3REZA

Glycoprotein gpib variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
113
Chain Sequence
PCPAPCSCAGTLVDCGRRGLTALPALPARTTELVLTGNNLTSVPPGAFDHLPQLRTAHLGANPWRCDCSLTYLRLWLEDRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib beta chain, Platelet glycoprotein I
publication title Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIb beta and a GPIb beta/GPIX chimera
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 32
structure length 113
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01463 LRRCT Leucine rich repeat C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rezA00
3O53A 3UL7A 2Z62A 3W3LA 3OGMB 1WWLA 2P1OB 3W3KA 1DFJI 2P1NB 3O6NA 2P1QB 4BSRA 1XECA 5GMFA 2XWTC 1FT8A 5AWCA 4FS7A 4GT6A 4PEQB 4WP6A 4C2AB 2V9TB 4RCAB 1D0BA 3ULUA 3W3JA 2OMUA 3CVRA 4TZHA 2WQUA 1K5DC 1M9LA 3VQ2A 4PQ8A 5HDHA 4AW4A 3UL9A 4R07A 2JE0A 4R0AA 1W8AA 4R08A 3RGXA 4KXFB 2O6SA 5GMHA 3OJAB 4ECNA 4YEBB 3E3ZA 4C2BB 2Z66A 4MQWX 3C6OB 2Z65A 4FHOA 1JL5A 4CILA 4BSUA 4Z94G 3ZYJA 4R6AA 4NKHA 4IM6A 3OGLB 4FMZA 4M7EC 5FTTB 5AZ5A 4V2DA 4Z61C 1DS9A 2P1MB 4LSCA 3E6JA 1Z7XW 1M10B 2XOTA 2OMXA 5CMPA 2ELLA 1OTNA 3OGKB 3P72A 3G3AA 4CC4A 2Z82A 5HZLB 1OZNA 2FT3A 1IO0A 3BZ5A 1OTMA 1SQ0B 2OMTA 5IJCA 1DCEA 3W3NA 4FD0A 4PSJA 4Y61B 5B4PA 1KOHA 5CMNA 3TSRE 1FQVA 1XKUA 2A0ZA 3WPFA 3WPCA 1P8VA 1M0ZA 4M7EA 3WPGA 1ZIWA 3RGZA 2UZXA 4UFRA 5A5CA 2ID5A 2Z7XA 2JE1A 3SB4A 4NKGA 4XSQA 1PGVA 4ECOA 4I6JB 3E4GA 4AY9X 4GLPA 2ASSB 4KT1A 5GQRK 1U0ND 4CC4C 4J4LA 1O6TA 4Q62A 5B0NA 1XEUA 4PERA 3VQ1A 3RJ0A 5GS0A 4FDWA 3WPIA 4L3FA 4Q3IA 3GOZA 1OTOA 2OMZA 3WPDA 3WPHA 4RCWA 3WN4A 2CA6A 4ARNA 3KJ4A 3RFJA 1XCDA 4LXRA 3PMHG 3ZYIA 1O6SA 4LI2A 1GWBA 4XOSA 2UZYA 2BNHA 2V9SA 2OMYA 4RWTC 1O6VA 2JQDA 4R58A 3UL8A 3WPBA 3DZEA 3M19A 4R6FA 2V70A 4OQTA 4U09A 4Z79A 3ULVA 4LI1A 2Z81A 2RA8A 3RFSA 5IYXC 3E2JA 4K17A 2WQWA 4KNGA 3CIGA 4BV4R 1G9UA 1M9SA 2Z64A 4ARRA 4BSSA 4V2CA 3G3BA 2OMWA 1P9AG 3W3GA 4P91A 2O6QA 1H6TA 1A4YA 2Y5QA 4R09A 5AWAA 1A9NA 4CP6A 2IFGA 2O6RA 2WFHA 3ZYNA 2OMVA 1YRGA 1KOOA 3CIYA 4P8SA 2ASTB 5B0TA 4XGOA 4U06A 4V2EA 1H6UA 3C6NB 4PKIG 3REZA 4QBZA 4R5DA 5LFNA 3ZYOA 4G8AA 3G39A 4LSXA 5GS2B 4EZGA 4LSAA 5GMGA 5IJDA 4U7LA 1K5GC 4WYKA 1QYYA 2BEXA 3ULAA 5IJBA 3UN9A 2RR6A 2Z63A 3JB9j 2Q4GW 1OOKG 4R5CA 3RIZA 5D3IA 3RW6A 1XWDC 1OGQA 4R6JA 4R6GA 3G04C 4H09A 4Z64C 2R9UA 3C6PB 4LXSA 4QXEA 2WQXA 4MN8B 3W3MA 3A79B 2Z7XB 4FCGA 3M18A 4Q3GA 4J0MA 2P1PB 4HQ1A 1FO1A 4B8CD 1P8TA 1LTXA 2WQVA 4LSXC 1FS2A 5AWBA 3RFEA 4CNCA 4QC0A 4CNMA 3OJAA 4Z8GA 3RW7A 4L3AA 3WPEA 3FXIA 5AWDA 3G06A 4U08A
chains in the Genus database with same CATH superfamily
3O53A 3UL7A 2Z62A 3W3LA 3OGMB 1WWLA 2P1OB 3W3KA 1DFJI 2P1NB 3O6NA 2P1QB 4BSRA 1XECA 5GMFA 2XWTC 1FT8A 5AWCA 4FS7A 4GT6A 4PEQB 4WP6A 4C2AB 2V9TB 4RCAB 1D0BA 3ULUA 3W3JA 2OMUA 3CVRA 4TZHA 2WQUA 1K5DC 1M9LA 3VQ2A 4PQ8A 5HDHA 4AW4A 3UL9A 4R07A 2JE0A 4R0AA 1W8AA 4R08A 4NZTM 3RGXA 4KXFB 2O6SA 5GMHA 3OJAB 4ECNA 4YEBB 3E3ZA 4C2BB 2Z66A 4MQWX 3C6OB 2Z65A 4FHOA 1JL5A 4CILA 4BSUA 4Z94G 3ZYJA 4R6AA 4NKHA 4IM6A 3OGLB 4FMZA 4M7EC 5FTTB 5AZ5A 4V2DA 4Z61C 1DS9A 2P1MB 4LSCA 3E6JA 1Z7XW 1M10B 2XOTA 2OMXA 5CMPA 2ELLA 1OTNA 3OGKB 3P72A 3G3AA 4CC4A 2Z82A 5HZLB 1OZNA 2FT3A 1IO0A 3BZ5A 1OTMA 1SQ0B 2OMTA 5IJCA 1DCEA 3W3NA 4FD0A 4PSJA 4Y61B 5B4PA 1KOHA 5CMNA 3TSRE 1FQVA 1XKUA 2A0ZA 3WPFA 3WPCA 1P8VA 1M0ZA 4M7EA 3WPGA 1ZIWA 3RGZA 2UZXA 4UFRA 5A5CA 2ID5A 2Z7XA 2JE1A 4NZRM 3SB4A 4NKGA 4XSQA 1PGVA 4ECOA 4I6JB 3E4GA 4AY9X 4GLPA 2ASSB 4KT1A 5GQRK 1U0ND 4CC4C 4J4LA 1O6TA 4Q62A 5B0NA 1XEUA 4PERA 3VQ1A 3RJ0A 5GS0A 4FDWA 3WPIA 4L3FA 4Q3IA 3GOZA 1OTOA 2OMZA 3WPDA 3WPHA 4RCWA 3WN4A 2CA6A 4ARNA 3KJ4A 3RFJA 1XCDA 4LXRA 3PMHG 3ZYIA 1O6SA 4LI2A 1GWBA 4XOSA 2UZYA 2BNHA 2V9SA 2OMYA 4RWTC 1O6VA 2JQDA 4R58A 3UL8A 3WPBA 3DZEA 3M19A 4R6FA 2V70A 4OQTA 4U09A 4Z79A 3ULVA 4LI1A 2Z81A 2RA8A 3RFSA 5IYXC 3E2JA 4K17A 2WQWA 4KNGA 3CIGA 4BV4R 1G9UA 1M9SA 2Z64A 4ARRA 4BSSA 4V2CA 3G3BA 2OMWA 1P9AG 3W3GA 4P91A 2O6QA 1H6TA 1A4YA 2Y5QA 4R09A 5AWAA 1A9NA 4CP6A 2IFGA 2O6RA 2WFHA 3ZYNA 2OMVA 1YRGA 1KOOA 3CIYA 4P8SA 2ASTB 5B0TA 4XGOA 4U06A 4V2EA 1H6UA 3C6NB 4PKIG 3REZA 4QBZA 4R5DA 5LFNA 3ZYOA 4G8AA 3G39A 4LSXA 5GS2B 4EZGA 4LSAA 5GMGA 5IJDA 4U7LA 1K5GC 4WYKA 1QYYA 2BEXA 3ULAA 5IJBA 3UN9A 2RR6A 2Z63A 3JB9j 2Q4GW 1OOKG 4R5CA 3RIZA 5D3IA 3RW6A 1XWDC 1OGQA 4R6JA 4R6GA 3G04C 4H09A 4Z64C 2R9UA 3C6PB 4LXSA 4QXEA 2WQXA 4MN8B 3W3MA 3A79B 2Z7XB 4FCGA 3M18A 4Q3GA 4J0MA 2P1PB 4HQ1A 1FO1A 4B8CD 1P8TA 1LTXA 2WQVA 4LSXC 1FS2A 5AWBA 3RFEA 4CNCA 4QC0A 4CNMA 3OJAA 4Z8GA 3RW7A 4L3AA 3WPEA 3FXIA 5AWDA 3G06A 4U08A
chains in the Genus database with same CATH topology
3O53A 3UL7A 2Z62A 3W3LA 3OGMB 1WWLA 2P1OB 3W3KA 1DFJI 2P1NB 3O6NA 2P1QB 4BSRA 1XECA 5GMFA 2XWTC 1FT8A 5AWCA 4FS7A 4GT6A 4PEQB 4WP6A 4C2AB 2V9TB 4RCAB 1D0BA 3ULUA 3W3JA 2OMUA 3CVRA 4TZHA 2WQUA 1K5DC 1M9LA 3VQ2A 4PQ8A 5HDHA 4AW4A 3UL9A 4R07A 2JE0A 4R0AA 1W8AA 4R08A 3RGXA 4KXFB 2O6SA 5GMHA 3OJAB 4ECNA 4YEBB 3E3ZA 4C2BB 2Z66A 4MQWX 3C6OB 2Z65A 4FHOA 1JL5A 4CILA 4BSUA 4Z94G 3ZYJA 4R6AA 4NKHA 4IM6A 3OGLB 4FMZA 4M7EC 5FTTB 5AZ5A 4V2DA 4Z61C 1DS9A 2P1MB 4LSCA 3E6JA 1Z7XW 1M10B 2XOTA 2OMXA 5CMPA 2ELLA 1OTNA 3OGKB 3P72A 3G3AA 4CC4A 2Z82A 5HZLB 1OZNA 2FT3A 1IO0A 3BZ5A 1OTMA 1SQ0B 2OMTA 5IJCA 1DCEA 3W3NA 4FD0A 4PSJA 4Y61B 5B4PA 1KOHA 5CMNA 3TSRE 1FQVA 1XKUA 2A0ZA 3WPFA 3WPCA 1P8VA 1M0ZA 4M7EA 3WPGA 1ZIWA 3RGZA 2UZXA 4UFRA 5A5CA 2ID5A 2Z7XA 2JE1A 3SB4A 4NKGA 4XSQA 1PGVA 4ECOA 4I6JB 3E4GA 4AY9X 4GLPA 2ASSB 4KT1A 5GQRK 1U0ND 4CC4C 4J4LA 1O6TA 4Q62A 5B0NA 1XEUA 4PERA 3VQ1A 3RJ0A 5GS0A 4FDWA 3WPIA 4L3FA 4Q3IA 3GOZA 1OTOA 2OMZA 3WPDA 3WPHA 4RCWA 3WN4A 2CA6A 4ARNA 3KJ4A 3RFJA 1XCDA 4LXRA 3PMHG 3ZYIA 1O6SA 4LI2A 1GWBA 4XOSA 2UZYA 2BNHA 2V9SA 2OMYA 4RWTC 1O6VA 2JQDA 4R58A 3UL8A 3WPBA 3DZEA 3M19A 4R6FA 2V70A 4OQTA 4U09A 4Z79A 3ULVA 4LI1A 2Z81A 2RA8A 3RFSA 5IYXC 3E2JA 4K17A 2WQWA 4KNGA 3CIGA 4BV4R 1G9UA 1M9SA 2Z64A 4ARRA 4BSSA 4V2CA 3G3BA 2OMWA 1P9AG 3W3GA 4P91A 2O6QA 1H6TA 1A4YA 2Y5QA 4R09A 5AWAA 1A9NA 4CP6A 2IFGA 2O6RA 2WFHA 3ZYNA 2OMVA 1YRGA 1KOOA 3CIYA 4P8SA 2ASTB 5B0TA 4XGOA 4U06A 4V2EA 1H6UA 3C6NB 4PKIG 3REZA 4QBZA 4R5DA 5LFNA 3ZYOA 4G8AA 3G39A 4LSXA 5GS2B 4EZGA 4LSAA 5GMGA 5IJDA 4U7LA 1K5GC 4WYKA 1QYYA 2BEXA 3ULAA 5IJBA 3UN9A 2RR6A 2Z63A 3JB9j 2Q4GW 1OOKG 4R5CA 3RIZA 5D3IA 3RW6A 1XWDC 1OGQA 4R6JA 4R6GA 3G04C 4H09A 4Z64C 2R9UA 3C6PB 4LXSA 4QXEA 2WQXA 4MN8B 3W3MA 3A79B 2Z7XB 4FCGA 3M18A 4Q3GA 4J0MA 2P1PB 4HQ1A 1FO1A 4B8CD 1P8TA 1LTXA 2WQVA 4LSXC 1FS2A 5AWBA 3RFEA 4CNCA 4QC0A 4CNMA 3OJAA 4Z8GA 3RW7A 4L3AA 3WPEA 3FXIA 5AWDA 3G06A 4U08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O53 A;  3UL7 A;  2Z62 A;  3W3L A;  3OGM B;  1WWL A;  2P1O B;  3W3K A;  1DFJ I;  2P1N B;  3O6N A;  2P1Q B;  4BSR A;  1XEC A;  5GMF A;  2XWT C;  1FT8 A;  5AWC A;  4FS7 A;  4GT6 A;  4PEQ B;  4WP6 A;  4C2A B;  2V9T B;  4RCA B;  1D0B A;  3ULU A;  3W3J A;  2OMU A;  3CVR A;  4TZH A;  2WQU A;  1K5D C;  1M9L A;  3VQ2 A;  4PQ8 A;  5HDH A;  4AW4 A;  3UL9 A;  4R07 A;  2JE0 A;  4R0A A;  1W8A A;  4R08 A;  3RGX A;  4KXF B;  2O6S A;  5GMH A;  3OJA B;  4ECN A;  4YEB B;  3E3Z A;  4C2B B;  2Z66 A;  4MQW X;  3C6O B;  2Z65 A;  4FHO A;  1JL5 A;  4CIL A;  4BSU A;  4Z94 G;  3ZYJ A;  4R6A A;  4NKH A;  4IM6 A;  3OGL B;  4FMZ A;  4M7E C;  5FTT B;  5AZ5 A;  4V2D A;  4Z61 C;  1DS9 A;  2P1M B;  4LSC A;  3E6J A;  1Z7X W;  1M10 B;  2XOT A;  2OMX A;  5CMP A;  2ELL A;  1OTN A;  3OGK B;  3P72 A;  3G3A A;  4CC4 A;  2Z82 A;  5HZL B;  1OZN A;  2FT3 A;  1IO0 A;  3BZ5 A;  1OTM A;  1SQ0 B;  2OMT A;  5IJC A;  1DCE A;  3W3N A;  4FD0 A;  4PSJ A;  4Y61 B;  5B4P A;  1KOH A;  5CMN A;  3TSR E;  1FQV A;  1XKU A;  2A0Z A;  3WPF A;  3WPC A;  1P8V A;  1M0Z A;  4M7E A;  3WPG A;  1ZIW A;  3RGZ A;  2UZX A;  4UFR A;  5A5C A;  2ID5 A;  2Z7X A;  2JE1 A;  3SB4 A;  4NKG A;  4XSQ A;  1PGV A;  4ECO A;  4I6J B;  3E4G A;  4AY9 X;  4GLP A;  2ASS B;  4KT1 A;  5GQR K;  1U0N D;  4CC4 C;  4J4L A;  1O6T A;  4Q62 A;  5B0N A;  1XEU A;  4PER A;  3VQ1 A;  3RJ0 A;  5GS0 A;  4FDW A;  3WPI A;  4L3F A;  4Q3I A;  3GOZ A;  1OTO A;  2OMZ A;  3WPD A;  3WPH A;  4RCW A;  3WN4 A;  2CA6 A;  4ARN A;  3KJ4 A;  3RFJ A;  1XCD A;  4LXR A;  3PMH G;  3ZYI A;  1O6S A;  4LI2 A;  1GWB A;  4XOS A;  2UZY A;  2BNH A;  2V9S A;  2OMY A;  4RWT C;  1O6V A;  2JQD A;  4R58 A;  3UL8 A;  3WPB A;  3DZE A;  3M19 A;  4R6F A;  2V70 A;  4OQT A;  4U09 A;  4Z79 A;  3ULV A;  4LI1 A;  2Z81 A;  2RA8 A;  3RFS A;  5IYX C;  3E2J A;  4K17 A;  2WQW A;  4KNG A;  3CIG A;  4BV4 R;  1G9U A;  1M9S A;  2Z64 A;  4ARR A;  4BSS A;  4V2C A;  3G3B A;  2OMW A;  1P9A G;  3W3G A;  4P91 A;  2O6Q A;  1H6T A;  1A4Y A;  2Y5Q A;  4R09 A;  5AWA A;  1A9N A;  4CP6 A;  2IFG A;  2O6R A;  2WFH A;  3ZYN A;  2OMV A;  1YRG A;  1KOO A;  3CIY A;  4P8S A;  2AST B;  5B0T A;  4XGO A;  4U06 A;  4V2E A;  1H6U A;  3C6N B;  4PKI G;  3REZ A;  4QBZ A;  4R5D A;  5LFN A;  3ZYO A;  4G8A A;  3G39 A;  4LSX A;  5GS2 B;  4EZG A;  4LSA A;  5GMG A;  5IJD A;  4U7L A;  1K5G C;  4WYK A;  1QYY A;  2BEX A;  3ULA A;  5IJB A;  3UN9 A;  2RR6 A;  2Z63 A;  3JB9 j;  2Q4G W;  1OOK G;  4R5C A;  3RIZ A;  5D3I A;  3RW6 A;  1XWD C;  1OGQ A;  4R6J A;  4R6G A;  3G04 C;  4H09 A;  4Z64 C;  2R9U A;  3C6P B;  4LXS A;  4QXE A;  2WQX A;  4MN8 B;  3W3M A;  3A79 B;  2Z7X B;  4FCG A;  3M18 A;  4Q3G A;  4J0M A;  2P1P B;  4HQ1 A;  1FO1 A;  4B8C D;  1P8T A;  1LTX A;  2WQV A;  4LSX C;  1FS2 A;  5AWB A;  3RFE A;  4CNC A;  4QC0 A;  4CNM A;  3OJA A;  4Z8G A;  3RW7 A;  4L3A A;  3WPE A;  3FXI A;  5AWD A;  3G06 A;  4U08 A; 
#chains in the Genus database with same CATH topology
 3O53 A;  3UL7 A;  2Z62 A;  3W3L A;  3OGM B;  1WWL A;  2P1O B;  3W3K A;  1DFJ I;  2P1N B;  3O6N A;  2P1Q B;  4BSR A;  1XEC A;  5GMF A;  2XWT C;  1FT8 A;  5AWC A;  4FS7 A;  4GT6 A;  4PEQ B;  4WP6 A;  4C2A B;  2V9T B;  4RCA B;  1D0B A;  3ULU A;  3W3J A;  2OMU A;  3CVR A;  4TZH A;  2WQU A;  1K5D C;  1M9L A;  3VQ2 A;  4PQ8 A;  5HDH A;  4AW4 A;  3UL9 A;  4R07 A;  2JE0 A;  4R0A A;  1W8A A;  4R08 A;  4NZT M;  3RGX A;  4KXF B;  2O6S A;  5GMH A;  3OJA B;  4ECN A;  4YEB B;  3E3Z A;  4C2B B;  2Z66 A;  4MQW X;  3C6O B;  2Z65 A;  4FHO A;  1JL5 A;  4CIL A;  4BSU A;  4Z94 G;  3ZYJ A;  4R6A A;  4NKH A;  4IM6 A;  3OGL B;  4FMZ A;  4M7E C;  5FTT B;  5AZ5 A;  4V2D A;  4Z61 C;  1DS9 A;  2P1M B;  4LSC A;  3E6J A;  1Z7X W;  1M10 B;  2XOT A;  2OMX A;  5CMP A;  2ELL A;  1OTN A;  3OGK B;  3P72 A;  3G3A A;  4CC4 A;  2Z82 A;  5HZL B;  1OZN A;  2FT3 A;  1IO0 A;  3BZ5 A;  1OTM A;  1SQ0 B;  2OMT A;  5IJC A;  1DCE A;  3W3N A;  4FD0 A;  4PSJ A;  4Y61 B;  5B4P A;  1KOH A;  5CMN A;  3TSR E;  1FQV A;  1XKU A;  2A0Z A;  3WPF A;  3WPC A;  1P8V A;  1M0Z A;  4M7E A;  3WPG A;  1ZIW A;  3RGZ A;  2UZX A;  4UFR A;  5A5C A;  2ID5 A;  2Z7X A;  2JE1 A;  4NZR M;  3SB4 A;  4NKG A;  4XSQ A;  1PGV A;  4ECO A;  4I6J B;  3E4G A;  4AY9 X;  4GLP A;  2ASS B;  4KT1 A;  5GQR K;  1U0N D;  4CC4 C;  4J4L A;  1O6T A;  4Q62 A;  5B0N A;  1XEU A;  4PER A;  3VQ1 A;  3RJ0 A;  5GS0 A;  4FDW A;  3WPI A;  4L3F A;  4Q3I A;  3GOZ A;  1OTO A;  2OMZ A;  3WPD A;  3WPH A;  4RCW A;  3WN4 A;  2CA6 A;  4ARN A;  3KJ4 A;  3RFJ A;  1XCD A;  4LXR A;  3PMH G;  3ZYI A;  1O6S A;  4LI2 A;  1GWB A;  4XOS A;  2UZY A;  2BNH A;  2V9S A;  2OMY A;  4RWT C;  1O6V A;  2JQD A;  4R58 A;  3UL8 A;  3WPB A;  3DZE A;  3M19 A;  4R6F A;  2V70 A;  4OQT A;  4U09 A;  4Z79 A;  3ULV A;  4LI1 A;  2Z81 A;  2RA8 A;  3RFS A;  5IYX C;  3E2J A;  4K17 A;  2WQW A;  4KNG A;  3CIG A;  4BV4 R;  1G9U A;  1M9S A;  2Z64 A;  4ARR A;  4BSS A;  4V2C A;  3G3B A;  2OMW A;  1P9A G;  3W3G A;  4P91 A;  2O6Q A;  1H6T A;  1A4Y A;  2Y5Q A;  4R09 A;  5AWA A;  1A9N A;  4CP6 A;  2IFG A;  2O6R A;  2WFH A;  3ZYN A;  2OMV A;  1YRG A;  1KOO A;  3CIY A;  4P8S A;  2AST B;  5B0T A;  4XGO A;  4U06 A;  4V2E A;  1H6U A;  3C6N B;  4PKI G;  3REZ A;  4QBZ A;  4R5D A;  5LFN A;  3ZYO A;  4G8A A;  3G39 A;  4LSX A;  5GS2 B;  4EZG A;  4LSA A;  5GMG A;  5IJD A;  4U7L A;  1K5G C;  4WYK A;  1QYY A;  2BEX A;  3ULA A;  5IJB A;  3UN9 A;  2RR6 A;  2Z63 A;  3JB9 j;  2Q4G W;  1OOK G;  4R5C A;  3RIZ A;  5D3I A;  3RW6 A;  1XWD C;  1OGQ A;  4R6J A;  4R6G A;  3G04 C;  4H09 A;  4Z64 C;  2R9U A;  3C6P B;  4LXS A;  4QXE A;  2WQX A;  4MN8 B;  3W3M A;  3A79 B;  2Z7X B;  4FCG A;  3M18 A;  4Q3G A;  4J0M A;  2P1P B;  4HQ1 A;  1FO1 A;  4B8C D;  1P8T A;  1LTX A;  2WQV A;  4LSX C;  1FS2 A;  5AWB A;  3RFE A;  4CNC A;  4QC0 A;  4CNM A;  3OJA A;  4Z8G A;  3RW7 A;  4L3A A;  3WPE A;  3FXI A;  5AWD A;  3G06 A;  4U08 A; 
#chains in the Genus database with same CATH homology
 3O53 A;  3UL7 A;  2Z62 A;  3W3L A;  3OGM B;  1WWL A;  2P1O B;  3W3K A;  1DFJ I;  2P1N B;  3O6N A;  2P1Q B;  4BSR A;  1XEC A;  5GMF A;  2XWT C;  1FT8 A;  5AWC A;  4FS7 A;  4GT6 A;  4PEQ B;  4WP6 A;  4C2A B;  2V9T B;  4RCA B;  1D0B A;  3ULU A;  3W3J A;  2OMU A;  3CVR A;  4TZH A;  2WQU A;  1K5D C;  1M9L A;  3VQ2 A;  4PQ8 A;  5HDH A;  4AW4 A;  3UL9 A;  4R07 A;  2JE0 A;  4R0A A;  1W8A A;  4R08 A;  3RGX A;  4KXF B;  2O6S A;  5GMH A;  3OJA B;  4ECN A;  4YEB B;  3E3Z A;  4C2B B;  2Z66 A;  4MQW X;  3C6O B;  2Z65 A;  4FHO A;  1JL5 A;  4CIL A;  4BSU A;  4Z94 G;  3ZYJ A;  4R6A A;  4NKH A;  4IM6 A;  3OGL B;  4FMZ A;  4M7E C;  5FTT B;  5AZ5 A;  4V2D A;  4Z61 C;  1DS9 A;  2P1M B;  4LSC A;  3E6J A;  1Z7X W;  1M10 B;  2XOT A;  2OMX A;  5CMP A;  2ELL A;  1OTN A;  3OGK B;  3P72 A;  3G3A A;  4CC4 A;  2Z82 A;  5HZL B;  1OZN A;  2FT3 A;  1IO0 A;  3BZ5 A;  1OTM A;  1SQ0 B;  2OMT A;  5IJC A;  1DCE A;  3W3N A;  4FD0 A;  4PSJ A;  4Y61 B;  5B4P A;  1KOH A;  5CMN A;  3TSR E;  1FQV A;  1XKU A;  2A0Z A;  3WPF A;  3WPC A;  1P8V A;  1M0Z A;  4M7E A;  3WPG A;  1ZIW A;  3RGZ A;  2UZX A;  4UFR A;  5A5C A;  2ID5 A;  2Z7X A;  2JE1 A;  3SB4 A;  4NKG A;  4XSQ A;  1PGV A;  4ECO A;  4I6J B;  3E4G A;  4AY9 X;  4GLP A;  2ASS B;  4KT1 A;  5GQR K;  1U0N D;  4CC4 C;  4J4L A;  1O6T A;  4Q62 A;  5B0N A;  1XEU A;  4PER A;  3VQ1 A;  3RJ0 A;  5GS0 A;  4FDW A;  3WPI A;  4L3F A;  4Q3I A;  3GOZ A;  1OTO A;  2OMZ A;  3WPD A;  3WPH A;  4RCW A;  3WN4 A;  2CA6 A;  4ARN A;  3KJ4 A;  3RFJ A;  1XCD A;  4LXR A;  3PMH G;  3ZYI A;  1O6S A;  4LI2 A;  1GWB A;  4XOS A;  2UZY A;  2BNH A;  2V9S A;  2OMY A;  4RWT C;  1O6V A;  2JQD A;  4R58 A;  3UL8 A;  3WPB A;  3DZE A;  3M19 A;  4R6F A;  2V70 A;  4OQT A;  4U09 A;  4Z79 A;  3ULV A;  4LI1 A;  2Z81 A;  2RA8 A;  3RFS A;  5IYX C;  3E2J A;  4K17 A;  2WQW A;  4KNG A;  3CIG A;  4BV4 R;  1G9U A;  1M9S A;  2Z64 A;  4ARR A;  4BSS A;  4V2C A;  3G3B A;  2OMW A;  1P9A G;  3W3G A;  4P91 A;  2O6Q A;  1H6T A;  1A4Y A;  2Y5Q A;  4R09 A;  5AWA A;  1A9N A;  4CP6 A;  2IFG A;  2O6R A;  2WFH A;  3ZYN A;  2OMV A;  1YRG A;  1KOO A;  3CIY A;  4P8S A;  2AST B;  5B0T A;  4XGO A;  4U06 A;  4V2E A;  1H6U A;  3C6N B;  4PKI G;  3REZ A;  4QBZ A;  4R5D A;  5LFN A;  3ZYO A;  4G8A A;  3G39 A;  4LSX A;  5GS2 B;  4EZG A;  4LSA A;  5GMG A;  5IJD A;  4U7L A;  1K5G C;  4WYK A;  1QYY A;  2BEX A;  3ULA A;  5IJB A;  3UN9 A;  2RR6 A;  2Z63 A;  3JB9 j;  2Q4G W;  1OOK G;  4R5C A;  3RIZ A;  5D3I A;  3RW6 A;  1XWD C;  1OGQ A;  4R6J A;  4R6G A;  3G04 C;  4H09 A;  4Z64 C;  2R9U A;  3C6P B;  4LXS A;  4QXE A;  2WQX A;  4MN8 B;  3W3M A;  3A79 B;  2Z7X B;  4FCG A;  3M18 A;  4Q3G A;  4J0M A;  2P1P B;  4HQ1 A;  1FO1 A;  4B8C D;  1P8T A;  1LTX A;  2WQV A;  4LSX C;  1FS2 A;  5AWB A;  3RFE A;  4CNC A;  4QC0 A;  4CNM A;  3OJA A;  4Z8G A;  3RW7 A;  4L3A A;  3WPE A;  3FXI A;  5AWD A;  3G06 A;  4U08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...