4FD0A

Crystal structure of a putative cell surface protein (baccac_03700) from bacteroides caccae atcc 43185 at 2.07 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
391
structure length
391
Chain Sequence
SAENPAEPVGALLEDFSIEQLPAKTIYALGENIDLTGLNVTGKYDDGKQRPVKVTPEQISGFSSSAPVDKQEVTITIEGKQKSFSVQISPVRVENGVLTEVLKGHNEIILPNSVKSIPKAAFRGSQINKVVLNEGLQSIGDMAFFNSTVQEVVFPTTLEQLEENIFYYCRNLKKADLSRTKLTKLPASTFVYAGVEEVLLPATLKEIGAQAFLKTSQLKTIEIPENVRTIGLEAFRESGITTVKLPNGVTTIAQRAFYYCPELTEVTTYGTVINENPEAMIHPYCLEGCPKLTRFDISKSIRILGQGLLGGNRKVTQLTIPANVTQINFSAFNNTGIKEVMVEGITPPQVFEKVWYGFPDDITVIRVPAESVEKYKNANGWKDFTNKITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Leucine rich hypothetical protein
publication title Crystal structure of a leucine rich hypothetical protein (BACCAC_03700) from Bacteroides caccae ATCC 43185 at 2.07 A resolution (CASP Target)
rcsb
source organism Bacteroides caccae
total genus 113
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07523 Big_3 Bacterial Ig-like domain (group 3)
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3630 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fd0A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fd0A02
5GQRK 4I6JB 3PMHG 5IJBA 2P1MB 3RJ0A 2OMTA 4NKGA 1XCDA 3RFEA 4LXSA 3RGXA 4BSRA 4PQ8A 5GMFA 4U06A 2P1PB 4PERA 4XSQA 5AWAA 4V2EA 3OGMB 2UZYA 4Z64C 4H09A 1IO0A 2ASSB 4R58A 3WPCA 3UL8A 4FS7A 4U08A 4M7EA 4R6AA 1SQ0B 3ULVA 2Z65A 3VQ1A 3W3GA 5B0TA 1O6TA 4KXFB 4R5DA 1M10B 2V9SA 4RWTC 3SB4A 2Z66A 5HDHA 4LXRA 4BSSA 1P9AG 2Z62A 3RGZA 4WYKA 3W3LA 5B4PA 4B8CD 1XEUA 2WQWA 2OMWA 4L3AA 4RCAB 5GMHA 4M7EC 1OTNA 1W8AA 2O6RA 3OGLB 4R5CA 2O6QA 3RFJA 5A5CA 1FQVA 4R09A 4Q3GA 3WPEA 4C2BB 2JQDA 1K5GC 4ARNA 3UL7A 3UL9A 3W3KA 1OGQA 4J4LA 3O53A 1FO1A 4MQWX 2P1QB 2P1OB 4G8AA 2WQVA 2XOTA 4FD0A 5LFNA 3UN9A 4J0MA 2XWTC 1G9UA 2WQXA 4GLPA 4KT1A 4TZHA 1Z7XW 1WWLA 2Z7XB 4AW4A 5AWCA 1KOOA 2Y5QA 2Z64A 3CVRA 3W3JA 2Q4GW 5AWDA 1P8VA 2RR6A 4R08A 1LTXA 3M19A 4QBZA 1DS9A 4UFRA 3TSRE 4FDWA 4C2AB 4EZGA 3C6PB 2Z81A 3WPGA 4CILA 4P91A 4U09A 4R6FA 3G04C 1A4YA 4BV4R 1ZIWA 4R6GA 3WPBA 3GOZA 1OTOA 4Z8GA 3RIZA 4WP6A 4R0AA 2WQUA 1KOHA 4CNCA 4GT6A 3G3AA 1O6VA 1XECA 4FHOA 1FS2A 5IJDA 4Y61B 3E4GA 4U7LA 1QYYA 1OTMA 5HZLB 4FCGA 2A0ZA 3ZYOA 1K5DC 1A9NA 4BSUA 5IYXC 3CIYA 2V70A 3W3MA 4KNGA 3ZYIA 4NKHA 4LI2A 2UZXA 4V2DA 4Z94G 5FTTB 5D3IA 1U0ND 4IM6A 4MN8B 2Z82A 4LI1A 4PSJA 3P72A 3E3ZA 3WPIA 3ZYJA 1P8TA 4R07A 2O6SA 3KJ4A 5IJCA 4LSCA 4RCWA 4K17A 2OMYA 2WFHA 1PGVA 1YRGA 3OJAA 2V9TB 4ECNA 4CNMA 3A79B 2RA8A 2JE0A 4PKIG 4P8SA 4ECOA 1FT8A 1M9LA 4R6JA 4FMZA 1OOKG 1XWDC 3RW7A 4CC4A 4Z61C 4AY9X 1O6SA 1H6UA 1DFJI 5CMNA 4LSXA 1OZNA 2Z63A 2OMVA 5CMPA 3ULUA 2CA6A 1H6TA 3W3NA 3OJAB 3ZYNA 4LSAA 3FXIA 3BZ5A 5B0NA 2JE1A 3RFSA 4YEBB 1M9SA 2ID5A 3ULAA 4Q62A 4XOSA 4QC0A 2BNHA 5AWBA 3C6NB 3C6OB 3DZEA 2IFGA 2FT3A 3O6NA 1M0ZA 4CC4C 5GS0A 3REZA 4Z79A 2OMZA 4LSXC 4XGOA 3WPFA 4ARRA 1DCEA 4HQ1A 1JL5A 4OQTA 4L3FA 4QXEA 2R9UA 2OMUA 3E6JA 3VQ2A 5AZ5A 3G3BA 3WN4A 2OMXA 2P1NB 5GS2B 3M18A 5GMGA 3CIGA 3OGKB 4PEQB 4Q3IA 1XKUA 3E2JA 2BEXA 2ELLA 2Z7XA 3G39A 3JB9j 1D0BA 2ASTB 3G06A 3WPDA 1GWBA 4V2CA 4CP6A 3RW6A 3WPHA
chains in the Genus database with same CATH superfamily
4JG1H 3HZVA 4HZLA 3U7YH 5GQRK 1DVFA 4WWNA 4W9LC 3PU7A 4ZPVA 4Z7UA 3JTSB 2ROYA 3F2LA 4Q6IC 5FO8A 4R5XA 2DYSB 2K4AA 1G5AA 1KXQE 3RJ0A 1ACCA 1UXMA 2XU9A 4KHTL 4PJFB 4MAYA 1G7HA 1TF4A 4YPJA 1JHTB 3Q43A 4HPOL 3MBXL 2V9UA 2YZ8A 3DO3A 2UZPA 1NCIA 2R2BB 5H8DA 2E6PA 4L18A 4K94H 1MI5A 3BIBX 3L2NA 1OTTC 3MRQA 4ELME 2JLLA 1XGUA 3UDWC 1A6VH 5J8OA 4MZIA 3BIAX 2D73A 1HEZB 3BQVA 1KIUB 4J39A 1E8WA 5IFJA 1M56B 1XL6A 3BD5A 5GS0H 4TVUA 3WS3B 4FLQA 4B9FA 1K8DA 4A04A 1OSZA 2EIMB 1AH1A 2ZCKL 5B1JC 2OMYB 5FM4A 1B0GB 1L9MA 4QRRD 2OFQA 1SY6L 3CX5J 1T0MA 1O7DE 4M7EA 2DJUA 5D70L 1YEIH 2CUHA 3A5VA 3MV7A 4X7TA 1VFBB 3FL7A 3POCA 1MNUH 4LCCA 3W3GA 4FZEL 3TIDA 1RUPH 5DHVA 1NMCB 1LO4L 5B39A 4N87A 4YSUA 4RAHA 4BINA 1AGFA 3FQWB 3NZSA 3UZQB 5HHOD 4H40A 3UBXB 2J8OA 3IDGA 3WNPA 2XPGB 3LOWA 2FJGA 1GGBL 1XSOA 3AB0B 4BSSA 2WSPA 4YL4A 5MEPA 1WP6A 3BWAA 4NOBA 3BO8B 5IFAH 1UH3A 4PV9B 4PLKC 2FO4B 3PNRB 2D7QA 2DM2A 5E08H 2F74B 1UADC 3QIBC 4HW6A 1NGXA 2E75C 5KAQG 2GPZA 1QWNA 4QCIB 3I85A 2JCCB 1JTTA 3EBAA 1MJ7H 1IQWL 3IN2A 5EZJA 3LEXB 4YHIB 1XEUA 3N91A 1KCVH 1XAKA 1XR9A 2R23B 5GRUL 5MENE 4JZOB 4G9FB 1WFUA 3MCLL 3OV6A 3RYMA 4M3KB 2HTLD 3BFQG 4JVUA 4GKZA 2NUPA 4DESA 4B9IA 3VFNB 4XNMA 1OTNA 3TBBA 1BAFH 3EGDA 3QRBA 2X4SA 2AAAA 2BNQD 2P49B 4LEXH 5F97E 1E43A 3MCYA 3NIFE 3OGLB 5C70A 2APFA 2JF1A 2DI7A 3DJSA 4N2AA 2H0PA 3HTLX 2FUTA 1CL7H 2E8ZA 3T0EC 5BOPA 1UXWB 5B1AB 4HUNB 1QSFA 5I0VA 4FQXA 3LXAA 5IMLB 3GXPA 2IQ9L 1O5DT 1SXAA 5CEXB 3NPSC 3SDAB 4G42A 5DHXB 4OAWA 3PWNB 32C2B 4JFPB 1R3JA 1CGVA 4ERSH 5CFAA 4WUKL 4ARNA 1DJIA 2DF3A 3OX8A 2C26A 2Z8SA 4NIKB 1PZ5B 3FUEA 2NW3A 4DQAA 4MCZA 3RAJL 2EINB 3QDMB 4NWTH 4WUUB 4ODUA 3U9PL 5EF0A 1S7WA 4U1SA 4ODVL 1ETA1 3ECBA 4N0YH 5IHUL 4L9DA 1NLBL 4DWHA 1U92B 1SM3H 3W82A 5H4ZA 1QFPA 3SE9L 4QGYA 5I1EL 5FHAH 3GXTA 4FERA 1UA6L 5AUMA 3RIFK 4EMZA 1LEIA 4DP8X 4JO8A 4IOFD 5C08A 5FHBH 1OGTB 5IVXB 4ZXBA 5EU3B 1Z9SA 5HHNA 4EUPH 3PQYB 5KJRH 2ZF9A 5E00A 1WZ1H 3TEYA 1WISA 1MNNA 3D4GA 1KNOA 2VLLA 1BLNB 2FNWA 4XNAA 5DJCB 3T1FA 4KMTL 5DFTA 2WQXA 2V9QA 5DRZA 1TTUA 2HTKC 4OKVA 3CVHA 4U1JB 1E65A 4XWOD 3WFEL 4LIQE 1YEWA 5JHLA 1W80A 4K07A 3UMTA 1SOSA 3WBDA 1Q9LB 2J56A 3R8BB 4WWID 5IWLC 4X6EA 1K3IA 3VXMB 4LZKA 5I6OA 4KXCA 1TLMA 1R3LB 1XXFC 4Q4IA 4K8RL 4KQ0A 1I7RA 4FFYH 2BHYA 1HE8A 4X9IA 1M1SA 3WFDL 3P3UA 3HZVB 4HZLB 1RFDL 4FE9A 1DVFB 4EI6A 3NJHA 1HNFA 4N0UA 4PGZA 1G6RL 1UZGA 4ZPVB 4Z7UB 5TDNA 5FIEA 4I9WD 3HIZA 1DANT 3EOBA 3PWUA 5FO8B 4IU2A 5D6CA 1NCDL 3T08A 1XGQA 2IGTA 2PPFA 1YZZA 4MAYB 1G7HB 1YEEH 2Z81A 1TQCB 3H3PH 1GY1A 3MRNA 3WFHA 2R56L 1DFBH 3DROA 3DO7A 4ZODA 1MI5B 1ZA3A 3MRQB 1JZJA 1XGUB 4UNVA 2FYVA 1Y6KR 2CJTA 2NZ9D 1A6WH 5GS1C 3OMAB 1TETL 4TNFA 3DBXA 4QHKJ 1P2CA 3ILDA 5GSRA 5LHDA 5I8CA 5IFJB 5L2KA 5K1VA 1K8DB 2EDHA 3CXHJ 1Y18A 4LSQH 1OSZB 2OQJA 4HUXB 4ZUTA 5CD5D 4RWYL 5F71A 1T0MB 1KCUL 2NNAA 3QAQA 3MV7B 4X7TB 4JFDA 4TTGA 1ZSHA 4FLSA 4PB0L 4NCC2 2L7UA 4N2DA 3WENA 1M6UA 4LCCB 3TIDB 5DHVB 2VR5A 4PRPD 4Q14A 5B39B 5F8RC 1FYTA 3ESPA 1AGFB 4ZMAT 2B1AL 4DGUA 3V4UL 3IDGB 2NY5C 3ML9A 1CWVA 5AYUL 5DRXA 2FJGB 5E6IA 2WXIA 5MEPB 3RWJA 4KK9D 2PP7A 2WTPA 5FV1L 1Z32X 5DZPA 1OWRM 3EJUA 3JWDH 2H41A 1MCEA 1USZA 4F1SA 4JFUA 2V70A 3O6LL 3W3MA 1E28A 1NGXB 3PPSA 3OAYK 1GCYA 5IROA 2Y7NA 5C0CE 1EDHA 5EZJB 2BHZA 4MDIA 4YSQA 1WA0X 3UJJH 1O9VA 4KJPD 1NCAH 4UWQB 5MEND 1XR9B 3NACL 3TYFA 3C2SA 3RVXD 4OCNC 1RJZA 1GJWA 3B3IA 1OCRB 2XQYK 3PXLA 2ZKWA 3MNMA 3WPIA 2FIRT 3WKML 1NCBL 4XBPA 4LAQL 4GKZB 2NUPB 4M8UA 4AV5A 4ZW5A 3WKQA 4P07A 4XNMB 5E9DE 3EGDB 1G9NH 1QLEH 2X4SB 3ZW3A 2YO3A 2WUCL 2H9GA 5F7EL 2CGRL 3R0NA 5T1LA 4YLCA 4YXHH 4HOZA 1QSFB 3DOHA 3NJJA 4FQXB 4ECNA 5D7KE 4N8VA 5DSCA 3OAUL 4NZ8A 1CF8H 2ZXWB 1F1DA 2DH2A 4NXKA 5H37H 3A79B 2O6CA 2BJMH 1H3GA 3BP4A 4G42B 4OAWB 1C5CL 1R3JB 3PJNA 1KGIA 3LRLA 3KR3H 2HXAA 2N0KA 3OX8B 1T89A 4U6HA 1MFVA 4YDIH 2NW3B 3QIWC 4MCZB 3NJMA 4NBZB 3HLAA 3HHSA 3U1PA 2H45A 4O2FA 1A7QH 4U1SB 3ZHNA 5HYQA 4XN5A 4KVNL 3WHXA 3ECBB 1A0QL 4Y1AA 3BCFA 3ENEA 1JHKH 2DW5A 1FC1A 1H3PL 4PJCF 2E27H 4QDGA 1DFJI 4KRPB 1RK1A 5AUMB 1LEIB 1R3IH 4OM0L 5C08B 5IHHA 2HKHL 3P1VA 4ZXBB 1VPOH 1Z9SB 1JCVA 2D7MA 5HHNB 5E00B 2WIMA 3S6CA 4A7GF 5IJCC 2AMUA 5C7XL 5GRVL 4G8IA 1KNOB 2VLLB 3W0WA 4UBDC 4KVCH 4R26L 2FX7L 2J6EH 1KB5B 3T1FB 3T2QA 4X4XA 4W9ZA 2IDSA 5DRZB 4E68A 1OQOA 1TJHL 2IPTH 4KI1A 4OKVB 3IM1A 2V5YA 1JHLH 2MH4A 3CC1A 3P3TA 1JZ6A 2J3SA 2UV3A 2Z4QA 2QTVA 5I8EA 4XH2A 1NKGA 3IWVA 5D4JA 5CBAA 4X6EB 3SEPA 3G6JE 4IRSC 5D1QC 2F7QA 2Y4SA 4LFHD 4UT7L 4PB9L 1DDHA 4UAOC 5F7DA 2DDQL 4XNDA 4ZO9A 4PIRF 2EILB 3M7OA 3HE7D 1I7RB 2QV4A 3OF6A 3RY4A 5K33A 5I1HH 2X3CA 4F15C 1JMXA 3C5ZC 4G8GD 4WWKD 4XP9L 2VN5A 2FT3A 4EI6B 1AR1B 5TDNB 4N0UB 5DJDA 2MCPL 3AY4C 1XB6A 1XGZA 2PPDA 3EOBB 3PWUB 3UACA 4IU2B 1CLOL 5D6CB 5HHQA 3CVHL 1INEL 4OFYA 2O5XH 4F2EA 5JHLL 4OZHF 4F20A 1XGQB 5GJSH 4LSRL 4FFYA 2IH1A 4RGMB 3S8GB 3B2PA 3QNFA 4FZ8H 2Y2WA 5ICXA 3K0WA 3MRNB 3WFHB 1JWSA 1PDKA 3DROB 3KBHE 4HLZG 4MZRA 4CSPA 3DO7B 2X9ZA 1ZA3B 2QKIC 4YHMH 3FT1A 4CW1A 4MS6A 4DTGH 5B4MC 1F2XK 1LLAA 2X05A 3EJYD 2VO5A 3IRPX 5FC9A 3DBXB 1OSEA 2OSYA 4PI0A 4TQHA 5GMGA 1P2CB 1UB6A 1E67A 5GSRB 1P7BA 5DR5H 5I8CB 4KOCA 2WPGA 4FABH 1SEBA 5L2KB 1E3ZA 2VUKA 1XKUA 4JX0A 4DO5A 1GW6A 2A38A 3B1TA 4OCXH 1Y18B 5ITBL 3PABA 2Z1PA 3LEVL 2OQJB 4RGOL 5LAXA 1PFCA 2ZICA 4K3EH 4B9PA 4BWUA 1X44A 1OY3B 1WT5C 2F7PA 3KPSE 1LMIA 1W0YT 2Z8WC 4ZUTB 5CEYA 3WS6A 5GZOD 1F41A 2NNAB 5MEQA 1AC0A 4JFDB 4PVNA 3VFVA 1F4WL 3G06A 2JSFA 3NJFA 3EJQA 3RDJA 5JLZB 3QFDA 1KFAH 1QQDA 2BIHA 2H1PL 2OMNA 4QHKI 1KTRL 3DSNA 4WRLA 3S2CA 4N4YB 1HXMA 1FYTB 1PEWA 1PG7H 1KLFA 3RBGA 4ANXA 4X7FC 1BYNA 4DQOL 1B2WH 5AAMC 1WH0A 5DWUL 3T0EE 4NWUL 3RWFA 2J55A 4AL8C 5DRXB 5E6IB 5F7LB 3VWKD 3BVNA 3UP6A 4IIQA 1QSEA 2E9JA 1CQKA 1QUNB 1F4HA 2XV6B 3AQDA 2QSVA 3CFBA 4FQJL 1YJDH 1UM6H 1NMAH 3LXCA 4LQFL 4B6ZA 4FA6A 1E28B 1RVFH 1FDLH 5I15H 3VDBA 2CDFA 1NCWL 5GJTL 4AYFA 1AY1L 4CDHA 1I3RA 1JYXA 4X42A 5HGAA 3H4FA 4JHBA 5D7IF 1Q1JL 3R06A 1TTFA 2HFGL 2CMRH 5C7ZA 4AGQA 3TYFB 1JP5A 3MLRH 3QXUA 4P0DA 2XKSA 1CDGA 1RJZB 2YLHA 4KAQH 4LSPL 2ZUTA 3B3IB 2QQKH 2FNBA 1J0IA 1KLGA 3SPVA 2O61A 4XBPB 3ARWA 3ZRSA 2P44B 4RISH 2ARWA 2DQJH 4DP2X 3S34H 1ZT1A 2ITEA 4BUHA 3ZDZF 7TAAA 2H9GB 3CX2A 2MCG1 2EKJA 2YUWA 3QG6B 5T1LB 5D7KD 2BK8A 4IBVA 4N2BA 1F3JA 1GZHC 1LD9A 2AJYL 4N8VB 3B7YA 5DSCB 1BD2A 1A6UL 3VQ1A 3RUGE 1AYRA 2VQUA 1F4YL 1QPXA 5DJ2A 4XMTA 4Y4KC 4L29A 3G6DH 3TBTA 3BP4B 3W5MA 4JG0H 2WNXA 3LZLA 5IMOA 3L4ZA 4U6HB 2IO5A 1MCOL 5IHBA 4G6MH 3JWNH 1EO8L 3HLAB 3HHSB 1XO8A 4LOEA 4ZOAA 2WLJA 2NZIA 2P7TA 4O2FB 5H37A 2DJMA 4LSVL 1X9RA 3PHSA 3QUHA 4FX5A 1VJSA 3ZL4L 5HYQB 3SKJH 3WHXB 1XEDA 1P9AG 2OR9H 4Q0XH 1A14H 1KCVL 4Y1AB 2VMEA 1R9FA 1IC4H 4D0CA 4WYKA 3TEXA 5EEXA 1CDJA 4RZCA 5CZKA 2V6HA 4W9HC 2IAMD 3GZKA 4NZDA 3U82B 1RK1B 3AXHA 1FN4A 4Y4FC 1UM5L 1XDTT 1JRHL 4Z0BL 4LEXL 1LEGA 5DZVA 2RCSH 2WXOA 3H85A 3DI2B 2A74A 4G8IB 4WI6A 3W0WB 2AEOA 3X3FL 4X4XB 1I7UA 1Q8MA 1SVZA 3HFML 3V0WL 3T3MF 3QHTC 4GRWB 2C9RA 2Z4QB 4ZTPL 3FU6A 5I8EB 4L3CA 4XH2B 5CBAB 4F5CE 2BSEA 4HD9A 4KK8D 2OP4H 1JZ4A 3EFDH 2W07A 1I8MA 1DDHB 5F7DB 2Y36L 2G75B 3D3VA 3INOA 4IQHA 3TO4C 1AQDA 2Y07L 5EZOH 1J05A 1HX0A 3FFDA 4WI4A 1JK9A 3MBEC 4LKCA 3U7WH 3UL7A 2X44D 3JWOC 4FJ6A 1FNSH 3L8QA 4LK4A 1NM9A 2KDGA 5FW7A 3KPTA 3MOBH 2VXVH 5DJDB 1GHFH 1EFXA 3CHPA 3RX7A 4H88L 5HHQB 3BH9A 5BS0A 1P6FA 4MQWX 5T1KD 4P5TD 3SY0A 1ASQA 2IH1B 4WI7A 1P4IH 5F1OB 2YMTA 5FR3A 4XO4A 3CQPA 4DCQA 4AQ1C 4X0KA 5ICXB 2YMXL 4HU8A 3S3JA 4HX1A 1JWSB 2W80C 4M7ZB 2D4FA 1EJOL 1HXKA 4DKEL 1T83C 4TULL 1M6OA 5LFNA 4FCAA 4RFNB 4PLKD 4LCIH 4Z7NF 4JM2A 3T1WA 5AZ2L 1MVFA 4ZNCD 1U8KA 4RMTA 5BZZA 1S7QA 2C9UA 1UB6B 3QIBD 2GHWB 4F7CA 3MLUH 3WJMA 1SEBB 4G6FD 4PQXA 2D3VA 2IGLA 3U4KA 3ILPA 3PABB 5KVEE 2IAAC 2G2NA 2WLKA 1KTDA 1H8SA 4LLAA 4ODTH 4OCWH 5JQHC 5CEYB 5CGBA 1LO3H 3FQYA 3PV6A 3SZKC 3V8OA 4BRJA 5D72H 2DQEH 3HHMA 3OMIB 5MEQB 2NY1B 3VFVB 3QC6X 2JKRM 5DMKA 3D51A 3NGBB 1INDH 1TQBC 3QFDB 1QQDB 4TQEL 4XAWL 4CKVX 3DSNB 1NKRA 3MLXL 1RZIA 4N20A 3RGVA 2LU3A 1HXMB 3PYCA 1KLFB 2X3AA 1RK7A 2VLKE 3Q6GH 4POYA 3TC9A 1KUMA 3P11H 2VJXA 2PPCA 3MLVH 3RWFB 3CWGA 4RAUA 3OKYA 1G7QA 2C7UB 3BVNB 4IIQB 3UYRH 9CGTA 3RKDC 1K6QL 5KBMA 2M26A 4MLSA 4EZGA 4K5MA 3Q1EA 1QSEB 2BXZA 4NP4H 3CFBB 2Q0ZX 5IIEA 5BVJA 4LLUA 3KLHD 1UVQA 2FQGA 2WWKT 1KN4L 3DARA 4HJSA 1KBWA 2CDFB 4AYFB 4UB0H 1I3RB 3SDYH 2P5WA 1RUQL 1UKQA 3A21A 5HGAB 5KUKA 1KV3A 4X6BA 3R06B 2DIJA 4KX8A 3O2DH 5L8JB 1ETJA 4KKRA 2ZP8A 2BS71 3TZVD 1JXJA 1KLGB 2ZXAA 3SPVB 2O61B 4E5XA 3N3EA 4JFEA 1WD8A 3DTDA 3EO9L 4XMWA 2ZCZA 3JQOB 1FGVH 1U3NA 2A9BA 2BZCA 2XY2A 5D1ZC 1ZT1B 1FF5A 5LXGL 2COVD 5FW6A 3UG5A 2IG2L 1RD6A 3HS0C 4UIKL 1J88A 3RILA 2EIKB 5T3XH 3MUHL 1XB3A 2ED9A 4NQUA 1F3JB 3PWPA 1LD9B 2DZEA 4J28A 1BD2B 4M00A 2IPKA 2MQ0A 2J4WH 2HTKD 3QAZC 3E4GA 3M07A 5DJ2B 2DQCH 3BC9A 1QLEB 4XXCA 1FNGA 2ZPKL 4L29B 3TBTB 1XGYH 1V7MH 3QJFA 4JPVH 4JKKA 5I18H 3ABKB 4ZOCA 1R0AL 3GHEH 5IMOB 5FGBC 3APCA 5F6IB 1HZLA 3O4OC 1OTUC 1NCCL 2EO1A 4U1IA 3GS7A 3S7GA 1OGSA 4OIBA 1OQXA 4OGZA 1RPUA 2P7TB 3UG3A 3ZT7A 1FNEA 4WTZG 4S1RL 1X7SA 2OYLA 3CFJA 1P1ZB 3NSFA 4OJFL 4D0CB 4AJWA 3LKNA 4RZCB 2JFCA 4JKPH 4B96A 4BZYA 4LASH 3T3PF 4JGJA 2UZXA 3TCTA 5EHFA 1ZDQA 2VCOA 2DD8L 5T33L 1CTMA 4KJWD 4Y19A 5JIHA 3ULVF 2R27A 3FQNA 4GAJH 1RIUH 3V6FA 4IM6A 3TNNA 1LEGB 3PJLA 5H94A 2BY3A 4C47A 1VAHA 3TESA 4LI1A 3FRPA 5FKAB 4H5SA 2C9SA 5ERWA 3S2AA 4GG6E 2A74B 3NSJA 4XVTH 5JMRA 5I5JA 1WGOA 1I7UB 3GSQA 2QQLL 1P84J 1SN0A 3IFNH 5EBLB 3ZTCC 4ZJ9A 4F9PA 2ODIA 3K5SA 1KB9K 4JN2A 3G9VA 3HA0A 3VGHA 4L3CB 3QZWB 5IGXL 3VXPA 3C75A 1N7MH 3DLQR 3L3IA 4HJJH 2XRAL 1B9ZA 2ROXA 3GLAA 3TXAA 5EMYA 5TH2A 4PWGA 4KTGA 2W07B 1I8MB 4JO3H 4FA7B 1MCWM 3D3VB 4TQIA 5LNDA 1AQDB 3L1EA 4RSYA 5AVVB 1J05B 3FFDB 1JK9B 3FSAA 3IDMA 5JXEC 4LKCB 2EH8L 1JGLH 1UM4H 1ZLEA 3P2DA 3QCVH 4TRPL 3TWCH 5LWYL 4M1CD 1HL5A 1GGCH 1EZVY 2GYSA 4WO0A 4JFSA 2DQHL 1KENL 1UATA 1M9LA 3V10A 2JJSC 1EFXB 3SQRA 1U93A 2FBRA 3BH9B 5BS0B 3RW7A 5HDBF 1N70A 3SY0B 3BAYA 3NZHL 1W8EA 3MRKA 5K69A 4WHCA 1IAII 3VU1A 3OKKA 4DCQB 2P9RA 4X0KB 4ESKA 4N2FA 1A6ZA 4HX1B 1J86A 1E9OA 1ZHBA 1ZLWH 1XTMA 5LGKA 4OT1L 1M6OB 3L3HA 4PJGF 5KSAA 2E7CA 2DQ6A 4OVVA 5CKAA 2G9HA 4JM2B 5EZPA 3MQIA 2CA6A 4RCAA 1E2WA 1S7QB 2KHAA 3M8OL 4OZFH 3WJMB 1F45A 3ZZLA 1DQTA 3ILPB 3BSZH 3IKKA 4OSUH 1KTDB 1RCYA 2Q7YA 4BCXA 3QHFL 5I1HL 2VSMB 3ALXA 3DJTA 3HG1E 3QUMH 3AW5A 2B16A 3PV6B 4YDZA 1SN2A 1WSST 1NMCC 2R0KL 5AVSB 4HJIA 3VACA 4JVPA 2A6DA 5DMKB 1GIGL 2HLFD 1M7XA 3UAEA 4JR9L 1JZDC 2G5UA 2YWYA 3V9CA 1TZIA 2WQ8A 4XCCL 4G7YL 3RGVB 1RZIB 3PG2A 2VLKD 5KANG 2WBJA 3HR6A 1K4DA 3F7QA 3VD3A 4YMPA 5HDQL 3KNBA 3N44F 3A6CH 4M5TA 5HGGS 3ZZ1A 4FMFA 1SMDA 1IKNA 3GRWH 4WTWA 1RULH 3L5JA 4RAUB 3EYUL 1G7QB 1TU2A 2Z92A 1UXSA 2WXFA 4S1DD 1NC4D 2MKLC 4LSXC 3WPFA 3LNDA 3KWVA 5IBUG 3KVDD 3IJSA 1DVTA 1BV8A 5BVJB 4LLUB 5IIEB 1UVQB 2BZDA 1XWVA 4QXGH 3C12A 3TFKC 1QSZA 3QCTH 2P5WB 3P0VL 3VGBA 3VQ2A 1OM3L 4YDJA 4X6BB 2ESVE 2BNRA 2Q8AL 5DJXA 3MOAH 5D9SA 2YQBA 4JFTA 1KEGH 1FHNA 5E03A 3O9WA 1RUML 5F7HA 4N68A 3OHXA 4E5XB 4JFEB 5CFHA 2E56A 4AUYA 3N41B 1AGDA 3S35L 1NEZA 5EDSA 5CINH 4MQTB 5C07D 5E2JA 1NANH 2BVEA 2J88H 1CE1L 3IDUA 4Q56A 3SDAC 2NYYC 1G1CA 3PWPB 3QWRA 1OLZA 3H56A 1EBPA 1PX3A 4LPUA 4ZNEA 5B3JE 4K7PX 3GLDA 2IPKB 3MA7A 1GAFH 2ZQKA 2NT1A 3APDA 5KSBF 5L8LB 1TZHA 4HSCX 3DIFA 3DX1A 4Q89A 3AT0A 3GSNH 4ZRGA 4CSSA 4F8QA 1FNGB 1XGPA 1IU1A 2QVTA 1EIBA 3LCYA 3QJFB 2EIDA 1P4BL 5EUOA 2X6UA 4KO7A 2YD4A 1ZLSH 2OW7A 2BY2A 2MCMA 4A2DA 1QEXA 2CH8A 3GYRA 3HKZA 1H0DB 4U1IB 3HKFA 4TSAL 2YRLA 2APBA 2Y2YA 3WXVL 2X89A 1A47A 1ODAA 1NCOA 1MAMH 2P5PA 5LGJA 3Q13A 4ZUVA 1FNEB 5ABDE 2AZAA 2CMRL 3CFJB 3SD2A 3EAKA 3LKNB 4O9HL 5AB0A 3LY6A 1W0WA 2VKXA 2UZXB 4I87A 4KDVA 3PHOA 2EXTA 3QI9A 1WHPA 2B3RA 2DQJL 4Y19B 2YEZA 4JQXC 3FQNB 4NQDD 1OE3A 4KQ3H 2FBJL 5AWAA 3V6FB 3LRHA 5DD1H 4NJ9L 5H94B 3TNNB 4N8PA 3FRPB 4H5SB 3GNMH 5ERWB 1B0WA 1NPUA 4W4NA 2G5BA 1C5BH 3BZ4A 2ERJB 2M2DA 3GSQB 1IO0A 3T6WA 1TZOA 5HPOA 2ZP9A 2YARA 2JB6A 4JN2B 3UP1A 4GRLA 3PDDA 4BUQA 2A9CA 4R6UA 3T2LA 2YUZA 4S1QL 3VXPB 4DKAA 1MJJA 3L3IB 5CCKL 4PW9A 4UOQA 2AJSL 2OTWA 3F01A 4QLRA 3EF4A 4MQ7A 2GBUA 4UQAA 1KELH 1DVFC 4TV3A 1DANU 4NPJA 1BGXL 3IDMB 3AG2B 5KJ7E 3SKJL 5KG9B 4JRFA 3SGEH 5AL0A 2AJUH 1AAJA 4CGTA 1RIHL 1IJNA 1U30A 3WEAA 2QQNH 1NDTA 4P99A 3X2QB 5IFHH 3TF7C 3QB7C 1TQCC 3IJYA 3PWVA 4JFFA 3VI3E 1HYSC 3CN4A 1U93B 4HFWA 2Z0UA 4I0PA 4ZMLA 5TFSL 3IU3A 3MRKB 1GOFA 4J3OD 3OKKB 3D48R 4JO1H 4M1DH 1A6ZB 3OG6B 1E9OB 2YAQA 1ZHBB 3QCUL 1WLHA 2I26N 4GAFB 4B8CD 4C4UA 4W9CC 4M62H 2WQWA 2ICEA 1LO2L 3L3HB 4IDJL 3VG0H 4J2XA 5KSAB 5BRZA 2FBOJ 2ZCHH 2NY3B 1J1XL 1DJXA 2W65A 2G9HB 1U3HD 3NA9H 4RCAB 1EDYA 3VSQA 5D4IA 2VDOH 4AZ8A 4ZMYA 2YD1A 4M7EC 1KCWA 3F05A 1E5BA 2P5EA 1A8ZA 3G08A 3M1BA 1DSFH 3T0XA 1LL1A 3TCXA 2ORBL 3HG1D 5CJ5A 1BOGA 4LCCC 3DTXA 2WSDA 1QZ1A 1GTFA 5MEOA 3VI4E 5SWSE 3DETD 3B7RL 4P46A 1HHIA 1T4WA 2CA3A 5DTFA 4ZW7A 4XO3A 2A6DB 4U31A 4UQ2A 6FABL 3MUJA 5DURB 4R09A 4U6XA 4RETB 1KGJA 5FDWA 1TZIB 2WBJB 1K4DB 2DQDH 2EIJB 3MJ7A 2B2XL 7PCYA 3KNBB 1A4CA 1OT2A 4JKWA 4XP4H 3HZMA 5KVDE 1ADQH 4J4LA 1BMZA 2PCPA 5LDUA 3EDJA 1TU2B 4XB8A 2Z92B 4HYTB 4ZQKA 4ZUWA 3ZDYB 1UXSB 3GUTB 1AXSA 4Y4KD 4KI5F 3IJSB 3QUZA 3N42F 2DYPA 4TKWA 4CGUB 2YAFA 1D5IH 4G8AA 3T4AA 4BQ9A 3O4LA 3O6ML 5IZ7A 3MLUL 4AGOA 3T6VA 3SPGA 2DQMA 1KMGA 2ESVD 4YBQD 4JKMA 2V4LA 3GMQA 4QUOA 4YDJB 5BZDA 1N6UA 2BNRB 2XG4A 3UFIA 2EECA 1RURH 5DJXB 5D9SB 4OF6A 5GIRA 1W9XA 4NM8L 3O9WB 2GTZA 5C6TH 3OHXB 1DVSA 1M2VB 3I84A 2MQGA 3LXBA 5MI0B 2WIIA 1LDPL 4DNLA 1IGMH 5DMGC 3X13A 1L0PA 2HYMA 4FQXC 1AGDB 1Z7XW 3OJMB 1NEZB 3CH8A 4JL2A 4JHWH 2APVA 5HJGA 2UWEE 1ORSA 4G6JL 4OTXL 1RZJL 4X5XA 4MTMA 5EIIG 3MNVA 1UJTA 2LTQB 2BFVH 3E7JA 2FDBP 3MA7B 5E6RB 1TZHB 3CVRA 1ZE3H 3DIFB 4PGJA 2Y1AA 2D7OA 2WD0A 1XGPB 4GUQA 3MLWL 5F3BA 5EUOB 3CVCA 2OLDA 3NIDF 2EDRA 2O93L 1BMGA 4BV1A 2RR6A 1BXXA 4M4PA 4CL7A 3DV6A 1T2XA 4C2AB 4QTIH 4YPGA 1PZBA 3DDFA 5LGJB 4KRPC 4ZUVB 2V7NB 2PF6A 2B9AA 4YGVA 3TVMA 3MV8A 1KBBA 2H0FA 4ZXBC 3MNZA 2NZ1A 1HI6A 4DN4L 4ADIA 5I5IA 1RUKL 1W0WB 1M7UA 1I9IH 5FM8A 1JZHA 3PHOB 4N25A 4U09A 1FAKT 3LPGA 1PD0A 3QFJA 3QI9B 1YHPA 1UZ6E 2OK0L 5I6LA 3LN9A 1FGVL 2YEZB 3V4LA 1SLUA 1DYZA 3X3GH 5JTWA 4YSDA 3X1BA 4R6GA 3ETBF 5C0RH 3AU0A 4E42A 5JW5A 3KYAA 5SV3A 4ATTA 2G5BB 2R4SH 4D0BA 2BIOA 3RIZA 3FH5A 2D31A 4GQQA 3BZ4B 1VFAA 4WDIA 2JTYA 3EFOA 4HK3J 4XC3H 1LQBC 2JB6B 5HI4C 2Q10A 4GRLB 3ARBC 3S8FB 3SBPA 5I18L 1MJJB 1MN4A 2IDQA 3GHEL 1L3WA 2OTWB 1UD6A 4HOWA 4MQ7B 4WV1A 1RZ8A 1TQSA 3CAFA 3GSXA 4HAKA 1AR1C 4HBCH 2L8AA 5JIKA 5GISL 4N2KA 2FLMA 4C55A 3BX7C 1L0XA 4FCGA 2BOCA 4Z7OF 2WKOA 2K6ZA 2IDTA 4RGMC 2A1WL 1X5HA 2NY7H 4HD5A 4V2BA 3IJYB 3PWVB 3DYOA 4JFFB 5E2UH 5KANI 1CUOA 3OXSA 2IADA 4HFWB 4I0PB 3SD5A 4WWPA 3U1SH 2YQGA 3EHBD 1A7RH 3KGSA 3SE4A 1JNNL 5EF1A 5IYXC 3BGMA 3IU3B 4J3BA 5I74B 3SDDD 3OKEA 4NKHA 3GKWH 2LLLA 4TF4A 2O6EA 4QNPE 3OG4B 1U42A 2ICEB 2JI3A 5DUML 5BRZB 1SOXA 1HDMA 2QZ5A 2W65B 5FW8A 5C0AA 2JCCE 4N1CA 2WWNA 2FWLB 2YGNA 4K5NA 4LARH 4W81A 5A7EA 2V2TA 1VCAA 4R5VA 1FZJA 5DD5H 4AIXA 2Q3ZA 2H26A 1P8TA 1JD9A 4AZ8B 1L9RA 4L1LA 3WKYA 4OF8A 3N1PC 5AALA 4RCWA 2P5EB 3G08B 4G9FE 4O00A 1ETB1 3M1BB 2G2PA 4F37F 3TIEB 3LV3A 1BOGB 4YHNA 5SWSD 3DTXB 1DQDL 1U8LA 2RB8A 5MEOB 1W0VA 2FH6A 1AZBA 2X38A 1JN6A 3P9WB 4P46B 1GJUA 1HHIB 5DTFB 3DTUB 4OZFB 1ZTXL 2WZ0A 4M3HA 4UQ2B 5FECA 1BVNP 2APTA 5FDWB 3F3HA 2XV0A 4S1SH 5E6IC 1N26A 3SQBA 3KZ8A 1EO7A 5GGSY 3CHQA 3PHQA 1XF3A 4AE0A 4M6NL 3MJ7B 5SX5K 4E9QA 4X2UA 1WV7T 2XKNA 3ZRFC 2R9HC 3V0DA 1G7PA 4PJ5D 5D6DA 5ICUA 4CU6A 4R2GB 3HZMB 5DEJA 3EJZD 2PCPB 1R5WA 4ZUWB 4ZQKB 4ZZFA 1AXSB 5AAWA 3KJ6H 2W9EL 2R51A 1A7PL 1AD0A 1PNDA 1T4KA 3QDME 3QUZB 4JG5A 4NGHL 3O0LA 4WUUE 2DYPB 5E56A 1H6UA 1DBKL 2X4RA 4Z7WE 1TPXB 3T4AB 3O4LB 1ADQA 2DH3A 4MCMA 2IVFC 2WZ5A 2HJKA 3GGWA 3GMQB 1YEKH 2ZX6A 5BZDB 5JW4R 1MJ8L 5DZNA 2XG4B 4HS3A 5GIRB 3VUAA 1NSNL 4QKTA 1U8OB 2GTZB 5GGTH 3FK3A 3DGDA 3DUHA 5ISZE 2NY2C 1NFDA 3TTSA 3KH3A 3VD0A 1EH9A 3PQYE 2WIIB 2DQIH 5ALCL 3X13B 3P54A 3H2PA 1R33A 2WKGA 1NMBH 3AM8A 2FJFA 3S5LG 3VSTA 2FX8H 4XP5L 2YD8A 3CBJB 2DLEA 1ORSB 3ZN6A 2NY6D 2YFOA 4DVRL 3MNVB 3CVBA 3EUUA 4OJCA 5D5MA 3ESVF 2X6AA 1T89C 1E2ZA 3BN3B 3Q1SH 2XUWA 4FLHA 1K3ZA 1V7NH 1EV2E 2ZE0A 3VXME 1EEYA 3BUBA 3NA4A 5F3BB 3SCMA 1BJ8A 2DQUH 3C6NB 4LLQA 3QQDA 1E5ZA 5IF0A 3GI8L 5INCA 3RIAF 1XBRA 5SV4A 1GW0A 3DV6B 2H0EA 5GGSA 3X1EA 3IEAA 4Y16A 1CGSL 1L9TA 4YPGB 5I30L 5F0PB 5LKNA 3L54A 4B7LA 1BQ5A 4YGVB 1LILA 3AUVA 3TVMB 4AMKH 3MV8B 1SPDA 4Z7UE 3SHSA 3WIHL 1PZAA 3MNZB 3NTCH 1HI6B 3VRJA 5C2UB 2XLLA 3NSDA 4ZX4A 2R9UA 5LGHH 4NDMA 4HWEH 5IKCA 4HISA 3QFJB 1EHLL 1T0PB 2XWCA 4XN2A 5AZ5A 4Y2NA 3KPLA 2B0SL 3P3SA 5I19H 5CJXC 1FH5H 2DOCA 3C87A 1YNTA 1LXMA 4E42B 4NZRL 1MI5E 5JW5B 3BSHA 3INUH 4D0BB 4P3CL 1QRNA 4ZOEA 2D31B 4WDIB 5CGMA 1VFAB 1CZ8H 4WK2B 5FV2A 2W9DH 2WXPA 2QFPA 5EU6A 3JB9j 1L7TH 2VXTH 4BCYA 3GBML 1DL7H 3BW9A 2AABL 1D0BA 4WW1A 4JY5H 4HUKB 2KL6A 5AOLA 4P9HL 4OU3A 4WV1B 3DMMA 1RZ8B 1AIZA 3GSXB 3B7SA 1VF5C 3BZEA 3MRDA 4LPTA 3V7AE 1E8YA 3MV7E 3VGEA 2JKWA 2PO6D 2J8UB 5J3HD 2BOCB 4NN7B 4V33A 4EDWH 5HYJD 4YHOH 1G0YR 1X5FA 2B1HH 4I3RL 4OLXL 3UBXG 3DYPA 4ONGL 2EE2A 4A7SA 4CU8A 2HRGA 1UWXH 3OXSB 2IADB 3AMLA 4M7ZC 1MELA 2M8XA 5F0MB 3TFBA 4N0FA 4JRYE 2Z31D 4IYKA 3BGMB 5A3ID 5K9OA 4RFNC 2YLKA 3WTUA 1THCA 4YXKL 3FU7A 3IJ7A 4HEPG 3OKEB 5JDSA 2VN4A 1H5BA 4APQA 3GBNH 1OAKL 4KMLB 4BFFA 1RU9H 1RHHA 4X98A 3AS3A 5EPMA 1HDMB 8CGTA 2H47C 4NQCD 2XQYA 2CJ3A 5C0AB 1BJ1J 1FO0H 2GQHA 2WTRA 2V2TB 4EZKA 4YDKL 3BWUF 5I23A 1FZJB 3MLZH 5A2AA 1EJFA 1A1NB 2H26B 3IGUA 2V5RA 3WS6C 1X5JA 3DX7A 1E9QA 4G9FD 5I1JL 4M48H 2NY1C 4JO4L 3FUMA 3WI9A 4KKCD 4QRPA 4WSGA 4FS7A 3HC3L 3I3DA 3LV3B 5CU5A 4YHNB 3WHE1 3NGBC 1WA2X 5HYSG 1U8LB 3TS8A 1QYGH 1W0VB 5I1IL 1HQ4A 1JN6B 2NNRA 1QHPA 4B5ZA 2VDOB 4LRIA 5FECB 2G5RA 4IBWA 3IB4A 5T1MA 3CK0H 1QSFE 2QQQA 3I6LE 4KK5D 2GVYA 4LSSH 1PLGL 4PHZA 4IIQC 1IRAY 4PRNA 1SMOA 1XF3B 2V9RA 3PHQB 5E7FA 3I2CL 2JK5A 2XKNB 3SDAD 1D7CA 1G7PB 3TA3D 3W81A 4L8CA 4ISVA 4FRWA 2FEDD 2NTFA 4E9XA 1R5WB 2K6YA 3SPHA 2WWMC 3MRPA 3OC5A 3ZTEA 3G5ZA 1FAIH 1W91A 2X4TA 1AD0B 3N40P 1T4KB 3T6QC 5KYUA 3VQMA 2X4RB 2YOAA 3JWDC 1V3LA 5BQ7A 4EAEA 1BXUA 5K5YA 1AMXA 2FT6A 3V4VH 1KCLA 3GGWB 2HJKB 3ZTNH 3ZT6A 1QBLH 1FP5A 3FH8A 1IEHA 4HS3B 1X6NA 2Z64C 3UZVA 1FHGA 4K8RD 5ISZD 3ESNA 1BM7A 1UWEH 1XV8A 5LO7A 5C08E 3PQYD 3DHUA 1U2CA 1NFDB 1EXHA 4LLYA 2XN2A 3K2UH 5HHVH 3F7YA 4E9YA 2Z6FA 1LK3L 2OTPA 1PGRB 2FCBA 4YE4L 4OZIA 4UQ3A 2HZHA 3DX6B 3VQ1C 2FJFB 5JOFA 5TD4A 2BMKA 3DJRA 4F7MA 1G9NC 1KJ3H 5GGTA 4W9FC 3WTTA 5D5MB 5F6IC 5TE4H 5FDYA 4X4ZA 3VXMD 5LVEA 1DVXA 4MB3A 3WGVB 4BZ1H 2FD6H 3F64A 3PAYA 2IV8A 1EEYB 1K5GC 5DGQA 1WEJL 3ARVA 4LLQB 3QQDB 5IF0B 2XWEA 5INCB 3IKCA 3JYCA 4DKFH 4WO4A 2IH8A 2PYEA 3FCGA 3ZDXF 4POZD 4XNUL 1MFBL 4QAMB 3O53A 5GGSB 4HQQL 1DVFD 4Y16B 3BLKA 3ARGA 4NM4H 1TKWA 2W92A 3A6BH 4N0UE 4MJIA 1NL0H 4FJYA 2CDGA 2C9VA 2HP4A 4I1NB 3MXWL 4WNJA 5EOQL 3VRJB 1TTGA 2VXQL 5EORH 3B9AA 5IBLC 1T5XA 3CFIC 2P8LA 4NDMB 4MAYD 5IKCB 2VWEC 4ZFGH 2A74C 2VC2H 2PCFA 5C86A 4M7KL 1AE6H 3KPLB 4DP9X 4JO5A 3TM6A 3FSWA 3UN9A 3KYOA 5L88H 1MI5D 1YNTB 2UVFA 4QLWA 2RD0A 5E51A 2EADA 4NAMA 3IMVA 3JT0A 1QRNB 4KZEH 1EHNA 4K23H 3ARDA 3ZHLA 2AJZA 1QFWI 1R47A 1Q1PA 2XNAA 2BSRA 3GHBL 1UGKA 3JXAA 3ELQA 5EU6B 1B2YA 4UM9D 1FBIL 3V7AG 3BW9B 1LE5A 4WW1B 4UTAH 1UOVA 4M43H 3VXRE 1ED3A 2I60H 4I4WA 5KVFL 3DMMB 2DI8A 3MRDB 3BZEB 1P7KA 1EZSA 4QIRA 2CBOA 1ET5A 3MVSA 4HKBA 5B39G 2WYZA 1GSMA 2VB5A 3FN0H 1KGWA 3I50H 1KTLA 4OQTH 4R90L 3O3EA 1F90L 4AKOA 4UT9H 1T7ZA 4KXZI 5I17A 1FYTE 3DRTA 3VSUA 1G87A 3B5HA 4NRYA 2X70A 4JRYD 3VD9A 1CYXA 2BS8A 2XY1A 4N0FB 2X87A 2X0UA 5K9OB 3ML8A 3FU7B 5JDSB 3GMRB 3U0WH 4APQB 1H5BB 4MRCA 2BSSA 2XZQL 5T1DL 4QRRA 1OT1A 2R4SL 5ADOL 3EYSH 4WEBH 5D71L 4X98B 5EPMB 3I6SA 4ZMVA 4HZ1A 2V17H 1DQQA 1FZKA 3FSVA 1HKLH 3FC8A 3BPNB 2WTRB 4LVEA 5D4HA 3DHJA 2NDFA 3QNZA 4JHUA 2TSBA 3OLIA 4BBWA 3DX7B 1ZIAA 1E9QB 2XYCA 4OGXH 4YWGL 3OJVC 5FEBA 4PW3A 1V55B 4QRPB 4LAJH 1N12A 4BUGA 2WUBL 4IW4C 2KC0A 3G3AA 1JERA 1KXVA 2GFBA 4K9EH 3RGVC 3SKMB 1HQ4B 1Q72L 2VL5A 1DJWA 1IMHC 5BRPA 4PYGA 2MHAA 5HP5A 2VMCA 3TO2A 5KSVB 4Y61B 2YSTA 5DMGD 1QYYA 3I6LD 4XCNA 5T1MB 3D1MC 1A3RL 1ZHLB 2FUQA 3RDTD 3WGUB 1I3VA 2DBJA 5KS9A 5K9QI 1VIWA 1GKOA 1MF2H 4KNSA 4HUCA 4PRNB 4QD2E 5J6GA 2FGWH 5DJ0A 2DIBA 1IC5H 2JK5B 1NBCA 1IAKA 1BJMA 3NABH 4L0YA 4L8CB 4ISVB 5SWQA 4PJXE 2NTFB 2GBVA 1M4KA 1RZ7H 3C6LA 4Q97A 3U7AA 2VXSL 4DEWA 2VN3A 5DS8A 5HGDA 5DC9B 3MRPB 1U95A 5DUPH 2AS5M 1AQKH 2NR6A 4BZ1A 3G5ZB 1UCBH 2X4TB 4H0IA 2CNZA 4GXVL 2YD7A 4PM1A 5EV7A 4XGZA 5DEGA 3KLKA 2LU4A 5KYUB 3NCYP 2J20A 2JIXA 3BWZA 3PGDA 4IKLA 5BQ7B 3ZGHA 1YJDC 4G6KH 3B34A 3X14A 1MRFH 4NC0B 4Y1AE 4XVSL 5EFIA 3UL4A 4B41A 5EEVA 3HEIB 2VLRD 1QATA 4KRPD 3UZVB 4B27A 3VA2C 2BRRH 5EO1B 4ZXBD 5DF0A 2QFRA 1Z0NA 5EOCL 3BP7A 2F5BH 4LLYB 1DQLH 3F7YB 3I3BA 5E8DL 5CN3A 1KJMA 2ZYSA 4OM1H 4UQ3B 3V4VA 3MV11 4OZIB 2CK0L 4G59C 2CQVA 4K3JH 4MVBC 4ELKA 4E36A 3BEVA 3W0WE 5JOFB 3T0VA 2BMKB 4RFOL 4PCYA 3FO0H 2DY2A 4S1SL 4F7MB 3L6FA 4XXCC 1P0SE 1D6VL 4RRPA 3SDXA 5EEYA 4GRWE 3LVEA 3FHQA 4GI6A 5EA0H 4NPKA 4U1NA 3HRZA 4FQ2L 3RA7L 1TYJA 4EIZC 3AQXA 3H53A 4Z77A 2ZUYA 3UGXA 1JFQL 2E46A 4K9JA 1U8QA 1QFUH 2HJLA 3IKCB 4GO6B 1L4IA 4DEUA 2CUAA 3TH4T 4WO4B 2PYEB 2L3BA 1OOKG 1D7BA 3P30L 2LLGA 2DV6A 1AR1D 3BZFA 3JWNC 2ZTBA 3ARGB 3QARA 1ESOA 4WEEA 1OP5K 1TKWB 1XT5A 1JVKA 1XSIA 2K45A 3DGCR 5FGSA 3UBXI 4MJIB 4U4BA 2CDGB 1JFHA 3PWJA 1QO3A 2YIHA 5AVUB 3QG7H 5CUSL 1T5XB 4ZMPA 2P8LB 4NJAL 3IMUA 1S3KL 2PCFB 2NCEA 2R59A 2Z63A 4QJ4B 1Z9OA 2ERJC 2YK1H 3KYOB 1DQVA 3EUDA 4Y5YC 3LS5L 5EDXA 3VGFA 3W3NA 1N68A 4NZTH 2JB5H 4DGIL 4LSAA 1MFAL 3ARDB 2AJZB 2NXYD 5IQOA 2XNAB 3FHEA 5EIVA 1IBYA 4OLUH 3ZE1F 2BSRB 2RGSA 3ISRA 1V27A 3MLSH 4H25A 1PZCA 3QXDA 4UAHA 25C8L 4Y2OA 1CD1A 3VXRD 4HLZH 1LE5B 2AW2A 3DOSA 5B38A 3W1ZA 2EVFA 1ED3B 1GOHA 4I4WB 2ZAIA 4D8PA 1P7KB 1XZWA 3ETBJ 5FYJL 3TV8A 4HKBB 3ABLB 4Z7VF 1MVUA 2AXFB 3RTLA 4HPYH 2NY0D 1KYAA 4DGVH 1IT9H 3KM2A 2AGJL 2BHFA 3O3EB 3OAZH 4UTAA 4A37A 4ODHL 4HXAL 4PJEF 2I69A 3FF8A 5HVFB 3DRTB 3EJJX 5I17B 1FG9C 2BP0A 4QRSB 1PU0A 4NRYB 5M95B 1ROCA 1FFRA 3TGXA 2V2WA 1J9TA 3MREA 5KSAC 4OQTA 4Z7QB 2NY3C 3R7RA 4ES9A 5AWNH 2L0DA 1QSEE 2BSSB 2ADFL 1SQ2N 2B4CL 4QRRB 4RGNB 3TT3H 3E3QC 4E41A 4IRZL 3S37H 5IROD 1DQQB 1FZKB 1TOXA 4HWUA 4LL1A 2FQEA 4J7RA 1ID5I 2XPYA 3ESMA 1NCGA 2TAAA 4PRPA 4X50A 3QNZB 1IAIH 3BPCA 4PEQB 4YSRA 4HJGA 2EH7H 1VLXA 2YAPA 1YG9A 5E0QA 3LRSA 4ZD3L 5K93A 5AW0B 5IW3A 4X9FA 1X5YA 3NUKA 5DJAA 3CSBA 1GZQA 4P5MB 1DBJL 3VFWA 2GFBB 3UJIH 1JXFA 2YPLA 4KUZL 2WBJC 2VL5B 1A6PA 1KCSL 3QPXL 4YHOL 5ICYA 2MHAB 3TO2B 3WEOA 1XCWA 1IKNC 4XCNB 5KUMA 1JZ5A 2IWFA 4PGCA 5KS9B 4JDEA 3LN4A 4NLHA 2Q3AA 5LB1A 5BVPH 5J6GB 5IUCA 1BYPA 1YYCA 4L3EA 1TCMA 4DSYA 4CA4A 1SLVA 5FCSH 1IAKB 1KC5H 3C8HA 4Y7MA 4OUUA 1RZJC 3FULA 5SWQB 2HUEA 1FJ1A 3SBWA 1UOWA 4FOMA 3VGGA 5AW6B 5DS8B 4MCYA 5HGDB 1U95B 2HLAA 2YR3A 2DQGL 2EYTA 4NKMA 1IV8A 2H2PD 3VQ2C 4P23D 2WWKO 4XGZB 5DEGB 4N2NA 4U06A 1OAJA 3PGDB 1J10A 1UD3A 2VZTA 2RIKA 3M45A 4Y1AD 3X14B 1SDAB 5C6WH 3GI9H 3CXDH 5EU7C 5EFIB 2WXGA 3OHXC 3BKJL 1UWGL 2E9WA 5MI0C 2OBGA 1YSOA 4HA1A 4CADA 5G4OA 1EEQA 3HAEH 2YD5A 1CYGA 4ZYKA 4V2EA 2UZYA 3JBG7 3FT4A 4NNYA 3BP7B 5F6HJ 4NI6A 1KJMB 3C2AH 1IARB 3V4VB 3W0WD 1TCRA 4ELKB 4KDTA 2XQ0A 2W9LA 1Y1DA 4B53A 2VYRE 3BEVB 3ZUNC 1BF8A 3ZQXA 3M86A 3L6FB 1A9VA 3SDXB 4CBPA 4YDLB 1HL8A 1BFSA 3GMOA 4I1PA 4MMXA 2VDNL 1YYLH 4YFLI 4U1NB 3HRZB 1PLCA 3K6IA 4OCYL 5EEWA 1X9UA 4KXFB 4R5DA 2XA3A 2UUDK 4DUVA 3GEWB 2ZNXA 2F53A 4Z77B 1MZYA 4YHZH 4WSKA 1NJ9A 4J3XA 3OF6D 3D3VE 2FO8A 1U8QB 2HJLB 3AJ7A 1CFTA 4PJIF 2CKNA 4JM4L 2JI1A 4MMZA 3S88H 4R84A 3BUIA 4UCFA 2XX0A 3BZFB 5GRYA 3ZKSD 2WLMA 4AH2A 3QI9C 1Q38A 1P7HL 4OFYD 3Q2VA 1NGPH 3VH8A 3PWJB 3PXHA 1QO3B 1SNRA 4MX7A 3TN0A 5L2JA 3WNLA 1ZHNA 5EWIL 5D1XE 2MPAL 5DJYA 3UGEA 3K8LA 4GRLC 1T2QH 3VA6A 3LEYL 1A64A 5IQ7H 1MIML 4HGWA 4S11A 1MDTA 4UOZA 3EJCA 1BBDL 2VC2B 1I1YB 4G8GA 4YAQA 2CBMA 3ZHFA 3QDGA 4YH6A 4H25B 3H2WA 3QXDB 1X5KA 4Y2OB 1CD1B 3MDJA 3BCDA 3OZ9L 5L4FA 3NEEA 3DOSB 4DPCX 5B38B 4Q3GA 1RZFL 3VYPA 1MWAL 1KIRA 2UXFA 5BZWA 4X0NA 4EVNA 4GH7B 4D8PB 1ZWIA 4O02L 1WCBA 4FTVD 2JQDA 5DD0L 1SXSA 1MVUB 2ZXDA 4F27A 3K8MA 3ISWA 4I0PC 2VDQH 4XHJD 5E6ZA 2YD6A 2DN7A 1H19A 2Q7AA 3JVGC 4WW2A 1ERNA 1EVTC 1QBML 2CR6A 5I74C 4JY6A 2EZ0C 3PCYA 4Z18A 3QBTB 2BP0B 3D0VA 5AW7B 5GXBB 2VC2L 2WKLA 4GYBA 4PJ7A 2WLLA 2CPUA 4F2FA 4N6RA 3NYKA 2V2WB 2ICEC 3F85A 3MREB 4P4RA 2YXMA 1JI2A 2N1TE 5FYLL 4L0ZA 1F13A 1QSED 3VYNA 1J8HE 4XZUA 2DJSA 2YD9A 4OB5L 4O4YH 2CDEA 5GZOA 4AT6A 4E41B 3RB7A 3U4BL 4FN0A 3DUUA 3LXUX 4PRPB 1G7JA 1I85A 2WW8A 2Y24A 3BPCB 2HMID 4FQ1L 4AYMC 4HJGB 5JIIA 3SOBH 2HFEB 3LRSB 4P46C 4L4JA 2DWTA 2A3TA 3A4AA 4F57H 5DJAB 1GZQB 1T80A 3MUUA 3NAAL 3KDMA 3MFFA 1NGWA 3VWKA 1QR1A 1EPFA 1ICTA 2UX6A 1RK0A 1HOCA 3VFWB 3VGDA 4PLOB 4KFMA 1XGRA 2WANA 2YPLB 1RUAL 4ZTOH 3U79A 4OZGF 3NZUA 5ICYB 2KZKA 4KO5A 2I9TA 4NPYA 3PLYA 3NFSL 4HHAA 1BQKA 2TRYA 4PGCB 3PWPE 4JDEB 3LN4B 3EOTH 2HH0H 3S48A 4PJFF 1M3IA 4XP1H 4FQLH 1CTNA 4OLEA 2O6DA 3T04D 1BM3L 1DS9A 2EXWC 4OUUB 3QUZC 2WCPA 2ADYA 3U0WL 5GGRY 3B2VH 1JNHA 1FJ1B 4N2EA 3OJ2C 4G8AC 1CLZH 3VXTA 4MCYB 5BCAA 1OZUA 2HLAB 1MPAH 2EYTB 4TL4A 4NKMB 2VUOA 4X6DE 2F0CA 4NNXA 3KYKL 1W6LA 3QORC 2EP6A 1X9QA 4KTYA 4TVPL 1K72A 2C5DC 1E4JA 5JW3H 4UILH 1JNLH 5HI5D 4CADB 4Z1PA 4OI7A 1FL5A 2ZYHA 1MFNA 5F21B 3LMJH 3HNSL 3N1MC 4HVBA 4EBQL 4ZYKB 4ZBJA 2UZYB 2FZ3A 4H8VA 2QSTA 4XVJL 3FT4B 4K9EL 4NNYB 4Z8GA 4Z9KB 4J4PC 4EOWH 5DI8A 1IGTA 2YKLH 3ULSA 4FG6C 4R0AA 1KOHA 1TCRB 4JUSA 1ZLUH 3BVDB 4N5EC 1URZA 3HAEA 5BV7H 5H4YA 1JBJA 1OOAA 5LGYA 4NCC1 1UKSA 2X9XA 1XECA 1EDQA 1UD8A 2OCFD 3HW7A 1Z5LA 4FHOA 2YAMA 3GMOB 1JWMA 1U8JB 4MMXB 3OLEA 4PWEA 3RTQA 1SOQA 5KYWA 2MIZA 3SE8H 6TAAA 2XA8L 1RZ7L 3KGTA 4NUPA 2IAMA 4LPXA 4LSTL 5F6HI 4Q9QH 2E4FA 4ANWA 1MHPH 1ZEAH 3H0TA 3D3VD 5FYJU 4AC2A 4DK5A 5ADPH 1NJ9B 3KCWA 2WO4A 1QBAA 1T2JA 5TF1L 1BSIA 3FSOA 1CDIA 1CFTB 2BSCA 4MCNA 3TVMC 3KVQA 4MMZB 1LO5A 3V2AR 2PN5A 3B2MA 1MAJA 2XWXA 4LVNB 4PRIA 4JS7A 3ULUL 4XT1C 4AH2B 1W6WA 3AACA 2X41A 2CO2A 3TT1H 1Y6NR 2BCMA 2DLTA 2WLHA 3DI3B 3Q44A 2WINA 5EUKA 5GGRA 3VH8B 4LP5A 2EYRA 5L6YH 3FF7A 4MX7B 1XF4A 2ARJQ 1DQML 3G6JA 4X7SL 3TN0B 2F5BL 1NBVH 5L2JB 4IJ3B 4XPGH 1IE5A 4GKSA 2VDLB 1QI3A 4DFHA 1U0ND 5D1XD 1ZHNB 5F72S 2L7EA 3FT3A 3GSRA 1XH0A 3GM8A 1GGIH 4UMSA 5BOZG 5DJYB 4BFNA 2WYTA 3GUFA 3ZKMD 4EIUA 4HGWB 1G7LA 1N4XL 3P77A 2GBAA 4JM2D 5BO1H 3CFUA 3W5NA 3KBEA 1FNLA 3LIZH 1XF5A 4G8GB 4UM8A 1K85A 4YAQB 4OGAC 3IGFA 1UACH 3E3QE 4WV1C 5CR8A 3WE6A 5HD8C 5KTEL 1PS3A 3QDGB 2PPAA 5GZND 2K4WA 4GLRI 7PAZA 2ATKA 2WK2A 3WU1A 3ZHDA 4NN7C 4W68A 2IPUG 3OSVA 4LOUC 1KIRB 2EQDA 2JE0A 4M1GL 4LRNH 5BZWB 3QO0A 4AK1A 4EVNB 1ZWIB 2VDLL 1Y1UA 1WCBB 4EE2A 5KVEH 4HEMA 4P8SA 3WDIA 2EUZA 1ILUA 2EDYA 2PWDA 4XOAA 4L4VD 3QEQA 1TITA 2Z34A 2AK1H 2SODB 4Y89A 3RGVD 1QPPA 2ZYRA 1LWJA 3SE4C 4WW2B 4F37K 1JRHI 3QG7L 1TSRA 4JY6B 3H7BA 4XTRC 3EGSA 3D0VB 1EMTH 5IVXF 4PJ7B 2WLLB 1NKOA 4N6RB 5GHWH 5BMFH 1O6SA 4P4RB 2EC9T 3AUWB 1J8HD 4FNQA 4JHAH 4X8JA 3ZDYE 1DHKA 4HETA 1UH2A 4XZUB 2A73A 1CB4A 4YHKL 1JF1A 3C08H 3CSTA 3HNTL 4NNPH 2CDEB 3VMOA 3VTTA 4AT6B 4B60A 2R83A 4URKA 1NTDA 1A3LL 3L5WA 1IGYA 3QJOA 3KLAA 3W9EA 1NBQA 2XIBA 4XPHL 3VW3L 4CSZA 4MDJB 2JXMA 3DUUB 3L3JB 3BHBA 1G7JB 1JV5A 4E5XG 4H0HB 4PAZA 3EJTA 2NSMA 3VXOA 4GXUN 5J1AA 1CIDA 2B8OT 4MS8D 4GFXA 4ALAH 3I9PA 1MFDL 3QJUB 2DM3A 1MKFA 1YAIA 4L9LA 3KDMB 3MFFB 1NGWB 3VWKB 1HOCB 1OSPH 4U3XA 5TQ0L 2CBPA 1XGRB 2OAAA 3BMVA 1O5PA 5JZ7C 2XG5A 2I9TB 1XCTA 2J1ZA 5ANHA 1MFEH 3NQKA 4NPYB 5C09E 3PWPD 5D6DC 5AVWB 4BGDA 3MJ8A 4MVBD 15C8H 2QGEA 5E1HB 1KTBA 3LHPH 4KKLC 1DBAL 4UQ9A 4ZNEE 4PJHA 1HE7A 2WVTA 1A5FL 4R9HA 1Q0YH 4R7LA 3OB0H 3L45A 1FFOA 2CGZA 4TN9A 1JNHB 1DJHA 3TZVA 2CHWA 5EUOE 3VXTB 3V52L 5T3XE 3I75A 4X80L 1MQKH 4NNXB 4RBPK 3UERA 4PP2B 3MNDA 4IBTA 5FO9B 4PG2A 1UXLA 2ZAGA 2E5EA 3JWNG 2XZAL 3B56A 2X0WA 1OE1A 5I0YA 1UJ3A 4O2EA 2Y3AA 2X2IA 2FQFA 1DVYA 4UU9A 3RUGA 4LDLB 5CKGA 1FL5B 3RIAK 2ZXQA 3WY3A 4XMZA 3FRPG 3BAJA 4KTDL 3AM8C 1BVKA 2FZ3B 5E2WH 5J06A 3OR7A 4H8WL 1T3FA 4KKBC 4ONOA 3KCPA 5LQBH 4ZX6A 4HIHA 1T6WA 5DI8B 3N2JA 1IGTB 3ULSB 5F9OH 4R83A 4YX2H 2IBZX 5E5UB 4AQ8A 2WNWA 3TJEH 1QFOA 3HAEB 4NC2B 4IGBA 4KNQA 3P9LA 3MJ9L 2MTPA 1Z5LB 4JHZA 1JWMB 1Z9PA 3RTQB 4TNVF 4HAFA 5KYWB 3VFGL 3MGOA 4UNTA 4PRAA 3E6FA 4V2CA 2IAMB 2V3DA 2J1XA 5E99H 4X6CF 2D3LA 3CLFH 1JS4A 2V5MA 4LCYA 4RNRA 4X5LA 3WPHA 3H0TB 4RH4A 4Y16C 2HRPH 4I6JB 4ATWA 3QNYA 3N50A 4GSRA 1CI5A 2V33A 1LO5B 2H32H 1MREL 1RIVH 1Y7VA 4PRIB 4XNXL 4YHLH 5BQDA 1D5RA 4JFFE 4JQIA 2WINB 5GMFA 5GGRB 4NERA 4ENZA 2EYRB 4PLJC 4F5CA 3H6AA 1XF4B 3G6JB 3QJRB 3ZOAA 4XSQA 1FVDA 4GKSB 3QWOA 3ILQD 1EO5A 1ZTXE 3FT3B 2A99A 3GSRB 3MRLA 3QRGL 2EXYC 1DLFH 4DAGL 3GTTA 5INDA 3BVUA 3BVWA 3Q8AA 4IHBA 4HK0A 2NY3D 4M5ZH 4H09A 4QGTA 1G7LB 3P77B 1WWBX 3ARFA 2WXLA 4NOFA 4FYSA 4J3OH 5D55A 5DZOA 1TVBA 1XF5B 4UM8B 4WQOA 4GMSH 4Z7AA 1RHFA 4XP6L 3WNJA 3WE6B 3DMMC 4OD1H 2MKWA 4AL8H 1I53A 1RXLA 4JCWA 3QA3A 2DPKA 2P5EE 2ATKB 1CDYA 2Y22A 4D8OA 1EA9C 4NKIH 4CU7A 1RZKL 1NLDL 3VM5A 1SVCP 2N4IA 2JJVA 3QO0B 3L16A 3K8KA 4DGWC 1HJCA 5DURD 4TSCL 1OAQL 1UKTA 2HT2C 1ZA6B 5DMIL 3QEQB 3FB5A 1CFVL 4OBSA 2WV3A 2DL9A 2V2XA 1UUSA 1FGNL 3NESA 1VESA 2CLRA 1T5KA 2NYKA 3H7BB 2HKFL 3CZLA 4WGVB 3EGSB 2QSCL 4APQC 1H5BC 3O3AA 4FQCH 1YNKL 3RU8H 3O45A 3BIKA 3RGZA 3N6YA 1O6SB 1BECA 4Y9GA 4Y9CA 3CGTA 5C0NC 3O0RH 3SBRA 3UPRA 4X8JB 2H2SC 4KKAD 2A73B 3BPNC 1JF1B 3OC8A 1X4XA 3QS2A 5B8CA 3IVKA 5AOMA 4J3VA 4TYUA 3V9EA 3G5YA 1OAXH 3L5WB 3KEDA 1IGYB 3RVUD 3KLAB 1CFBA 3W9EB 3O4LE 2JXMB 3W57A 1CU4L 3BHBB 1JV5B 4HULB 2OYPA 5IB1A 1J87A 2Y6SC 4G43A 1H9DA 3F7KA 1DTUA 4TM9A 3VXOB 3ASOB 5J1AB 3O9WD 3CN3A 2F5AH 1HCVA 3R1GL 3I9AA 4LRIC 3CN1A 1NEZG 2A83A 2G3ZA 1WWWX 4LVOB 1OVZA 4L9LB 4LDEB 3W2DL 4R4FH 2B5IB 4G9DA 3SE6A 4K3DL 1OTSD 2IMMA 4HWNA 2XG5B 2BDNH 4X8CA 1A1MA 5C09D 4LL9A 1JGDB 3WN5A 1XCTB 2NNCA 2WVUA 3MJ8B 3LZNA 4KROD 3D09A 2XI9A 2GEQA 4ZG1A 2NNXA 1WZKA 4PJHB 4KKPA 1DBML 5ALBL 5A6IA 4BXVA 1FFOB 1J5DA 3DX4A 4XHQA 4MAUL 1DQIA 2EUXA 3TZVB 1IGFL 4EXKA 4GSDL 1W72L 3I75B 4F33A 4UQBA 5I8OL 5BRQA 3RB5A 2X89D 3LRKA 1OB1A 2YA2A 2JH2A 4EN3D 2AQPA 1YEJL 1TNNA 1OANA 2XTLA 4R97B 5C07A 2IFFH 4LU5H 3UPCA 1SXZA 2VR4A 5G4MA 1UJ3B 1FFTB 4O2EB 5FYKL 4ZT1A 1T7XA 4UU9B 1RQ5A 3RUGB 3OHMB 5IVOA 3QFJE 1BVKB 2ADJA 1GMIA 3OR7B 3EJSA 4OZHA 4TTDD 1HHJA 1T3FB 3TA4D 3IGKA 3KCPB 5LBSH 1J1PL 4HIHB 5AW8B 4TZHA 3IMRA 1U2YA 3ATDA 3WY4A 4E9WA 1UGNA 4BQCA 4OJEH 4G3YH 1N64L 2UY7B 3UAFA 3NBNA 2WGNB 1YNLH 4YEFA 3EOTL 4DP7X 2A9MH 3P9LB 1E8XA 4GRLD 4N90E 1NICA 3W3BA 2C9AA 1QZNA 3QO1A 3GXIA 4GNKB 4PD4K 4NS0A 2I32A 3CFDA 3MGOB 3OXRA 2W0KA 3ORJA 4PRAB 4DZ8A 3E6FB 4WO4C 4V2CB 5E9NA 1F6AA 3WTXA 4LCYB 4RNRB 4Z3TA 7CGTA 1OCWH 3DSFH 4JFHE 5BV7B 3ARGC 3EXLA 4NUGL 4NQDA 3FCUB 1G9ML 3L7FA 3QNYB 3E2HB 3IDJA 2CK2A 3BKCL 3D39D 3VRLF 2X6BA 2Q6WA 4MXVE 1IC7H 1EANA 3ECWA 2CKBH 4HKZA 5JW3L 1OP3K 1PAZA 2IGFH 3OKDA 3AG1B 4QRFA 5E4EC 1X5LA 3QH3A 2ZUQB 4XPTL 3IETA 4I0PD 3L13A 1PJ9A 4I85A 3OWRA 4NSKA 2H32A 3FCTA 1FVDB 3VXSD 1AZRA 4X9YA 3PGCA 3ARYA 3QWOB 5FXCH 2FEJA 3FO1A 3ARDC 3K5RA 3MRLB 3P4NA 4TSBH 43C9A 5DQDL 4OLVH 1G43A 3LQAH 5INDB 4EQ3A 1X4YA 4HK0B 1IL1A 4WJ5A 1QI4A 4AKPA 1OPOA 4GQRA 4FFZH 3S0PA 2ZT9C 1A7NL 4GW4A 5ESAA 5IOKA 5KYYA 1TVBB 2EO7A 3UAJD 5FUOL 4YSCA 1F1GA 4MKMA 4AIZA 2AAVA 1UH4A 3QIUD 5ACZA 4RMSA 3QA3B 4TLUA 5D7IA 3T6XA 1TNMA 2VZOA 4JQIL 4DK6A 2AQ2A 2R7EA 3NH7L 5GRJH 3K81A 2CHXA 1QFWH 4P46D 1SEQL 5CGYD 5HZLB 3PP3H 1B6UA 2MJWA 4P3DA 3NCJL 3TPKA 3FB5B 3E38A 3I74A 3ZZSA 2V2XB 1K2DA 2CLRB 1U3HA 2Q76A 4N2OA 1E4XI 1ZHKA 4J6IA 1G84A 3RQ3A 5A2FA 1PLBA 2PABA 3BJ91 4R2GD 3O3AB 4XPAH 2VDKL 1BEYL 1N0XL 2MRYA 2VZ3A 3O45B 3BIKB 2JI2A 3SQOH 3HC4H 3GXUB 2HT3D 4DEPB 3UPRB 4MXWL 1DJZA 4FG4A 3HG1A 5D8JH 5D7SH 4MA1B 2F1AA 5B8CB 3IVKB 2DYPD 3CDYA 4KXZH 3G5YB 4KY1H 4M7JL 1EHAA 2BNUA 3O4LD 5A16A 1T1WA 2VGLM 5IB4A 2XQBH 3K6FA 5IB1B 4G43B 5D7LA 4LSCA 1KXVC 2LAGB 4J3WA 1S9YA 2P47B 4MWFA 2KERA 1OGPA 2VZ1A 5DHYA 2QADD 3BT2H 2A83B 1NFDE 4FG0A 4JPKL 4JRXA 4NENA 1PZ2A 4QXUL 1L9NA 3QR2A 1HL9A 4G9DB 3A67H 2VDPL 4IHOA 3SYOA 2HRHA 1S6NA 1ACYL 3MC0A 3WN5B 1A1MB 4BIKA 3VMNA 4L48A 4PU2A 1L7IL 3QJHA 4Z5RA 3GK8H 3PWLA 2FWUA 5E4OA 5B1BB 3W11D 4F8LA 2D7PA 4N5ED 2FYYA 2X1PA 3HR5A 2BX5A 1P9MA 2HTLC 1DUYA 1T6BX 2NR6C 3DX2A 3AROA 1HEHC 4WFHE 4JPIA 2XCMC 3F6JA 3QJTB 1PF3A 1C16A 4AX3A 1IZKA 4M93B 4UTBL 3LHAA 5EN3A 4KHTH 1RJYA 1XWDC 1BJ1H 2ENSA 2OL3A 4F33B 1BF5A 4HPOH 3MBXH 5AOKA 1M9WA 2DTSA 4X9HA 2Y06L 3KYNA 5C07B 4RMBA 4JNXA 3TVMD 3DUSA 4J1UA 3LD8B 4AZUA 3TURA 2H3XC 4Y9BA 1CFNA 3CN2A 1FYHB 5KVFE 3QFJD 3D4CA 1EJ6A 5IJVA 1FIEA 4GO9A 3TH3T 2ADJB 3LH2L 4OZHB 2R0WL 1HHJB 3UTZA 4WHDA 2ZCKH 1OCZB 4L1SA 3RWIA 1ZVYA 4KH2A 4LOFA 1MSPA 1SY6H 1BQLL 4KMQA 4YEBB 1PW3A 1MCNA 2ZSWA 3NQIA 5D70H 1QRNE 2LAAA 4N90D 4JB9L 1BA9A 1QWUA 2FRGP 3WNMA 3B6SA 4FZEH 4YXLL 4H1LH 1NOFA 3QO1B 5LBSA 2VDML 4LEOA 4A1RA 5C0DA 4U6YA 1LO4H 1F58L 1G9HA 3CFDB 5KJ4A 4C83A 3OXRB 4PG9A 3N06B 1YEGL 4DZ8B 5D7EA 1F6AB 2A2QT 2C4XA 3FQXA 4JFHD 1AG6A 5AW5B 3O6NA 4TOYL 3BAXA 1DVQA 3MR9A 3RJDA 4NQDB 5F3FA 1GGBH 2AQTA 3L7FB 2UYLA 2VXUL 4NQEA 3IDJB 2AEPL 3HC0A 5HHME 2Q6WB 2WC7A 4XMPL 4HKZB 1CGUA 4TS6A 3OKDB 1HVXA 1I3UA 1U4FA 4ORZC 3RLSA 4S10A 1IC1A 3QH3B 3IETB 1SN5A 1WITA 3WMPA 5CF3A 1I1AD 1IQWH 2P46B 2VIRA 4NSKB 2H32B 3FCTB 4XTRD 3PGCB 5GRUH 2CKBA 3REWA 3FO1B 3HN3A 3MCLH 4F91B 3P4NB 3MYJA 5D2NE 5KBPA 3M18A 4HSQA 1KDJA 43C9B 4ENED 3KEHA 4IBUA 4NHCL 1RSFA 3SODB 5HVHB 2MNWA 1XF2A 1IL1B 4WJ5B 4J6RL 1ZDSA 4GW4B 3QZPA 3V4PA 3QZLA 5KYYB 3ZMRA 3G39A 3D7PA 1IGCL 3KAAA 3DRQB 4AIZB 1DN2A 5I75B 3HG0A 3ARQA 2P45B 4UZUA 2XWRA 3D05A 5ACZB 4CBZA 5JYMA 5D7IB 5T1JA 4P5RA 4PPTA 2GABA 3MV9D 1OF2A 2IQ9H 3L4YA 4ZS7L 4I77L 1CICD 3AWGA 1EERB 2BCKA 3SDDA 2NZ9C 4WUKH 4N2HA 1F1AA 2YD3A 1I9JH 3QE5A 4P3DB 5JHDE 5LXVA 5ECGA 2UXTA 4WI2A 3RAJH 5FPIA 1K2DB 3NSYA 4HFUL 3U9PH 3HOGA 1SHSA 5FO7A 3II3A 3HFFA 2R2EA 1U3HB 2Q76B 1ZHKB 3CH1A 1BZQK 3OQ3B 3PUUA 4ODVH 3OR6A 5K1NA 1O7DC 5IHUH 1XCDA 1NLBH 2E86A 1WC7A 3IMWA 5J56B 2FATL 3DIDA 3SE9H 4UQEA 5I1EH 1YUHA 2QPDB 3WSQL 2LGNA 1UA6H 4PRHA 2Q8BL 2V5TA 5I8KL 3HG1B 4NO5A 2DS4A 4G7QB 2XC8A 4P57A 5SWSA 1G1YA 1OEZW 4NAJA 4FKEA 4JJOA 1KG0B 2AMGA 3V0JA 2QPEB 1I75A 2BNUB 3C9NA 3EKCA 5A16B 1T1WB 3D9AL 5FYKU 1Y6MR 4GUPA 3CQQA 4PFEA 3WLBA 4KMTH 5IB4B 2VM4A 3KL3A 4C56D 1EGJL 2Y1VA 3WFEH 2B15A 2AP2A 5JW4N 3GMLA 2D4DA 1S9YB 4KK9C 4MWFB 2UUDH 2UX7A 5DHYB 5KVGL 4NN5B 1B3IA 4PJ5A 3S3SA 3LH8A 4JRXB 1UT2A 2OCJA 3GJFK 4NENB 4IKJA 1M71A 4M3JA 3ULVA 5ETUA 4OZIE 4IHOB 5DK3A 4HJ0C 1S7XA 3MRBA 3OAWA 3LSOA 4K8RH 4K9EC 4X99A 1TJIH 2WO3B 5CILL 4FKKA 3JTBA 4WI5A 2VLJD 1MHCA 3QJHB 3FYEB 3ZKND 1CD0A 3L95A 3PWLB 3RVXC 4AEFA 4MBOA 2EVHA 3WFDH 3SBWC 4Y8AA 1RFDH 2FYYB 3PRZA 3WNOA 1DUYB 1G6RH 2VR6A 2F9BT 3T3MB 2X10A 1IFRA 1EEZA 4JPIB 2FVNA 1NCDH 3SCMD 3FBKA 2B14A 1C16B 1J12A 1RJYB 2O5NA 3NCCB 2P43B 1JPSL 3DOIA 2OL3B 4TUUA 4JDTL 1KWGA 1FCCA 1DO6A 2Q86A 2P26A 2R56H 4J12A 4NO2A 3LIUA 3KYNB 1YQVL 2HN7A 3VDCA 3BSGA 3DUSB 4J1UB 1CT8A 4UQCA 5CIPH 2ITFA 3RWCA 3V0VA 4HPHA 5CBEA 3HUJF 4MJIE 4XE0A 2PR9A 1CFNB 1QRKA 1F42A 1TETH 5C71A 4XNQB 2GSMB 5EZIL 5IJVB 3MKKA 5FYJE 1I8LA 4PLJD 1H3VA 3UTZB 3RWIB 4YLBA 1EAQA 4RWYH 4MMXC 1QRND 1KCUH 2EDLA 2IDFA 4HMCA 2ZSWB 2OL3L 4G7SB 2KI6A 3THML 5K59E 3GLEA 1D7FA 4AOFA 4PB0H 3C60D 2ENQA 1MFUA 1HNYA 3B6SB 5DD6A 5F44A 4EPSA 3NIGF 1IIIA 4HUMB 2X9YA 4LEOB 4X7CC 5C0DB 4U6YB 2R15A 4C83B 4KITB 4PG9B 1BHGA 1SY6A 4MMZC 3FQXB 5JQ6L 2P3YA 3DMMD 1QNZL 1JL8A 2B1AH 5ESVA 2WOBA 4LVNC 3V4UH 3N0AA 3W3KA 1CBVL 5AYUH 2DAVA 3MR9B 4UT6A 2UYLB 4NQEB 4UOW1 1D6EA 5HHMD 4H1LA 3HC0B 4PBXA 4DP5X 2JKNA 4JCLA 1A4BA 1PQZA 4RDBA 4OLZL 1DBBL 3TN0C 4IJ3C 5E8EA 2O26U 3TPUA 2AANA 1UQSA 4URTB 2VIRB 3ECQA 2ZZUT 3SBQA 2D2OA 3AGVA 4DJMA 3L9RA 4Q6YA 1E6OL 5LBSL 3N41F 1ET7A 3NACH 5BUGA 2CKBB 2JTDA 3REWB 3RVTD 1MCDA 3MYJB 1HAUA 2XQYG 1NCBH 4QRRE 3WKMH 4RGNE 1XF2B 1N19A 4GQ9L 1KGCE 2A6IA 2PO6A 3CSYA 3U83A 3FB7A 3V4PB 4Z23A 3BFOA 2WUCH 1Z5HA 5HYJA 4BE5A 2F6AA 3F83A 5F7EH 2CGRH 4ONFL 4KH9A 2WLYA 1KEML 3RY6A 1MCIA 3OAUH 3WJJA 3MLTA 3SGJA 3EHBB 1OF2B 4IMKA 2Y6SD 3GMPA 4DW2L 2Z31A 1ZSDA 3APFA 3NPZB 4KDWA 5DVNA 1Z5YD 2BCKB 1C5CH 1CE6A 2EABA 4N3UA 4WW2C 3SDDB 4ZMOA 4RESB 3W3JA 1AYOA 1S5IL 5JHDD 3WV0A 3FU0A 1OAUL 2W0FA 4F3FA 4D3CL 4I3SL 4YQXL 2EC9U 1RZPA 3K91A 1IBGH 4PWHA 2VNCA 5A43C 2J1KA 3EG9A 2BWDA 4NQCA 4KXDA 5FO7B 4N86A 2W60A 3L9YA 3L4UA 3CH1B 4KVNH 3V4PL 3OR6B 1A0QH 1U41A 4NZTM 4P4KA 1CFQA 1WC7B 5GZOC 2XSKA 1II4E 1H3PH 4FFTA 2R1XA 3MTXA 1TIUA 1YUHB 1E2VA 4N1HB 4PRHB 3T71A 1PKQA 3JZ7A 4NO5B 4OM0H 3QEUA 4P57B 5SWSB 5TK4A 2HKHH 2R2HB 2KH2B 3GQFA 5CJQL 1I85C 4X8XA 2ZUUA 2LU5A 2QHRL 1JNJA 3C9NB 5C7XH 4M8QA 3WPBA 4GUPB 2FX7H 3WLBB 1YEFL 5CD3A 2VDRB 4IKIA 4MQXC 3UJTL 1S7UA 1TJHH 3FOMA 5DFAA 4YDVA 1F56A 3VWKC 3GMLB 3IAPA 2P8MA 2A9NL 4BK8A 4PJ5B 2F8XC 2GIXA 3TA3A 1XGTA 2DLFL 4X4KA 4QO1A 4QAWA 5DJ6A 1M71B 2L04A 2OR8A 3BYTA 4G2AA 4UT7H 5ETUB 3ET9F 3QQXA 4PB9H 4D9RE 2DDQH 5IMKA 1S7XB 3MRBB 3LSOB 4H8WC 4X99B 4G83A 4Z7WA 3QXWA 3R0MA 4HLJA 2O6PA 3DX8A 1MHCB 3FCSA 3L95B 3SDXE 3L4WA 3HNVL 4PMEA 4XP9H 3K6OA 4MJ5A 4NKDA 4HF5L 4OLWL 2MCPH 1K5DC 5D2LF 4AJ0A 2VDRL 1S9VA 1EEZB 1SRDA 1CLOH 4B7IA 2EEFA 1INEH 2B1OA 3CVHH 5JHLH 5ISZA 4LSRH 1IBFA 3LPOA 2AEQL 3N85L 4WO4D 3KWXA 1IAIM 4PVMA 2NQDA 5M94B 3ZYIA 2Q86B 1G6RA 3ARGD 5E23A 4NO2B 1OCOB 3ULVL 2HN7B 3DJ9A 3W56A 3RWCB 3U6RA 3V0VB 2VABA 5JIDA 2OS7A 2O5YL 5CBEB 5DDHA 2NY6B 3S5LB 1ZGLA 4MN8B 1AFVL 1ECZA 1HYRC 4U7SA 1L0QA 4FQIL 3IDNA 5FYJD 4R7DA 4IOSD 2H5UA 2BO0A 4WCYL 5HDBB 5ITBH 3IDXL 3LEVH 1F4XL 5CIPA 1UC6A 4RGOH 4UDUA 5T3ZL 1YN6A 2ZKMX 3CZJA 4YSOA 4WFED 1P7QA 1PGVA 2I9LA 3RTQC 35C8L 5FUZL 2Q3XA 1F4WH 2IAMC 5TE7L 5F7AA 1IBBA 5DD6B 5EOCJ 3IJEA 2H1PH 4I9WE 3CHOA 3G3LA 5FYLE 1SHWA 2ICCA 1NIFA 4YDMA 4X83A 3CZFA 1PLAA 4ZMNA 1TMQA 4RA3A 4DQOH 4YFEA 2VLME 5ESVB 5DWUH 4NWUH 5IB5A 3MLPA 4JPWL 5AOIA 2I85A 4R6JA 3B9EA 1D6EB 5GGVL 4H1LB 4PJAF 3PAVA 4GMTL 2BERA 3IJ8A 1PQZB 4HUWA 4BGLA 4FQJH 4Z61C 3ZSTA 4LQFH 5E8EB 4KK8C 3N5AA 3TPUB 1PCSA 1ORQA 1UQSB 2VQTA 4U3SA 1NCWH 1MOEA 5GJTH 1AY1H 1HIML 4KK6D 3VFTA 3PP4L 3RWHA 4EZMA 3M17A 3OPZL 3UO8B 3L9RB 2BOLA 1Q1JH 2DWDA 3IPFA 2HFGH 2Y1ZA 4UM9A 5DZAA 3X1FA 4NQXA 4ZTEA 1SLWA 2LHAA 3ZVVA 4LSPH 2EUVA 5C0GA