B8C D;  4V2C A;  1M9L A;  2Z7X B;  3ZYJ A;  5GQR K;  5GMF A;  1XEU A;  2JE0 A;  4V2E A;  2AST B;  4CNC A;  3ZYN A;  3CVR A;  1OGQ A;  3E4G A;  4YEB B;  3BZ5 A;  5GS2 B;  1SQ0 B;  3UL9 A;  2ELL A;  2RR6 A;  4CP6 A;  4PEQ B;  4LI1 A;  4ECN A;  5B4P A;  4LSX C;  1M0Z A;  2XOT A;  3G3B A;  4NZT M;  4R07 A;  3SB4 A;  4WYK A;  2ASS B;  2BEX A;  3WPB A;  1P8V A;  4U06 A;  2OMZ A;  2BNH A;  4TZH A;  4ECO A;  2P1Q B;  3WPD A;  1O6T A;  4I6J B;  4Z79 A;  4PER A;  5A5C A;  4FS7 A;  3G04 C;  2P1M B;  3C6O B;  4OQT A;  4QC0 A;  3OGM B;  4CC4 C;  4C2A B;  4Z61 C;  2IFG A;  2Z65 A;  4MN8 B;  3CIY A;  3G06 A;  1KOO A;  3WPE A;  4QXE A;  2O6S A;  2JE1 A;  2Q4G W;  4Z94 G;  4EZG A;  2WQW A;  4FD0 A;  4J0M A;  3ULV A;  5CMP A;  3DZE A;  3OGL B;  2JQD A;  2CA6 A;  5B0T A;  1M9S A;  2OMU A;  1FS2 A;  4AW4 A;  3OJA B;  3G3A A;  4H09 A;  4CNM A;  1GWB A;  3JB9 j;  1FO1 A;  1O6S A;  1H6T A;  4FDW A;  1WWL A;  1Z7X W;  4GLP A;  3WN4 A;  3C6P B;  5AWC A;  1YRG A;  4PKI G;  4M7E C;  4LSC A;  5FTT B;  2Z64 A;  2P1N B;  3W3J A;  4PQ8 A;  1ZIW A;  4Z8G A;  1A9N A;  2OMV A;  4PSJ A;  4RCA B;  5AWB A;  1OOK G;  5B0N A;  4K17 A;  1QYY A;  1KOH A;  1P8T A;  5LFN A;  1D0B A;  3PMH G;  2ID5 A;  4CIL A;  4Y61 B;  4U7L A;  1FT8 A;  3OJA A;  3ULA A;  3O53 A;  3W3N A;  4KT1 A;  3WPG A;  4R6J A;  1DCE A;  1K5G C;  1XKU A;  4WP6 A;  1A4Y A;  1PGV A;  3M19 A;  2Z63 A;  4BV4 R;  3KJ4 A;  3E3Z A;  4NKH A;  4C2B B;  2V70 A;  2O6R A;  5HZL B;  4KXF B;  2Y5Q A;  4R6F A;  3RIZ A;  1M10 B;  1DS9 A;  4BSS A;  5GMH A;  1P9A G;  4P8S A;  2RA8 A;  4J4L A;  3ZYI A;  3RFS A;  4R08 A;  3REZ A;  4BSR A;  1XCD A;  5HDH A;  1H6U A;  1U0N D;  1IO0 A;  1OZN A;  3TSR E;  3ULU A;  1JL5 A;  4L3A A;  4R6G A;  2OMW A;  3UN9 A;  1LTX A;  4R58 A;  4V2D A;  3C6N B;  1FQV A;  2O6Q A;  4ARN A;  1W8A A;  3M18 A;  4MQW X;  2OMT A;  2R9U A;  2Z82 A;  4Q62 A;  4R5D A;  1OTM A;  2V9S A;  2WQV A;  2XWT C;  4LSX A;  4UFR A;  4XOS A;  3RW7 A;  2OMX A;  5IYX C;  4R5C A;  1G9U A;  1O6V A;  2Z66 A;  3W3K A;  3G39 A;  3WPC A;  1XEC A;  4LXR A;  3UL8 A;  4LI2 A;  4GT6 A;  4HQ1 A;  3GOZ A;  5AZ5 A;  4R0A A;  3P72 A;  5IJB A;  4IM6 A;  4FMZ A;  3VQ1 A;  4Q3G A;  4XGO A;  3E2J A;  3W3G A;  4XSQ A;  3CIG A;  2FT3 A;  2WQU A;  2Z62 A;  4FHO A;  5GMG A;  4L3F A;  1XWD C;  2P1P B;  4Q3I A;  4CC4 A;  4RWT C;  4R09 A;  3RGX A;  4U08 A;  3W3M A;  5GS0 A;  3UL7 A;  4NKG A;  3W3L A;  2P1O B;  2Z7X A;  3VQ2 A;  4R6A A;  4P91 A;  3RFJ A;  4BSU A;  3FXI A;  4U09 A;  2Z81 A;  1OTO A;  2UZY A;  1DFJ I;  5D3I A;  5AWD A;  4ARR A;  4FCG A;  4QBZ A;  2A0Z A;  4KNG A;  3WPH A;  5AWA A;  4RCW A;  4Z64 C;  5CMN A;  2OMY A; 
#chains in the Genus database with same CATH homology
 3RGZ A;  4LSA A;  2WQX A;  3WPI A;  3RFE A;  3RW6 A;  4AY9 X;  4M7E A;  4LXS A;  5IJC A;  3WPF A;  3ZYO A;  5IJD A;  2WFH A;  3E6J A;  3O6N A;  4G8A A;  2V9T B;  3A79 B;  1OTN A;  3OGK B;  2UZX A;  3RJ0 A;  1K5D C;  4B8C D;  4V2C A;  1M9L A;  2Z7X B;  3ZYJ A;  5GQR K;  5GMF A;  1XEU A;  2JE0 A;  4V2E A;  2AST B;  4CNC A;  3ZYN A;  3CVR A;  1OGQ A;  3E4G A;  4YEB B;  3BZ5 A;  5GS2 B;  1SQ0 B;  3UL9 A;  2ELL A;  2RR6 A;  4CP6 A;  4PEQ B;  4LI1 A;  4ECN A;  5B4P A;  4LSX C;  1M0Z A;  2XOT A;  3G3B A;  4R07 A;  3SB4 A;  4WYK A;  2ASS B;  2BEX A;  3WPB A;  1P8V A;  4U06 A;  2OMZ A;  2BNH A;  4TZH A;  4ECO A;  2P1Q B;  3WPD A;  1O6T A;  4I6J B;  4Z79 A;  4PER A;  5A5C A;  4FS7 A;  3G04 C;  2P1M B;  3C6O B;  4OQT A;  4QC0 A;  3OGM B;  4CC4 C;  4C2A B;  4Z61 C;  2IFG A;  2Z65 A;  4MN8 B;  3CIY A;  3G06 A;  1KOO A;  3WPE A;  4QXE A;  2O6S A;  2JE1 A;  2Q4G W;  4Z94 G;  4EZG A;  2WQW A;  4FD0 A;  4J0M A;  3ULV A;  5CMP A;  3DZE A;  3OGL B;  2JQD A;  2CA6 A;  5B0T A;  1M9S A;  2OMU A;  1FS2 A;  4AW4 A;  3OJA B;  3G3A A;  4H09 A;  4CNM A;  1GWB A;  3JB9 j;  1FO1 A;  1O6S A;  1H6T A;  4FDW A;  1WWL A;  1Z7X W;  4GLP A;  3WN4 A;  3C6P B;  5AWC A;  1YRG A;  4PKI G;  4M7E C;  4LSC A;  5FTT B;  2Z64 A;  2P1N B;  3W3J A;  4PQ8 A;  1ZIW A;  4Z8G A;  1A9N A;  2OMV A;  4PSJ A;  4RCA B;  5AWB A;  1OOK G;  5B0N A;  4K17 A;  1QYY A;  1KOH A;  1P8T A;  5LFN A;  1D0B A;  3PMH G;  2ID5 A;  4CIL A;  4Y61 B;  4U7L A;  1FT8 A;  3OJA A;  3ULA A;  3O53 A;  3W3N A;  4KT1 A;  3WPG A;  4R6J A;  1DCE A;  1K5G C;  1XKU A;  4WP6 A;  1A4Y A;  1PGV A;  3M19 A;  2Z63 A;  4BV4 R;  3KJ4 A;  3E3Z A;  4NKH A;  4C2B B;  2V70 A;  2O6R A;  5HZL B;  4KXF B;  2Y5Q A;  4R6F A;  3RIZ A;  1M10 B;  1DS9 A;  4BSS A;  5GMH A;  1P9A G;  4P8S A;  2RA8 A;  4J4L A;  3ZYI A;  3RFS A;  4R08 A;  3REZ A;  4BSR A;  1XCD A;  5HDH A;  1H6U A;  1U0N D;  1IO0 A;  1OZN A;  3TSR E;  3ULU A;  1JL5 A;  4L3A A;  4R6G A;  2OMW A;  3UN9 A;  1LTX A;  4R58 A;  4V2D A;  3C6N B;  1FQV A;  2O6Q A;  4ARN A;  1W8A A;  3M18 A;  4MQW X;  2OMT A;  2R9U A;  2Z82 A;  4Q62 A;  4R5D A;  1OTM A;  2V9S A;  2WQV A;  2XWT C;  4LSX A;  4UFR A;  4XOS A;  3RW7 A;  2OMX A;  5IYX C;  4R5C A;  1G9U A;  1O6V A;  2Z66 A;  3W3K A;  3G39 A;  3WPC A;  1XEC A;  4LXR A;  3UL8 A;  4LI2 A;  4GT6 A;  4HQ1 A;  3GOZ A;  5AZ5 A;  4R0A A;  3P72 A;  5IJB A;  4IM6 A;  4FMZ A;  3VQ1 A;  4Q3G A;  4XGO A;  3E2J A;  3W3G A;  4XSQ A;  3CIG A;  2FT3 A;  2WQU A;  2Z62 A;  4FHO A;  5GMG A;  4L3F A;  1XWD C;  2P1P B;  4Q3I A;  4CC4 A;  4RWT C;  4R09 A;  3RGX A;  4U08 A;  3W3M A;  5GS0 A;  3UL7 A;  4NKG A;  3W3L A;  2P1O B;  2Z7X A;  3VQ2 A;  4R6A A;  4P91 A;  3RFJ A;  4BSU A;  3FXI A;  4U09 A;  2Z81 A;  1OTO A;  2UZY A;  1DFJ I;  5D3I A;  5AWD A;  4ARR A;  4FCG A;  4QBZ A;  2A0Z A;  4KNG A;  3WPH A;  5AWA A;  4RCW A;  4Z64 C;  5CMN A;  2OMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...