3REZA

Glycoprotein gpib variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
113
Chain Sequence
PCPAPCSCAGTLVDCGRRGLTALPALPARTTELVLTGNNLTSVPPGAFDHLPQLRTAHLGANPWRCDCSLTYLRLWLEDRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Platelet glycoprotein Ib beta chain, Platelet glycoprotein I
publication title Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIb beta and a GPIb beta/GPIX chimera
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 113
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01463 LRRCT Leucine rich repeat C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rezA00
2OMTA 4U09A 4Y61B 5B4PA 3WPEA 4PSJA 4CNCA 4R5CA 3O6NA 4R6FA 4RCWA 4K17A 4R07A 1DCEA 3TSRE 2P1OB 4BSRA 4FD0A 3WPGA 2Z66A 2Z63A 1XWDC 1A9NA 4GLPA 3VQ1A 1FO1A 5D3IA 3M18A 4CNMA 2Z7XB 3ZYOA 1XKUA 1FQVA 2P1NB 3P72A 1M10B 3C6OB 5AZ5A 4R58A 2A0ZA 3UL7A 5IJCA 2Z7XA 2WFHA 5GQRK 3WPDA 3ULVA 5AWAA 4J0MA 1A4YA 2FT3A 4GT6A 1K5GC 3E4GA 3C6NB 4R5DA 5CMNA 3ZYNA 1IO0A 2OMUA 1QYYA 5IYXC 4R6AA 5FTTB 3BZ5A 4NKGA 1OOKG 3DZEA 2WQVA 4CILA 4I6JB 4R6GA 2Y5QA 4Z79A 1P9AG 3G3AA 3GOZA 3RGZA 1WWLA 3ULAA 2OMWA 2XOTA 4ARNA 4LSXA 1M9SA 4U06A 2IFGA 4J4LA 5AWDA 4IM6A 3RFSA 4B8CD 4H09A 4G8AA 4CP6A 1KOHA 4KXFB 4FMZA 3REZA 3W3JA 4BSSA 2JE0A 4TZHA 2Z62A 4PEQB 5GMGA 2ELLA 3W3KA 4R0AA 4FHOA 5B0TA 5B0NA 2V9TB 3WPIA 5IJBA 3UL9A 4OQTA 4U7LA 4WP6A 5GS2B 3E2JA 4LSAA 5IJDA 2JQDA 5HZLB 4M7EC 4FS7A 2O6RA 4ARRA 1FS2A 3OGLB 4BV4R 2BNHA 4R6JA 1H6TA 1OTNA 3UL8A 4R09A 3FXIA 4Q62A 3UN9A 3W3NA 2V70A 5LFNA 1XECA 2UZXA 2WQWA 1XCDA 3O53A 1U0ND 5GMFA 2WQXA 2OMXA 4LXRA 1D0BA 3WN4A 5AWCA 3WPCA 3W3GA 3RFEA 4BSUA 3WPFA 2ASTB 2O6SA 1OZNA 4AY9X 5GS0A 2OMZA 3CIGA 4ECNA 2JE1A 3E3ZA 3W3MA 4QXEA 2ASSB 3WPHA 4ECOA 4V2EA 1OTMA 3RIZA 3G06A 4LSCA 4V2DA 1XEUA 1FT8A 4Z61C 2ID5A 3RW6A 4Q3IA 4R08A 1PGVA 5CMPA 2V9SA 2OMYA 4RWTC 3W3LA 4NKHA 3OJAB 1GWBA 2UZYA 2BEXA 4U08A 2P1QB 4XGOA 3E6JA 4PERA 1DFJI 1LTXA 3RJ0A 4AW4A 3OJAA 4PKIG 3PMHG 4XSQA 1W8AA 4CC4C 3VQ2A 4QC0A 4CC4A 3KJ4A 4L3FA 5AWBA 1OTOA 4UFRA 3G3BA 3RGXA 4L3AA 1O6SA 3ZYJA 4M7EA 4KT1A 1KOOA 2Z64A 3RFJA 3M19A 4HQ1A 1H6UA 2RA8A 1O6VA 4LI2A 5GMHA 2XWTC 3ULUA 2RR6A 2CA6A 4RCAB 2R9UA 3A79B 2OMVA 3G39A 1Z7XW 4MN8B 1P8VA 4WYKA 3JB9j 3C6PB 4FDWA 3G04C 4LXSA 4Q3GA 4FCGA 3OGKB 4Z8GA 3CIYA 1M9LA 1P8TA 3OGMB 3SB4A 4V2CA 4P8SA 2WQUA 2Z81A 4XOSA 4QBZA 1JL5A 4C2AB 1DS9A 3WPBA 4Z94G 1O6TA 4LI1A 4C2BB 4KNGA 1G9UA 2O6QA 3CVRA 4PQ8A 5A5CA 3ZYIA 2Z82A 2P1PB 4MQWX 4EZGA 1K5DC 2Z65A 1OGQA 2Q4GW 1SQ0B 5HDHA 1YRGA 4YEBB 4Z64C 1M0ZA 1ZIWA 4P91A 4LSXC 2P1MB 3RW7A
chains in the Genus database with same CATH superfamily
2OMTA 4U09A 4NZRM 4Y61B 5B4PA 3WPEA 4PSJA 4CNCA 4R5CA 3O6NA 4R6FA 4RCWA 4K17A 4R07A 1DCEA 3TSRE 2P1OB 4BSRA 4FD0A 3WPGA 2Z66A 2Z63A 1XWDC 1A9NA 4GLPA 3VQ1A 1FO1A 5D3IA 3M18A 4CNMA 2Z7XB 3ZYOA 1XKUA 1FQVA 2P1NB 3P72A 1M10B 3C6OB 5AZ5A 4R58A 2A0ZA 3UL7A 5IJCA 2Z7XA 2WFHA 5GQRK 3WPDA 3ULVA 5AWAA 4J0MA 1A4YA 2FT3A 4GT6A 1K5GC 3E4GA 3C6NB 4R5DA 5CMNA 3ZYNA 1IO0A 2OMUA 1QYYA 5IYXC 4R6AA 5FTTB 3BZ5A 4NKGA 1OOKG 3DZEA 2WQVA 4CILA 4I6JB 4R6GA 2Y5QA 4Z79A 1P9AG 3G3AA 3GOZA 3RGZA 1WWLA 3ULAA 2OMWA 2XOTA 4ARNA 4LSXA 1M9SA 4U06A 2IFGA 4J4LA 5AWDA 4IM6A 3RFSA 4B8CD 4H09A 4G8AA 4CP6A 1KOHA 4KXFB 4FMZA 3REZA 3W3JA 4BSSA 2JE0A 4TZHA 2Z62A 4PEQB 5GMGA 2ELLA 3W3KA 4R0AA 4FHOA 5B0TA 5B0NA 2V9TB 3WPIA 5IJBA 3UL9A 4OQTA 4U7LA 4WP6A 5GS2B 3E2JA 4LSAA 5IJDA 2JQDA 5HZLB 4M7EC 4FS7A 2O6RA 4ARRA 1FS2A 3OGLB 4BV4R 2BNHA 4R6JA 1H6TA 1OTNA 3UL8A 4R09A 3FXIA 4Q62A 3UN9A 3W3NA 2V70A 5LFNA 1XECA 2UZXA 2WQWA 1XCDA 3O53A 1U0ND 5GMFA 2WQXA 2OMXA 4LXRA 1D0BA 3WN4A 5AWCA 3WPCA 3W3GA 3RFEA 4BSUA 3WPFA 2ASTB 2O6SA 1OZNA 4AY9X 5GS0A 2OMZA 3CIGA 4ECNA 2JE1A 3E3ZA 3W3MA 4QXEA 2ASSB 3WPHA 4ECOA 4V2EA 1OTMA 3RIZA 3G06A 4LSCA 4NZTM 4V2DA 1XEUA 1FT8A 4Z61C 2ID5A 3RW6A 4Q3IA 4R08A 1PGVA 5CMPA 2V9SA 2OMYA 4RWTC 3W3LA 4NKHA 3OJAB 1GWBA 2UZYA 2BEXA 4U08A 2P1QB 4XGOA 3E6JA 4PERA 1DFJI 1LTXA 3RJ0A 4AW4A 3OJAA 4PKIG 3PMHG 4XSQA 1W8AA 4CC4C 3VQ2A 4QC0A 4CC4A 3KJ4A 4L3FA 5AWBA 1OTOA 4UFRA 3G3BA 3RGXA 4L3AA 1O6SA 3ZYJA 4M7EA 4KT1A 1KOOA 2Z64A 3RFJA 3M19A 4HQ1A 1H6UA 2RA8A 1O6VA 4LI2A 5GMHA 2XWTC 3ULUA 2RR6A 2CA6A 4RCAB 2R9UA 3A79B 2OMVA 3G39A 1Z7XW 4MN8B 1P8VA 4WYKA 3JB9j 3C6PB 4FDWA 3G04C 4LXSA 4Q3GA 4FCGA 3OGKB 4Z8GA 3CIYA 1M9LA 1P8TA 3OGMB 3SB4A 4V2CA 4P8SA 2WQUA 2Z81A 4XOSA 4QBZA 1JL5A 4C2AB 1DS9A 3WPBA 4Z94G 1O6TA 4LI1A 4C2BB 4KNGA 1G9UA 2O6QA 3CVRA 4PQ8A 5A5CA 3ZYIA 2Z82A 2P1PB 4MQWX 4EZGA 1K5DC 2Z65A 1OGQA 2Q4GW 1SQ0B 5HDHA 1YRGA 4YEBB 4Z64C 1M0ZA 1ZIWA 4P91A 4LSXC 2P1MB 3RW7A
chains in the Genus database with same CATH topology
2OMTA 4U09A 4Y61B 5B4PA 3WPEA 4PSJA 4CNCA 4R5CA 3O6NA 4R6FA 4RCWA 4K17A 4R07A 1DCEA 3TSRE 2P1OB 4BSRA 4FD0A 3WPGA 2Z66A 2Z63A 1XWDC 1A9NA 4GLPA 3VQ1A 1FO1A 5D3IA 3M18A 4CNMA 2Z7XB 3ZYOA 1XKUA 1FQVA 2P1NB 3P72A 1M10B 3C6OB 5AZ5A 4R58A 2A0ZA 3UL7A 5IJCA 2Z7XA 2WFHA 5GQRK 3WPDA 3ULVA 5AWAA 4J0MA 1A4YA 2FT3A 4GT6A 1K5GC 3E4GA 3C6NB 4R5DA 5CMNA 3ZYNA 1IO0A 2OMUA 1QYYA 5IYXC 4R6AA 5FTTB 3BZ5A 4NKGA 1OOKG 3DZEA 2WQVA 4CILA 4I6JB 4R6GA 2Y5QA 4Z79A 1P9AG 3G3AA 3GOZA 3RGZA 1WWLA 3ULAA 2OMWA 2XOTA 4ARNA 4LSXA 1M9SA 4U06A 2IFGA 4J4LA 5AWDA 4IM6A 3RFSA 4B8CD 4H09A 4G8AA 4CP6A 1KOHA 4KXFB 4FMZA 3REZA 3W3JA 4BSSA 2JE0A 4TZHA 2Z62A 4PEQB 5GMGA 2ELLA 3W3KA 4R0AA 4FHOA 5B0TA 5B0NA 2V9TB 3WPIA 5IJBA 3UL9A 4OQTA 4U7LA 4WP6A 5GS2B 3E2JA 4LSAA 5IJDA 2JQDA 5HZLB 4M7EC 4FS7A 2O6RA 4ARRA 1FS2A 3OGLB 4BV4R 2BNHA 4R6JA 1H6TA 1OTNA 3UL8A 4R09A 3FXIA 4Q62A 3UN9A 3W3NA 2V70A 5LFNA 1XECA 2UZXA 2WQWA 1XCDA 3O53A 1U0ND 5GMFA 2WQXA 2OMXA 4LXRA 1D0BA 3WN4A 5AWCA 3WPCA 3W3GA 3RFEA 4BSUA 3WPFA 2ASTB 2O6SA 1OZNA 4AY9X 5GS0A 2OMZA 3CIGA 4ECNA 2JE1A 3E3ZA 3W3MA 4QXEA 2ASSB 3WPHA 4ECOA 4V2EA 1OTMA 3RIZA 3G06A 4LSCA 4V2DA 1XEUA 1FT8A 4Z61C 2ID5A 3RW6A 4Q3IA 4R08A 1PGVA 5CMPA 2V9SA 2OMYA 4RWTC 3W3LA 4NKHA 3OJAB 1GWBA 2UZYA 2BEXA 4U08A 2P1QB 4XGOA 3E6JA 4PERA 1DFJI 1LTXA 3RJ0A 4AW4A 3OJAA 4PKIG 3PMHG 4XSQA 1W8AA 4CC4C 3VQ2A 4QC0A 4CC4A 3KJ4A 4L3FA 5AWBA 1OTOA 4UFRA 3G3BA 3RGXA 4L3AA 1O6SA 3ZYJA 4M7EA 4KT1A 1KOOA 2Z64A 3RFJA 3M19A 4HQ1A 1H6UA 2RA8A 1O6VA 4LI2A 5GMHA 2XWTC 3ULUA 2RR6A 2CA6A 4RCAB 2R9UA 3A79B 2OMVA 3G39A 1Z7XW 4MN8B 1P8VA 4WYKA 3JB9j 3C6PB 4FDWA 3G04C 4LXSA 4Q3GA 4FCGA 3OGKB 4Z8GA 3CIYA 1M9LA 1P8TA 3OGMB 3SB4A 4V2CA 4P8SA 2WQUA 2Z81A 4XOSA 4QBZA 1JL5A 4C2AB 1DS9A 3WPBA 4Z94G 1O6TA 4LI1A 4C2BB 4KNGA 1G9UA 2O6QA 3CVRA 4PQ8A 5A5CA 3ZYIA 2Z82A 2P1PB 4MQWX 4EZGA 1K5DC 2Z65A 1OGQA 2Q4GW 1SQ0B 5HDHA 1YRGA 4YEBB 4Z64C 1M0ZA 1ZIWA 4P91A 4LSXC 2P1MB 3RW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMT A;  4U09 A;  4Y61 B;  5B4P A;  3WPE A;  4PSJ A;  4CNC A;  4R5C A;  3O6N A;  4R6F A;  4RCW A;  4K17 A;  4R07 A;  1DCE A;  3TSR E;  2P1O B;  4BSR A;  4FD0 A;  3WPG A;  2Z66 A;  2Z63 A;  1XWD C;  1A9N A;  4GLP A;  3VQ1 A;  1FO1 A;  5D3I A;  3M18 A;  4CNM A;  2Z7X B;  3ZYO A;  1XKU A;  1FQV A;  2P1N B;  3P72 A;  1M10 B;  3C6O B;  5AZ5 A;  4R58 A;  2A0Z A;  3UL7 A;  5IJC A;  2Z7X A;  2WFH A;  5GQR K;  3WPD A;  3ULV A;  5AWA A;  4J0M A;  1A4Y A;  2FT3 A;  4GT6 A;  1K5G C;  3E4G A;  3C6N B;  4R5D A;  5CMN A;  3ZYN A;  1IO0 A;  2OMU A;  1QYY A;  5IYX C;  4R6A A;  5FTT B;  3BZ5 A;  4NKG A;  1OOK G;  3DZE A;  2WQV A;  4CIL A;  4I6J B;  4R6G A;  2Y5Q A;  4Z79 A;  1P9A G;  3G3A A;  3GOZ A;  3RGZ A;  1WWL A;  3ULA A;  2OMW A;  2XOT A;  4ARN A;  4LSX A;  1M9S A;  4U06 A;  2IFG A;  4J4L A;  5AWD A;  4IM6 A;  3RFS A;  4B8C D;  4H09 A;  4G8A A;  4CP6 A;  1KOH A;  4KXF B;  4FMZ A;  3REZ A;  3W3J A;  4BSS A;  2JE0 A;  4TZH A;  2Z62 A;  4PEQ B;  5GMG A;  2ELL A;  3W3K A;  4R0A A;  4FHO A;  5B0T A;  5B0N A;  2V9T B;  3WPI A;  5IJB A;  3UL9 A;  4OQT A;  4U7L A;  4WP6 A;  5GS2 B;  3E2J A;  4LSA A;  5IJD A;  2JQD A;  5HZL B;  4M7E C;  4FS7 A;  2O6R A;  4ARR A;  1FS2 A;  3OGL B;  4BV4 R;  2BNH A;  4R6J A;  1H6T A;  1OTN A;  3UL8 A;  4R09 A;  3FXI A;  4Q62 A;  3UN9 A;  3W3N A;  2V70 A;  5LFN A;  1XEC A;  2UZX A;  2WQW A;  1XCD A;  3O53 A;  1U0N D;  5GMF A;  2WQX A;  2OMX A;  4LXR A;  1D0B A;  3WN4 A;  5AWC A;  3WPC A;  3W3G A;  3RFE A;  4BSU A;  3WPF A;  2AST B;  2O6S A;  1OZN A;  4AY9 X;  5GS0 A;  2OMZ A;  3CIG A;  4ECN A;  2JE1 A;  3E3Z A;  3W3M A;  4QXE A;  2ASS B;  3WPH A;  4ECO A;  4V2E A;  1OTM A;  3RIZ A;  3G06 A;  4LSC A;  4V2D A;  1XEU A;  1FT8 A;  4Z61 C;  2ID5 A;  3RW6 A;  4Q3I A;  4R08 A;  1PGV A;  5CMP A;  2V9S A;  2OMY A;  4RWT C;  3W3L A;  4NKH A;  3OJA B;  1GWB A;  2UZY A;  2BEX A;  4U08 A;  2P1Q B;  4XGO A;  3E6J A;  4PER A;  1DFJ I;  1LTX A;  3RJ0 A;  4AW4 A;  3OJA A;  4PKI G;  3PMH G;  4XSQ A;  1W8A A;  4CC4 C;  3VQ2 A;  4QC0 A;  4CC4 A;  3KJ4 A;  4L3F A;  5AWB A;  1OTO A;  4UFR A;  3G3B A;  3RGX A;  4L3A A;  1O6S A;  3ZYJ A;  4M7E A;  4KT1 A;  1KOO A;  2Z64 A;  3RFJ A;  3M19 A;  4HQ1 A;  1H6U A;  2RA8 A;  1O6V A;  4LI2 A;  5GMH A;  2XWT C;  3ULU A;  2RR6 A;  2CA6 A;  4RCA B;  2R9U A;  3A79 B;  2OMV A;  3G39 A;  1Z7X W;  4MN8 B;  1P8V A;  4WYK A;  3JB9 j;  3C6P B;  4FDW A;  3G04 C;  4LXS A;  4Q3G A;  4FCG A;  3OGK B;  4Z8G A;  3CIY A;  1M9L A;  1P8T A;  3OGM B;  3SB4 A;  4V2C A;  4P8S A;  2WQU A;  2Z81 A;  4XOS A;  4QBZ A;  1JL5 A;  4C2A B;  1DS9 A;  3WPB A;  4Z94 G;  1O6T A;  4LI1 A;  4C2B B;  4KNG A;  1G9U A;  2O6Q A;  3CVR A;  4PQ8 A;  5A5C A;  3ZYI A;  2Z82 A;  2P1P B;  4MQW X;  4EZG A;  1K5D C;  2Z65 A;  1OGQ A;  2Q4G W;  1SQ0 B;  5HDH A;  1YRG A;  4YEB B;  4Z64 C;  1M0Z A;  1ZIW A;  4P91 A;  4LSX C;  2P1M B;  3RW7 A; 
#chains in the Genus database with same CATH topology
 2OMT A;  4U09 A;  4NZR M;  4Y61 B;  5B4P A;  3WPE A;  4PSJ A;  4CNC A;  4R5C A;  3O6N A;  4R6F A;  4RCW A;  4K17 A;  4R07 A;  1DCE A;  3TSR E;  2P1O B;  4BSR A;  4FD0 A;  3WPG A;  2Z66 A;  2Z63 A;  1XWD C;  1A9N A;  4GLP A;  3VQ1 A;  1FO1 A;  5D3I A;  3M18 A;  4CNM A;  2Z7X B;  3ZYO A;  1XKU A;  1FQV A;  2P1N B;  3P72 A;  1M10 B;  3C6O B;  5AZ5 A;  4R58 A;  2A0Z A;  3UL7 A;  5IJC A;  2Z7X A;  2WFH A;  5GQR K;  3WPD A;  3ULV A;  5AWA A;  4J0M A;  1A4Y A;  2FT3 A;  4GT6 A;  1K5G C;  3E4G A;  3C6N B;  4R5D A;  5CMN A;  3ZYN A;  1IO0 A;  2OMU A;  1QYY A;  5IYX C;  4R6A A;  5FTT B;  3BZ5 A;  4NKG A;  1OOK G;  3DZE A;  2WQV A;  4CIL A;  4I6J B;  4R6G A;  2Y5Q A;  4Z79 A;  1P9A G;  3G3A A;  3GOZ A;  3RGZ A;  1WWL A;  3ULA A;  2OMW A;  2XOT A;  4ARN A;  4LSX A;  1M9S A;  4U06 A;  2IFG A;  4J4L A;  5AWD A;  4IM6 A;  3RFS A;  4B8C D;  4H09 A;  4G8A A;  4CP6 A;  1KOH A;  4KXF B;  4FMZ A;  3REZ A;  3W3J A;  4BSS A;  2JE0 A;  4TZH A;  2Z62 A;  4PEQ B;  5GMG A;  2ELL A;  3W3K A;  4R0A A;  4FHO A;  5B0T A;  5B0N A;  2V9T B;  3WPI A;  5IJB A;  3UL9 A;  4OQT A;  4U7L A;  4WP6 A;  5GS2 B;  3E2J A;  4LSA A;  5IJD A;  2JQD A;  5HZL B;  4M7E C;  4FS7 A;  2O6R A;  4ARR A;  1FS2 A;  3OGL B;  4BV4 R;  2BNH A;  4R6J A;  1H6T A;  1OTN A;  3UL8 A;  4R09 A;  3FXI A;  4Q62 A;  3UN9 A;  3W3N A;  2V70 A;  5LFN A;  1XEC A;  2UZX A;  2WQW A;  1XCD A;  3O53 A;  1U0N D;  5GMF A;  2WQX A;  2OMX A;  4LXR A;  1D0B A;  3WN4 A;  5AWC A;  3WPC A;  3W3G A;  3RFE A;  4BSU A;  3WPF A;  2AST B;  2O6S A;  1OZN A;  4AY9 X;  5GS0 A;  2OMZ A;  3CIG A;  4ECN A;  2JE1 A;  3E3Z A;  3W3M A;  4QXE A;  2ASS B;  3WPH A;  4ECO A;  4V2E A;  1OTM A;  3RIZ A;  3G06 A;  4LSC A;  4NZT M;  4V2D A;  1XEU A;  1FT8 A;  4Z61 C;  2ID5 A;  3RW6 A;  4Q3I A;  4R08 A;  1PGV A;  5CMP A;  2V9S A;  2OMY A;  4RWT C;  3W3L A;  4NKH A;  3OJA B;  1GWB A;  2UZY A;  2BEX A;  4U08 A;  2P1Q B;  4XGO A;  3E6J A;  4PER A;  1DFJ I;  1LTX A;  3RJ0 A;  4AW4 A;  3OJA A;  4PKI G;  3PMH G;  4XSQ A;  1W8A A;  4CC4 C;  3VQ2 A;  4QC0 A;  4CC4 A;  3KJ4 A;  4L3F A;  5AWB A;  1OTO A;  4UFR A;  3G3B A;  3RGX A;  4L3A A;  1O6S A;  3ZYJ A;  4M7E A;  4KT1 A;  1KOO A;  2Z64 A;  3RFJ A;  3M19 A;  4HQ1 A;  1H6U A;  2RA8 A;  1O6V A;  4LI2 A;  5GMH A;  2XWT C;  3ULU A;  2RR6 A;  2CA6 A;  4RCA B;  2R9U A;  3A79 B;  2OMV A;  3G39 A;  1Z7X W;  4MN8 B;  1P8V A;  4WYK A;  3JB9 j;  3C6P B;  4FDW A;  3G04 C;  4LXS A;  4Q3G A;  4FCG A;  3OGK B;  4Z8G A;  3CIY A;  1M9L A;  1P8T A;  3OGM B;  3SB4 A;  4V2C A;  4P8S A;  2WQU A;  2Z81 A;  4XOS A;  4QBZ A;  1JL5 A;  4C2A B;  1DS9 A;  3WPB A;  4Z94 G;  1O6T A;  4LI1 A;  4C2B B;  4KNG A;  1G9U A;  2O6Q A;  3CVR A;  4PQ8 A;  5A5C A;  3ZYI A;  2Z82 A;  2P1P B;  4MQW X;  4EZG A;  1K5D C;  2Z65 A;  1OGQ A;  2Q4G W;  1SQ0 B;  5HDH A;  1YRG A;  4YEB B;  4Z64 C;  1M0Z A;  1ZIW A;  4P91 A;  4LSX C;  2P1M B;  3RW7 A; 
#chains in the Genus database with same CATH homology
 2OMT A;  4U09 A;  4Y61 B;  5B4P A;  3WPE A;  4PSJ A;  4CNC A;  4R5C A;  3O6N A;  4R6F A;  4RCW A;  4K17 A;  4R07 A;  1DCE A;  3TSR E;  2P1O B;  4BSR A;  4FD0 A;  3WPG A;  2Z66 A;  2Z63 A;  1XWD C;  1A9N A;  4GLP A;  3VQ1 A;  1FO1 A;  5D3I A;  3M18 A;  4CNM A;  2Z7X B;  3ZYO A;  1XKU A;  1FQV A;  2P1N B;  3P72 A;  1M10 B;  3C6O B;  5AZ5 A;  4R58 A;  2A0Z A;  3UL7 A;  5IJC A;  2Z7X A;  2WFH A;  5GQR K;  3WPD A;  3ULV A;  5AWA A;  4J0M A;  1A4Y A;  2FT3 A;  4GT6 A;  1K5G C;  3E4G A;  3C6N B;  4R5D A;  5CMN A;  3ZYN A;  1IO0 A;  2OMU A;  1QYY A;  5IYX C;  4R6A A;  5FTT B;  3BZ5 A;  4NKG A;  1OOK G;  3DZE A;  2WQV A;  4CIL A;  4I6J B;  4R6G A;  2Y5Q A;  4Z79 A;  1P9A G;  3G3A A;  3GOZ A;  3RGZ A;  1WWL A;  3ULA A;  2OMW A;  2XOT A;  4ARN A;  4LSX A;  1M9S A;  4U06 A;  2IFG A;  4J4L A;  5AWD A;  4IM6 A;  3RFS A;  4B8C D;  4H09 A;  4G8A A;  4CP6 A;  1KOH A;  4KXF B;  4FMZ A;  3REZ A;  3W3J A;  4BSS A;  2JE0 A;  4TZH A;  2Z62 A;  4PEQ B;  5GMG A;  2ELL A;  3W3K A;  4R0A A;  4FHO A;  5B0T A;  5B0N A;  2V9T B;  3WPI A;  5IJB A;  3UL9 A;  4OQT A;  4U7L A;  4WP6 A;  5GS2 B;  3E2J A;  4LSA A;  5IJD A;  2JQD A;  5HZL B;  4M7E C;  4FS7 A;  2O6R A;  4ARR A;  1FS2 A;  3OGL B;  4BV4 R;  2BNH A;  4R6J A;  1H6T A;  1OTN A;  3UL8 A;  4R09 A;  3FXI A;  4Q62 A;  3UN9 A;  3W3N A;  2V70 A;  5LFN A;  1XEC A;  2UZX A;  2WQW A;  1XCD A;  3O53 A;  1U0N D;  5GMF A;  2WQX A;  2OMX A;  4LXR A;  1D0B A;  3WN4 A;  5AWC A;  3WPC A;  3W3G A;  3RFE A;  4BSU A;  3WPF A;  2AST B;  2O6S A;  1OZN A;  4AY9 X;  5GS0 A;  2OMZ A;  3CIG A;  4ECN A;  2JE1 A;  3E3Z A;  3W3M A;  4QXE A;  2ASS B;  3WPH A;  4ECO A;  4V2E A;  1OTM A;  3RIZ A;  3G06 A;  4LSC A;  4V2D A;  1XEU A;  1FT8 A;  4Z61 C;  2ID5 A;  3RW6 A;  4Q3I A;  4R08 A;  1PGV A;  5CMP A;  2V9S A;  2OMY A;  4RWT C;  3W3L A;  4NKH A;  3OJA B;  1GWB A;  2UZY A;  2BEX A;  4U08 A;  2P1Q B;  4XGO A;  3E6J A;  4PER A;  1DFJ I;  1LTX A;  3RJ0 A;  4AW4 A;  3OJA A;  4PKI G;  3PMH G;  4XSQ A;  1W8A A;  4CC4 C;  3VQ2 A;  4QC0 A;  4CC4 A;  3KJ4 A;  4L3F A;  5AWB A;  1OTO A;  4UFR A;  3G3B A;  3RGX A;  4L3A A;  1O6S A;  3ZYJ A;  4M7E A;  4KT1 A;  1KOO A;  2Z64 A;  3RFJ A;  3M19 A;  4HQ1 A;  1H6U A;  2RA8 A;  1O6V A;  4LI2 A;  5GMH A;  2XWT C;  3ULU A;  2RR6 A;  2CA6 A;  4RCA B;  2R9U A;  3A79 B;  2OMV A;  3G39 A;  1Z7X W;  4MN8 B;  1P8V A;  4WYK A;  3JB9 j;  3C6P B;  4FDW A;  3G04 C;  4LXS A;  4Q3G A;  4FCG A;  3OGK B;  4Z8G A;  3CIY A;  1M9L A;  1P8T A;  3OGM B;  3SB4 A;  4V2C A;  4P8S A;  2WQU A;  2Z81 A;  4XOS A;  4QBZ A;  1JL5 A;  4C2A B;  1DS9 A;  3WPB A;  4Z94 G;  1O6T A;  4LI1 A;  4C2B B;  4KNG A;  1G9U A;  2O6Q A;  3CVR A;  4PQ8 A;  5A5C A;  3ZYI A;  2Z82 A;  2P1P B;  4MQW X;  4EZG A;  1K5D C;  2Z65 A;  1OGQ A;  2Q4G W;  1SQ0 B;  5HDH A;  1YRG A;  4YEB B;  4Z64 C;  1M0Z A;  1ZIW A;  4P91 A;  4LSX C;  2P1M B;  3RW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...