4FD0A

Crystal structure of a putative cell surface protein (baccac_03700) from bacteroides caccae atcc 43185 at 2.07 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
391
structure length
391
Chain Sequence
b'SAENPAEPVGALLEDFSIEQLPAKTIYALGENIDLTGLNVTGKYDDGKQRPVKVTPEQISGFSSSAPVDKQEVTITIEGKQKSFSVQISPVRVENGVLTEVLKGHNEIILPNSVKSIPKAAFRGSQINKVVLNEGLQSIGDMAFFNSTVQEVVFPTTLEQLEENIFYYCRNLKKADLSRTKLTKLPASTFVYAGVEEVLLPATLKEIGAQAFLKTSQLKTIEIPENVRTIGLEAFRESGITTVKLPNGVTTIAQRAFYYCPELTEVTTYGTVINENPEAMIHPYCLEGCPKLTRFDISKSIRILGQGLLGGNRKVTQLTIPANVTQINFSAFNNTGIKEVMVEGITPPQVFEKVWYGFPDDITVIRVPAESVEKYKNANGWKDFTNKITAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine rich hypothetical protein
publication title Crystal structure of a leucine rich hypothetical protein (BACCAC_03700) from Bacteroides caccae ATCC 43185 at 2.07 A resolution (CASP Target)
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 113
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07523 Big_3 Bacterial Ig-like domain (group 3)
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3630 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fd0A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fd0A02
1A9NA 4NKHA 5B0NA 3M19A 3C6PB 3RJ0A 2OMYA 4BSSA 4AY9X 2Z66A 3C6OB 5AZ5A 2Z63A 1H6TA 4Z94G 3ZYOA 5HDHA 4M7EC 5CMPA 1OGQA 2OMTA 1OTMA 2WQXA 1WWLA 1FT8A 4LSCA 4GT6A 1D0BA 1O6VA 2P1PB 3WPBA 4C2AB 2OMZA 4FD0A 3WPGA 3RFSA 5IYXC 4Z61C 2ASSB 3C6NB 3UL7A 2O6RA 2V70A 5GS2B 2V9TB 2OMWA 3ZYJA 3WPFA 5FTTB 3RFEA 1XEUA 2IFGA 2P1QB 3REZA 2BEXA 1U0ND 4U08A 4P91A 5B4PA 1ZIWA 2OMXA 1P9AG 3DZEA 4R5DA 3W3LA 2CA6A 4R6FA 3UN9A 2UZXA 4V2EA 1G9UA 2WFHA 4ECOA 4M7EA 1KOHA 2Q4GW 5HZLB 4H09A 3ULVA 1OOKG 5GS0A 2Y5QA 1XCDA 3WPEA 4ARNA 4XGOA 4PSJA 4IM6A 4J4LA 3G06A 4U09A 2JE0A 1JL5A 4Q62A 3CVRA 5GMGA 4RCAB 4LSXA 4R09A 2O6QA 4HQ1A 3G3AA 5IJBA 1FQVA 5GQRK 4FDWA 5GMFA 1XWDC 1XKUA 4ECNA 3WN4A 2BNHA 4PEQB 3RIZA 3W3JA 4WYKA 1PGVA 4K17A 3O6NA 4Q3IA 3OJAA 4Q3GA 3ZYNA 4R08A 4I6JB 4L3AA 3P72A 4LXRA 4BSRA 2Z7XA 2Z81A 4QBZA 4LSXC 4ARRA 4J0MA 3OJAB 4CNMA 4L3FA 1K5GC 5AWCA 3W3MA 1DCEA 4R58A 4CC4C 4NKGA 2Z64A 3ZYIA 4Z8GA 5AWDA 2Z7XB 1SQ0B 4FCGA 3TSRE 1W8AA 4Z79A 3VQ2A 3M18A 2FT3A 3OGKB 3UL9A 1YRGA 1DFJI 3RW7A 4MQWX 3OGMB 5GMHA 3GOZA 4Z64C 1KOOA 3ULAA 3W3KA 4R0AA 3FXIA 4XSQA 5LFNA 3PMHG 4AW4A 4R6AA 1DS9A 1FS2A 4CNCA 1O6SA 1OTNA 1OZNA 4PQ8A 4WP6A 2ELLA 4G8AA 4LI2A 1FO1A 3JB9j 2XOTA 4C2BB 4P8SA 2WQUA 3E4GA 4FS7A 3WPCA 1A4YA 4U7LA 3SB4A 3A79B 1P8TA 2P1NB 4GLPA 3G3BA 1LTXA 4U06A 3G04C 4LI1A 1M9SA 4R6JA 2RR6A 1QYYA 4CC4A 3W3NA 3E6JA 1M10B 1GWBA 2JQDA 2XWTC 1M0ZA 3WPDA 4QC0A 1H6UA 5D3IA 4KT1A 2A0ZA 3VQ1A 2Z82A 4CILA 2P1MB 4RWTC 3UL8A 4MN8B 3RGZA 5IJCA 4V2DA 4OQTA 2ID5A 3O53A 4R6GA 4UFRA 2Z65A 3CIGA 5AWAA 1IO0A 2JE1A 4PERA 4CP6A 3OGLB 4B8CD 5AWBA 5CMNA 4BSUA 3RW6A 2V9SA 5B0TA 4R07A 2R9UA 4EZGA 1XECA 3CIYA 2UZYA 3W3GA 3BZ5A 4KXFB 4LSAA 1Z7XW 5IJDA 4KNGA 4LXSA 4XOSA 3WPIA 4V2CA 3WPHA 4QXEA 4Y61B 4BV4R 1K5DC 4R5CA 3G39A 2WQWA 2OMUA 3E3ZA 1OTOA 4PKIG 4YEBB 2O6SA 1O6TA 2P1OB 2OMVA 2WQVA 3KJ4A 4FMZA 2Z62A 4TZHA 3ULUA 3RGXA 1M9LA 4FHOA 2ASTB 1P8VA 5A5CA 3E2JA 2RA8A 4RCWA 3RFJA
chains in the Genus database with same CATH superfamily
1T5WA 1TMQA 4P2OB 3UBFA 3LQZA 4E9VA 5B8CB 3ZLQC 1KIPB 3F12B 5C0FB 3TN0B 2X4NA 5FYKH 1ZXKA 3KW8A 1H3GA 4JDVB 2HYMA 4HIXL 4F3FB 4GQZA 3F01A 3S88L 4UOJA 3FTGB 3VXUE 2XWRA 2ITDB 3GMPB 4X9HA 2R0WH 1ACXA 1OT4A 2Z31D 3P4OA 4QF1A 1K4CB 4KMLB 5ADOL 2Z63A 5IFHH 2WAHA 4EOWL 5FW8A 1XSJA 1DVQA 5GJTH 1N5AB 3O3BA 4IRJA 1NGPH 2HT2C 4MJ5B 4I18A 4HCFA 1FVEB 3IJSB 4B3EA 4HISA 3LXUX 5HHXL 3U82B 5IP4A 2FGZA 4AYFA 1MCLA 2APXA 1O7DE 5HYJD 1XGUB 1D0BA 4GT6A 1NFDA 1MLCA 43C9B 3NIFE 4U6TA 2P1PB 4NQEB 4PGDA 4PWGA 4OR1A 3WHE1 3ZYZA 2DBLH 4HXBH 3RWDB 3M1CA 3FN0L 1FNFA 5J1AA 3CX2A 4WJ5A 3RFSA 5IYXC 3QULB 4OZGA 4XHQA 2PTUA 5D4JA 1AHKA 3IDGA 1YJDC 3SKMB 4BJLA 2FAUA 3H42H 1J1PL 5KZCD 1QFUL 3E2HC 4XOCA 5F6HI 5H4ZA 2V9TB 3RG1C 3SPVA 1WH0A 3UBHA 4BZ2A 2NT0A 4DQAA 3PXJA 4XXCA 1T03L 4PLNC 4B41A 5LQBH 4P9HL 1SY6H 3BP7A 1ZLWH 3NAAL 4KRNA 4LP4A 5KANI 2YR3A 3I9IA 3O6FA 3LMJL 3BUYA 4ORZC 1NL0L 3APCA 2VXVL 3BH8A 3U4BL 1YQVL 5I76A 3FN9A 3DOSA 5FLVA 1U6AH 1IC5H 1UFGA 5FUCC 2VYRE 4BE5A 2G5BA 1GZPA 1MCPH 4JPVH 3A6BL 3BAIA 3TWCL 3IDNB 4NRYA 1M71B 4XRCA 4JN2B 5C9JB 4X6CB 2EXSA 3LKPB 3O9WA 5DDHA 5C0BE 3VFTA 2OTUA 3ZHFA 4GP8B 4UTAA 1NCBH 3PIQB 4F2FA 1WRFA 2JKJA 2LOEA 2VAAB 3IAGC 4EF3A 4R6FA 4BQCA 4R3SB 1XF2B 3WOVA 1FBIH 2FO8A 5C2BH 3NJIA 3JZYA 2LVCA 1SXAA 4MXQD 1GGIL 1UA7A 1BFOA 4J2QA 1R75A 1MVUB 3X3FH 4F92B 1ZHBA 2AJXL 1CO1A 3HKZA 4EJ1C 4JY4A 1JMZA 1XB3A 2JB6B 3ULVA 5KEZA 5EA0L 3QIWA 1SRDA 1YDPA 2Y9RT 2FL5A 3H2WA 2CLZB 1ZWIB 4FNRA 4KAQH 4XN8A 1KELH 2V8LA 3BWAB 3W81A 1HWGB 1BVZA 1P84J 2F1AA 5C0NC 2X4OB 5LNDA 1QRNB 4FFVC 5IGXL 5CWSB 5BOZG 4UANA 4W9JC 1TITA 1ZTXE 5C0GA 1BSIA 2NXZB 2WCPA 5CJ8A 3OGOE 4DP1X 5E9DB 3TIDA 5DZOA 2OX5B 5E1AA 2G4EA 5DUBA 3NZSA 4IRSD 3UFIA 5FOBB 1P0SE 2GT9B 2Z8WC 2W8CA 3FH5A 3CVHB 4LLQB 5GMGA 3QQDA 5GSVA 5DJYA 2NY6D 4AENB 3P2BA 1QSVA 1CE1L 2VABB 3L95B 4U3HA 1J0JA 2Y36H 3K6SB 3LZOA 1A14H 3GBMH 3BAYA 3ALXA 3B43A 2PUQT 4MDIA 4Y1AE 3MRHB 3BH4A 4AG4L 3UZQB 2R7EA 5J12C 3UG4A 2YUVA 5FYLD 5EWIH 3P9LA 2JQMA 4PJ5E 4R84A 4TTGA 3D3VD 4PLKD 4XMWA 1NIAA 4ZJ9A 5GS0C 1JBJA 3BLPX 3IFOB 5I1CL 4OH2A 2EC9U 4TQHA 4ZMXA 2DJMA 5D7KD 5IKCB 3APNA 3WMSA 3FONA 4PJHA 4MB5A 1H3WM 3IFNH 4Q3GA 2WLNA 4JFEB 5DT1L 4KROD 4R83A 1DVFD 1RZKC 3QDJD 4N20A 1FVDB 1KPVA 1MFBL 5E8EA 3X13B 4PJGE 4NQUA 1OAQH 4Y16A 4F33B 4L3AA 4NO3A 2W60A 3EYQC 4NXKA 5I1IH 2HJFB 1OW0A 1S46A 4RZKA 2Z81A 2Q5BA 4BGDA 5B1AB 4HWNA 3IF1B 4OV5A 2P47B 1AE6L 3FSVA 3I6GA 3BUBA 5FEBA 1XH2A 2XZQL 3KPSA 1CZ8L 5JO5A 1F4XL 1YCSA 3VSVA 2ARJA 2CHZA 5BZZA 2EE6A 4QAWA 3OR7B 3PY9A 1K5GC 3BQUC 1UOKA 1GS6X 5DJ6B 3MYJB 1ES0A 3DX9B 1GRWA 1R5VA 3HAEH 1DANU 2WHVA 5E99L 4AQEA 3GSWB 3OWRA 1G7JA 3PGDA 2DW5A 5B4MD 1HXKA 1OB1A 4ZAKD 3NCYP 5HJ3B 4NQDB 4Z8GA 4HIJA 2JVUA 3IRZA 3KLSA 2BWQA 2FZ3A 1A4KA 3EOTH 4MMZA 2EE9A 2DWXA 4G80A 4NQVA 3TNMB 5L2KB 2OKMA 3ARUA 3U1SL 2HVJB 1ZT4B 3AQZA 4HWZB 1G7PB 2QFPA 4DKTA 3OGKB 3DYOA 1JZGA 4E42B 3HNSH 1WUZA 3NQIA 4P05A 5IMLB 3RW7A 4L1HA 5ISZD 3IAQA 4KO9A 3HC0A 5D96C 3E3QC 3QQ3A 3DKHA 3U7WL 4OUUA 4EEEA 1N5YH 1ERNA 4PJAE 4WY7H 5KSAC 2XN1A 1KYOJ 4J3OD 3QUGA 1LMIA 5I5MA 1WBYB 2ZSWB 1I8KA 3VI3A 1QKZH 5GGUB 1ZK9A 3O2WL 5HHQB 1ADWA 5E2WL 3P30L 3HVNA 1MFMA 3AUVA 3FOMB 4IS6B 2BC4A 4LARL 2WZAA 4PD4J 1QEWB 3BQVA 2WLZA 4OGXH 4JVPA 3MLTA 1OF2A 2KZBA 4JHWH 2YKKA 5HHPB 1H0DA 1OTNA 3MLPA 1ZS2A 4BFFA 1T1ZA 5AAMA 1THCA 4U1IB 2VL5A 5EEWA 5EU7E 3ZTDC 3A3YB 4Y4KD 4ZTPL 4MDRA 5IB3B 4ZS7L 5D7EA 5A16B 3T3MF 5GZOD 5ANME 4LI2A 4UT9L 2XPGB 1I1AC 5F21B 5BRQA 1VRSA 5I16B 2HWZL 2UWEA 3QCUH 2YFOA 2KHAA 1EAJA 4HQQH 2JCCA 5EFIA 1F4YH 5BS0D 4G7VL 1KCRH 4K23L 2WO2B 2ZKXA 1YMMD 2BJML 1O6SB 2K8QA 2Q7YA 4X7TA 1CLCA 2HUEA 3NCCB 1OAXL 5I6LA 3ZPDA 4RAVA 1RZFL 2P5EE 2R29H 4NQSB 1QO3A 2DM4A 4G6AD 1LTXA 2B77A 4JFZL 4NQXB 4R7NB 1J5OH 4DESA 2FSDA 4LI1A 5KVFE 3ILPB 4UMSA 2X70A 3BW9A 1ZJBA 1UKTA 5DHMC 5CZXD 1E8WA 4GAAA 5HYEA 2W9EL 4IDJH 3V4PB 5FGBC 1JDAA 3QAQA 5D8JL 2GW5A 4P3DA 4FFYA 2DQEH 2QKIB 2DWDA 4DGYL 4YBQC 3C5ZC 4UNUA 4GIPD 1HHJA 1LO3L 4LCUB 4J3VA 5HHME 1U95B 4PJ9D 2YSTA 1N64L 1BQLL 2A9MH 2X5PA 2N3JA 4AWJC 1TZGH 3L2NA 3EHBC 4PJBA 1OE2A 5DJ0B 4ANKA 2V2XA 1Q0YL 3WSQL 3MA9H 3WN5A 2L8AA 4LSTL 5TE7H 3RY4A 5GJSL 2O5ZL 4HUWB 2NXYB 4M6NL 4MNQD 3GUTB 4GAYB 5DSCB 3MREA 3OAUL 4OCMC 4LNRB 2KH2B 3IJHA 4N0UE 1U0QA 4RGMC 5I19L 5C0IB 4A39A 1WAEA 1PLGL 5J4MA 4V2DA 2HRGA 4KNSA 3C6EA 4XTRC 4Y4FC 4XVUC 5DGQA 3UJIH 3O53A 3C75A 5I71B 5FGSA 2O6DA 5A2AA 5DZJA 5D96B 2J3SA 4YBLB 3A47A 2SEBB 5AVZB 3RWHB 5TDNA 5AWAA 4LGSB 3OGLB 5HI4D 5EN2A 3WUWG 4LXFA 3C60A 3HC2A 4JFVA 1CDHA 1F11B 2B1HH 4P5SA 3FYEB 4YBHA 2C1PB 5F1OB 5F9WC 3RLSA 1DN0B 1FAKT 3AWGA 4UM9B 5DWUH 3KS0H 2DQUH 3O4LB 2ZSVB 3L4YA 3PHQB 3HG4A 1JV2A 1HYSD 4FQQB 4UQBA 5T1KA 5I8OH 4ICXA 4LCIH 5IROA 3GTTA 2CO3A 2GJPA 3DIFA 5C09D 1NC2D 4WVRA 3DX0A 4HJJL 2WCSA 4NUQA 4LPYA 4ZZKA 3JWOL 3ARYA 3MV01 5TFSH 1LNUB 3EFOA 4JJ5A 4XP9L 1CDIA 2Z31C 1KGJA 2D7NA 3UO8B 4XP5H 4MZRA 4LHJB 2BNQD 5E6UB 7FABH 3ZT6A 5DEFA 2Y5TA 1CG9A 4RAUB 1RUPL 4XWGL 4NZTM 1OK0A 1KFAH 2BNUB 3GJEB 4M7ZC 1T7YA 4F8OA 2LQRA 4NPKA 2DV6A 3NTCH 2IADB 4AMWA 3VFUB 2BSRB 1RJLA 3MPCA 3B34A 1F4AA 3K2KA 1DSWA 5CGTA 3TFBA 1EZSA 1Y6NR 4Y9FA 3VXPB 1I75A 1JGEB 1KT2A 3O3EB 4I77L 1JGUH 1NC4D 4PJ6A 3V52L 3LD8C 5J13B 2F9BT 1RJYB 2EILB 2WVTA 1J7VR 1K8IB 2P5PA 4WK2B 1U3NA 4TOYH 5IOKA 3WIHL 4E68A 1Q1JL 3ELQA 4KDVA 4MA3A 2NT1A 3L5JA 3O3AA 5EPMA 1DQKA 4GUCA 4Z7OE 5T3XL 3BDXA 3O0LA 4YFLF 5DZLA 3P9MA 5J6HB 1RULL 2ZYHA 2QSTA 1MH5A 2GBAA 2Y7NA 1T80A 3EHBB 4FYSA 4HWBH 5JOEA 3FFCD 1U4EA 4EUPB 4D9QD 2TSBA 1TG8A 1ZIBA 2K3HA 4YHNB 2AW2A 2X88A 5D7LB 1RZ7L 5FB8A 4M6OH 1HAWA 5LKNA 2FO1A 1G7HB 3V0VA 1FLRH 3IMUA 4NC1E 3OZ9L 5EUKA 1G6RB 4OFYD 2A83B 1IZKA 2QSCL 3C5SB 4P2QE 3IDJB 4IKLA 2FLMA 4H2AA 4Y4FB 4MCYA 4ILDA 2F54A 1T6BX 4Z94G 1YC8A 3GXPA 4O2FB 1KIQB 4QNPE 3HC4H 1NAMB 1JJUA 2QMKA 4WWOA 1QI4A 4TV3A 2YUWA 5BQ7B 3V0AC 3E80A 2VLMD 2E5EA 2AABL 4RMUA 4BZ1H 2R2EA 1NBVL 1I1YB 4MA8L 1W0WA 2QPUA 1MWAL 2BS71 3G5VB 3NABH 5F9WB 4MXQC 3FCSB 5FO8B 1BQUA 2VXTH 1UM4H 1ZVHA 3KCPA 3TA3B 5C8JA 4NSKA 4R7XA 2EIBA 4DN4H 4GMTH 1U30A 3N1FC 5SX5H 5CCKH 2WWKT 4FQ2L 4W9DC 4G7SB 4DTGL 5JA8B 1NAKL 4CC0A 3PE9A 4TPRH 3MLZL 1AGFB 1FH5L 1SVZA 5AVSB 1R47A 2OMTB 3WFZA 4GKSB 2I07B 3H9SE 1M7DA 3QPXH 1S2EA 5EZIH 5IQOA 2IBGA 2BS8A 2K4WA 3FQWA 2VDLL 2FBJL 3F5WB 2MCMA 4UV4H 2VQTA 4EI6B 4HU8A 4MB1A 1G43A 1MVYA 2ICEA 2Z31B 1EVTC 1A47A 4PRBB 3S4SB 3QJRB 5JOPD 3P11H 2NTFA 5K9KB 2AV7B 4MAYA 4QXWA 1BLIA 2X3BA 3THML 5LO7A 4I0PA 4K5PA 4Y2DA 4ZW8A 2R2BB 4IRSC 4JG1L 4XN9A 4WWKA 4M7ZB 1I8UA 3SE8H 3T0EE 4E0RB 3MLUH 1TYRA 5HYJB 4QLWA 4KZDH 4Z23A 3AUWB 2NY6C 1KXQA 3T0AA 1OGTA 4XMKH 3ABKB 5J8OA 4KJPD 1ZHNA 2GCYB 1ZIWA 1NJ9A 1E6OL 3ZE2F 1MHPL 5EU6D 4OCYL 1P7QD 3FFDA 1EXGA 4QCIA 2CBOA 4TNFA 1KPUA 4JB9L 1PY4A 1T21B 5DJ8B 3ZE2E 2CNYA 1Z6JT 1OLZA 3M1BB 4PLKC 5KZCB 2BIIA 1MUJB 1GOGA 1MFEL 3MC0A 2HH0L 3JWNE 3C5JB 1LJMA 1CS6A 3PL6B 4HUUA 4M5TA 15C8H 4NRXA 4PI0A 5FDWB 5GRUH 4JCMA 4ZMQA 4N0CD 4NUJA 1AC6A 2J4WL 3AS2A 3PFQA 4JKNA 4F1SA 4Z7UE 1BGXH 4KVCH 5C0RH 4G8FB 3AGWA 3ML9A 4HUXA 3M86A 4KROC 4P3CL 4Y9EA 2ZX5A 5IQLA 3SDAD 1S9VA 4XBPA 1J48A 3S0PA 3INOA 3SN6N 1WAAF 3MBEA 1PY9A 2QHRH 3UPRB 2F8OA 3LSOA 4NLAA 4P99A 3SIKA 5B7FA 3MRNB 5F7EH 4TNGA 1GC1H 1NMAL 5KYNA 4FQLH 4DAGH 4DOHE 4JAMA 3T1FB 3VYPA 1BZDA 4KFZC 1I8LC 1F4WL 1D5XB 1QATA 1PSKL 4UDTA 4XCYB 5JIMA 4PSJA 5MI0C 3EZJB 4F7MA 1ZE3C 5E6ZA 3II1A 1PCSA 5IW1B 1M05B 1TJHH 4O2EA 4UQAA 3TJPA 3FRUB 4ODVL 2R69H 1U8OB 3O81A 4NT6A 5B4MC 2DQIL 3KPQB 4ZAKC 3HLKA 4DP6X 1G7LA 4FX5A 5FF6B 2AK1L 5D2NC 4KKAD 3SE4C 3A21A 5LVEA 3L48A 1ZLUK 1ZRUA 4G7YH 1DVTA 2YD6A 1NBQA 4RDQG 3RPIA 2CALA 5DLML 3ETBF 3GPSA 1BVLB 4OJEH 2R1WA 5GQRK 3KL0A 3PV6B 4XPGL 3H3KA 2MFNA 1TVBB 1Z9SB 3U25A 1I4FB 1KCVH 1OCWH 4JPWH 2XFXB 2X41A 1GSKA 2C8NA 1MHCB 1Q9KA 4J3OC 1J0KA 2JH2A 3CZGA 4PW9A 4JFPA 4XAWL 5E2TL 1FO0B 3VJ6A 1D9KD 1JD9A 3N6YA 2YQGA 1AMYA 1VFOA 2O5XL 4H20H 4RFNC 3ZYNA 4PJ7F 1IQWL 5D1QD 1KNOB 5MEND 1AP2A 1OGPA 1SEBA 1ZLWK 1N6QL 2QVIA 5DQJA 2OL3B 2YFNA 3I75A 4XPHH 2ZWKA 2R0ZH 1FH2A 3QEHB 4N0FB 3OB0H 5ALCL 4CJ1A 4I7ZC 4Y4KC 2H1PH 3TO4D 5GISL 3WE1A 3U9UB 2KMWA 2J2ZA 3BH9B 1YPZA 5GZOC 4LSXC 1RK7A 2KPWA 1EHKB 4CVWA 3HE7B 5E7BA 5HVGB 4PWEA 3CZSA 4DQOH 3II2A 1P69B 3CDYA 1KGYE 5LCVL 1Q94B 3UERA 1LEGB 4ZOEA 1K2DA 1MCSA 2KQNA 3FH7A 2EDMA 2J6EH 5HTSA 5DO2D 5ICZA 4G1EA 2YKLH 3AGVA 3R19A 1CD1B 3WO4C 2K7PA 2E75C 3DUUB 4CC4C 4ZFFB 2JLPA 2W91A 3AS1A 3SJVE 5AKVA 3JWDL 2CO6B 4PS4H 1U91A 1VFMA 1HXMB 3QP3A 1CBVL 3NEEA 3G5WA 4QRFA 1M3IA 1SN2A 4G6AC 5SWZE 3RWHA 4AT6B 4R4BA 4JZJA 2JJTA 4ICWA 3VSTA 2YXWA 1NGWB 3QRGH 4QHKJ 1T22B 1YNTA 3H9HA 1OSPH 4KROB 4ODUA 1LO4H 3QDJB 4XBEL 5DR5H 2ZCLH 2PETA 5CZXC 3VXMA 3GRBA 5IR1A 1E7UA 4Z76A 2XI9A 3U6XA 3NSFA 4QRSA 5F9DC 1ZSDA 4Z64C 2CA4A 1AQMA 4PVMA 32C2A 3N91A 2ENQA 2V33A 3QZWA 2Z1KA 3KR3H 5LXVA 4JFTA 4IYKA 4OCWL 4X0KA 4XVOA 5BRZB 3FQRA 5DHVA 4PJ9C 1WC7A 3CFJB 2EXYD 2IALB 2D73A 3QC5X 2IV8A 3RDJA 2HCZX 1RIHH 1T0OA 4LEXL 2G3XA 5IVNA 4QR7A 2NX5B 1SJXA 1FFNA 3I85A 3RGHA 1Q9OB 4WDIB 3UO1L 3V95A 4LL9A 1D5MB 4BA0A 3MXVH 3LZNA 4UT7L 3HW7A 2KS0A 3GEWB 2BSED 3BVUA 3RX7A 1MRFL 4GRMA 1GZQB 2WLYA 3CFTA 4LSRL 1AC0A 5C0AE 2ELLA 1CGYA 5D2NB 4F91B 4YGVB 3K71B 3K91A 4CU6A 3HJ0A 2ZUXA 1MNUL 2XOTA 3VMPA 4UDUB 4WU5B 1DUYB 3L3HB 2K1MA 3DO3A 1KB5H 4HWBA 5ISZB 4YLQT 1QPXA 1T83C 5C07A 4TL5A 1W6WA 5JHLL 4FS7A 2X4QA 2AAVA 4DW2H 4L8CB 4JQIH 3QXAA 4JG0L 4EDWL 5HI4C 3UCQA 4JFDE 3T3ME 1TVDA 3WUZA 3R1GL 3ES6A 2F7QA 3MNMA 4NAJA 2F53E 5AOJA 2L04A 2FIKA 3FXIC 3CLWA 4HCRH 4PJ8A 3N40F 4RFOH 5F8QC 1PG7L 1QWNA 3HBQA 4I4WA 4BFKA 4WTWA 3SDXF 2FK9A 1ZVSB 4FQXB 4NPYB 1HYSC 1TVHB 1MI5B 4CSSA 3RNKB 3TT3L 1IGFH 3DGCR 1YJDH 2V5RA 5AENA 6PAZA 2D3NA 4AL8L 2CE6A 3RX5A 3SDXE 1I1FA 3FUMA 2Z7YA 4WRLA 1UZ8A 3ZVVA 3US1A 2QDWA 1CGWA 5IJKC 1BOGA 3RVTD 4ZG1A 5JHDB 4ZFOA 1U8NA 1AGBA 3MO1B 2HN7A 3KJ6H 1WWAX 3KEDA 5IV2B 4UIMB 5BS0B 2C3GA 2OI9C 4XZUB 2OZ4H 4X6FB 1RK0A 3WO4B 1LILA 1VGKB 4FNSA 1BVKB 1CQYA 3DJZA 4KGJA 3STZB 2F58H 3C6SA 3I3BA 5CBAB 1RZJL 2E56A 4Q58C 1HTYA 3T9WA 1NEZA 1FHGA 3B7SA 3L7FA 3SGJA 1WBZA 4KZEL 5IB4A 1N59B 4U6HB 1Z0MA 2HVKB 1SOQA 2A74C 2F5BH 4GG8B 2IAND 3VI4A 4GXFA 5TQ0L 3W0WA 1VPOL 4ZYKA 3KPRB 3NJKA 3U46A 2M2DA 1U58B 2JWYA 4HIEA 4D7BA 4U6YB 1KJVA 2NDGA 3CC5B 2F61A 4LE8A 3I74A 3GC3A 3R0MA 4NKOA 1NLBL 4NWTH 4PJDE 1KYFA 1AZNA 1NFDF 1XR8B 4PJ9B 3VE0B 4OF3A 4GUQA 5FFGA 2TRYA 5CJQH 4Z5RB 4NENB 5HDLA 3EO0A 3CBRA 5JUEH 5JLZA 1NFDE 4UB0H 3VXSB 5FCUL 3WKPA 4ALAC 3T04D 4YXHH 3FO2A 5JQ6H 2NNXA 1R3KA 3CIYA 1CK0H 2K6ZA 1N70A 3LEXA 3LNEA 3OVUB 4HG4K 3HLAA 1AS8A 4Z78B 4WFGD 1VKXA 2A6DB 2DYPB 1AXIB 4NFDA 4F5CA 1II4E 2ZQKA 3QJHB 1I8AA 4IU3B 5FGCE 2XQBL 4NKDA 4S0TD 2MPAH 4GOSA 4OZGE 4AMKL 3WPIA 1XGYH 5DYOB 3M88A 3L9RA 1NKRA 1JZ6A 2WXNA 2VRQA 3BVNB 4K2UH 3GHEL 2OXGA 2X1OA 2B3RA 3CZUB 4GT7A 4DHLA 1CU4L 3MA7B 1FJ1A 3ZDXF 4G6JH 3EDEA 1HZLA 4C56D 4NKIH 4GQRA 5A3ID 1GPOH 2A6IB 3BEVA 3G5ZB 4WO4B 2AQTA 5T3ZL 5DGRA 1IT9L 3DV4B 1H3TA 4JFHD 2H41A 3TTSA 4ONGL 4P2OA 2AP2A 2A73B 3D39D 5B8CA 3HCVB 3F12A 3OD3A 3TN0A 5C0FA 5F96L 1XZ0B 5GS0H 4JDVA 4FNUA 4F3FA 5JIHA 1H3PL 5C09B 1UWGL 3FTGA 2YK1H 1A9EB 2ITDA 3B9KD 4BXSV 2H7WA 3GMPA 2GY5A 4JM2D 2OMUB 1K4CA 1OAKL 3LXAA 3W2DL 2KLTA 1RZKH 1T0NB 2XVGA 3KYOA 5LGYA 1N5AA 1X9UA 4X42A 5JW4R 1TCMA 2PO6D 4LHUD 4MJ5A 3KGSA 2JK5B 1FVEA 2OMVB 3IJSA 4KJYB 2R2CA 1GS8A 1YYLH 1ZPUA 4FZEL 2EIKB 1CE6B 3ULVF 1XGUA 1KCUL 1DDHB 5H2BB 2J5LB 1OP5H 43C9A 3SDCD 1UATA 4QGYA 4ZFGH 4NQEA 1FA4A 4GP4B 5AOZA 1PX8A 3RWDA 3N9GL 1H6TA 3OJVC 4PN6A 4KJPC 2FNBA 4AK2A 1NKGA 5JHAA 1WUNT 3IK2A 1OAUL 4Y4HD 2GJ6D 3CVIH 1QSEB 2ICWJ 4MKMA 3V9CA 1W72L 3QULA 1TJGH 2VN7A 5C3TA 3RJQB 1UD8A 5C3LD 4M62H 3SKMA 1EHXA 2PYED 3MCKB 1PAZA 3W82A 1WIOA 2AJ3B 3F7YB 2V9TA 2W0KA 1DVSA 4AYMC 2APSA 3LNDA 3CZKA 2FJFB 5I1EH 4UILL 5I6XB 4BSWB 5FCSH 1YEHL 3GRWH 4N0CC 4C47A 4DCQB 2QT6A 1JI1A 3BGMB 5CP7B 2G30A 4R90H 2ZWYA 3H0TB 4Z7WA 1Q4NX 1PKQB 4CMMB 3UROR 1YN6B 3BLKA 1IKFH 1AKJD 3SDAC 2BP5M 3UL7A 2O26U 3BWUC 1ASPA 2WKOA 5CSGA 2MPVA 3BO8B 2CBTA 2AVGA 2CRMA 3AXLB 3G9VA 3IDNA 2HFFB 1M71A 3HHSB 1KBWA 3QDHA 4JN2A 5C9JA 4X6CA 1NCDL 1PZ5B 3LKPA 5DS8B 1BLNB 3MV8D 5DQDL 2YXVA 4M00A 2OMZB 3HFMH 3CMOL 2VLKD 4PJHF 5HDBB 3PIQA 3IMRA 4IBWA 2VAAA 1S9WB 2W81C 4E9TA 4QHKI 1JZ5A 2VKWA 3ARED 4R3SA 3MKGA 5F0LB 4Z0XB 1XF2A 4XC3L 2AEIT 3G6AB 4PJHE 4HFWA 1ESOA 3PRZA 4GSUA 5DD5L 1U8CB 4JFXB 2HKHH 2ZUSA 3EOBB 1MVUA 3T5WA 4KKAC 1L0QA 3HRZB 2GEEA 4NP4L 4PRIB 2VDML 5DJAB 3ASNB 3OZKA 1A6WL 1IM3B 1OF0A 5CGMA 2JB6A 2J1WA 4W9IC 5EH1A 4Z3JA 4UTBH 5JIQA 4FABL 1U8MB 1TTAA 1FZMB 2CLZA 1WAPA 1ZWIA 2G3NA 2MQCA 2VDOB 4ANVA 3BWAA 4PP2B 3OTTA 3UYOD 3L13A 3G9AB 2X4OA 1QRNA 4ELDA 5CWSA 2PNDA 4NN5C 5ERWA 1VESA 2ENYA 3GXUB 4NIKB 1D9KC 3VYOA 1P84K 2MKWA 1JE6A 1NDGB 5E9DA 3T6XA 5D1QC 2OX5A 3NDYE 4M9OA 5DD6B 3QEGH 5DJ2B 1I7UB 2RCSH 4FNQA 1AIZA 2BDNL 5FOBA 3HG0A 2GT9A 3QI9B 4MSWB 1IMHC 3T8XB 3CVHA 1E5AA 2CXKA 1QW9A 2BIMA 4Y1SA 3VSQA 3CXHJ 4JMXA 4AENA 3MJ7B 4AM0A 2VABA 4J4PA 1WK0A 4Z95L 2EDQA 3O2DA 3TO4C 3L95A 4MYWB 5E94B 3K6SA 5HVWA 3VI3F 1BBJB 3MRHA 3UZQA 1EDHA 4F27A 3VI3E 3DVFA 3QGVA 1X9LA 4PJIF 5DO2C 5ICXB 2J8OA 3QUXD 2YAPA 2B2XL 4PP1D 4Y0GA 4PG2C 4Y19D 2CO2A 1WCQA 2F18A 2OR9L 3IFOA 4HS8L 5GS2D 3CVRA 1CYGA 3AVEA 5ICUA 5I75C 4N6RB 1NPNA 1E7VA 1BFTA 5IKCA 4NFCA 3GXFA 3A4DA 4X4MA 3BFWA 4WNSA 2CO1A 4P23D 4I1PA 3HMXH 4S1RH 5K9JH 3SGDI 3WDHA 5HHOD 1G9EA 1CR9L 1FVDA 4KI5E 5GMFA 4HEPA 5SX5K 3D9AL 4PSRA 4F33A 1C5CL 5AVXB 2DQFB 3FQXB 2UWEF 3NZ8B 4X9FA 4JBSA 2HJFA 1JAEA 2FUQA 2O61B 4JPKH 4F7PB 3LX9A 3IF1A 3DC0A 1BZQK 1HKLL 2BFGA 3VGHA 3RIZA 1E30A 3UAJD 3W3JA 2JCCE 5E03A 1DDTA 2IBBA 1JHLH 5FM5O 3QDMA 3RURA 3SY0B 1PGVA 4OB5L 3FCBA 4NZJA 1NIFA 2E7BA 3SGDH 3T2NL 3TBYB 5I0VA 5I0YA 1FC1A 1CWVA 1EAOA 1PIGA 2EXYC 3OR7A 1Q38A 3P73B 5A40E 5DJ6A 5DTFB 3MYJA 3DX9A 2AQ3A 2HKFL 4UQEA 3GSWA 4P9HC 2IH8A 5HJ3A 4NQDA 1H3UA 2JJWA 4ZS6D 1OANA 3MN8A 2MQ0A 4AJ0A 1GMEA 3ZK0A 3TNMA 5L2KA 4NZTL 2HVJA 3IJ7A 4HWZA 1G7PA 2VERA 4OM1L 1MOEA 3S36H 3QBTB 4E42A 5IMLA 4MMYB 3V6BR 4YL4A 2Y7SA 2X1QA 4HSAC 3EBIA 1DLHB 1ZANH 4PJBF 2Y4SA 4YGAB 3PUCA 1MSPA 3AG4B 3OF6A 4ZXBB 1X7TA 4JKKA 3BDBA 2DD8H 5J1TC 2ZSWA 5J11C 1KYOK 5GGUA 1RZGB 1I7ZB 2DICA 4ABWA 4F15B 5HHQA 5KSVB 4KX7A 3W3BA 2WK2A 4MFHA 2IAAC 3S5LG 1EO8L 3FOMA 4IS6A 4EBQL 1QEWA 3WV0A 3VGGA 4RWYL 1C7TA 2EC9T 5D1QB 3RGVB 4HC1L 3RIFF 4PD4K 4YAQB 2I7SA 1OTUD 4U1IA 4PB0H 1MAML 4Z8FL 4GQ9H 4DO6A 2EIEA 5I5RA 4K3HA 5IB3A 3QCVH 5A16A 2AJZB 5MEQB 3TO4B 3FHQA 5LUMA 2KUTA 4JY6B 1PAMA 1PDKB 1UH2A 2QQNH 2XPGA 3RVTC 1J05B 1PZ3A 3NCMA 5I16A 3SSGA 3GS0A 4GJTB 3BPNC 4K0OA 3TLRA 4NQCB 4Y88A 1O6SA 5FYJE 1P2CB 5J9PB 3G08B 2A9AA 1EFXD 1K4DB 1T2QH 2V5TA 5E1GA 3U0WH 4NQSA 1A6TB 1FGVL 1NCJA 2L0DA 2CGRH 3VTAA 2DLTA 4P9ML 5BV7B 2VR6A 2P80D 4NQXA 4R7NA 4Y89A 4ZFQA 5FUZH 3N06B 1DANT 4UQIM 3BJLA 4LQ1A 3ILPA 4LAQL 2CG9X 1NCAL 4UZGA 3DGDA 1UZGA 4OFVA 3L2MA 4AVHA 4X8GA 2RAMA 1SEQH 2QVMA 3V4PA 1D3CA 3QZOA 4NJAH 3ATAA 3FSZA 2FBRA 4NBYB 5E8DL 5FWQA 3OAZH 3NIDE 3AM8C 2QKIA 3D09A 3WJJC 3V0IA 4XOBA 3A4AA 2X87A 4LCUA 2R83A 3BPOB 1U95A 5LNEA 1H8NA 1ZDSA 3QNZB 3ARFB 2EADA 2VMEA 5J57B 3EFDL 2FJHB 4PAZA 4OI8A 5DJ0A 3IGKA 4L4VB 5HYSB 1RFDH 4M48L 5I6KA 4ZMVA 2RR6A 4QKXB 2HTLD 4HUWA 4QRRB 3WY2A 4NEHB 1BMGA 1X5JA 3GUTA 2H0EA 2ICWI 4NO5B 3QA3B 5DSCA 2E8ZA 1S7WB 2L4OA 2QADB 3MLRH 3NFPB 1UCTA 2ZX9A 3HB3B 4TQ8A 4Y5YC 4M5YH 2EH8H 3OB0K 4HZLB 5I1GH 5C0IA 3VD1A 3TZVD 6PCYA 1B4JL 3WFCH 5EEVA 4Z1PA 1PPIA 2JIXD 4X7CC 5CSZB 4J2XA 4P59H 1FYHB 4K4KA 2CHXA 1T04B 4M6ML 3ZIYA 3EBGA 2LLGA 2SEBA 4MWFB 4E9YA 4YSPA 2PXYB 1JNLH 4L4TB 4KK5D 1F11A 1KGUA 2OZNA 1NUGA 1LEIB 3FL7A 1XSKA 2C1PA 3FK3A 2WBJB 1DN0A 1IKNA 4UM9A 3UTTD 4RWTC 5DVMA 2Q3XA 3O4LA 3VFRA 2ZSVA 5IJCA 2CIKB 1HXYB 4AQ1B 5A3IC 3IETB 1XDTT 3PHQA 3ZGHA 3G3LA 1M3JA 5D1XD 1J10A 1JZ7A 4FQQA 5KVDH 1SBSH 4MNHB 4A55A 1YMHB 3QG7H 2IPUK 5JW5B 4JUSA 1XXFC 2YEQA 4CP6A 3SKOB 2ZOKB 1JZHA 5FS5A 3ZL1A 2NY7H 1CDGA 2L3BA 2W92A 3B9KC 1LNUA 1ACCA 2CUAA 4LSVL 5FYJH 1BAGA 3E8VA 1JPSL 1UC6A 2XV6B 1NINA 2NMSA 3F83A 3IN2A 5FV1L 1HC1A 1JCKA 3M17B 4ONOA 2XZZA 4BSVB 2R9UA 5FYKL 4GAJH 2PO6C 4PREB 2BNUA 4YXKH 1UTDA 2IAMD 5GGVH 3BKJL 2EJ1A 2ADFH 2IADA 2R0WL 1KWGA 4LP8A 4KXFB 3L4UA 2C7UB 3SDCC 2BSRA 3VFUA 4HVBA 5IFHL 2EEDA 1G7QB 2Y07H 2V8MA 3CLFL 5I1KH 5GJTL 5AAPA 3VRLE 3VXPA 1JGEA 3O3EA 1ZMYA 4X7DC 1J8HD 1OY3B 1NGPL 3LIZA 3TBWB 4AV5A 1RJYA 1SXCA 1K8IA 4Y4HC 5FGBA 3LVTA 1A6AB 2FLRT 1IIIA 1W8NA 2ZAGA 4MQ7B 4TL4A 2H1XA 1KBGH 3MRIB 1ETJA 4L1BA 2ZONA 3GYRA 2C9RA 3MACL 4PGEB 1ECZA 4JK0D 2D3LA 4QRPB 2HA1A 3L4WA 2UZYB 3U4EB 4BQ6A 1MCCA 3NCYS 4HXBL 4YHLH 3MLVH 1AVAA 2VE6B 4GRWH 1CF8H 3OLEA 2VW7A 5HDQH 4PWFA 4TVSa 4EUPA 1ZTMA 4DNLA 3ARBD 4P8QA 2P1OB 3NK3A 4YHNA 1PQZB 3H42L 5FK9B 5BPPA 5D7LA 1KXQE 1D2PA 1X5LA 4UAOB 3V4VB 1CDBA 2Z7ZA 1G7HA 5I15H 2C7FA 5JDJA 3Q3GB 4J3OH 3N04A 4H0GA 4P06A 1M2OA 4NZ8A 3QFJE 1G6RA 2A83A 5LQBL 1J1XH 1CYXA 4HAFA 1SY6L 3GO1L 4Y4FA 5GGRB 4BEIA 4E41D 5JIPA 4Q89A 4QYAA 5E4EB 1CGXA 2RFXB 3CFEB 1XAUA 4O2FA 3ZHDA 1EAPB 4P46B 5D4HA 1NAMA 4TTDD 2XICA 1OE1A 2Q1EA 2AMUA 4YHYC 2PPAA 1GKOA 3O45B 1DQJB 2HPOA 1SLUA 1IC5L 1U6AL 3M19A 1UH4A 1NPJA 1ND0B 2VLRD 3AREC 3H2QA 4UIKH 3DNKA 1NICA 5BQ7A 4GI6A 4JPVL 1JPTH 4GW1B 1I1YA 4M5ZL 3G5VA 4M03A 4AZ8B 3FCSA 5FO8A 1PGRB 1MW2A 2QV2A 4NM4L 5JTWA 3VRJB 3TA3A 2EIMB 3PQYE 1U3ZA 1NCBL 4LBAA 1J5HA 2R0LH 5I5JA 1UCBL 1WP6A 2VXQL 4UAHA 3WGVB 1AGFA 1OGQA 4Z7IA 2OMTA 3D39B 4GKSA 2I07A 1L5GB 5C2BL 1WWBX 3AB0C 4LIQE 2YMOA 4PH8A 2VXSL 3SGKC 2FH6A 3UMTA 1WT5A 2MQ3A 4J8RB 5D70H 3F5WA 3X3FL 3ZTCC 2BXZA 1VFAB 1B4LA 4PV8B 5HI3D 1NTDA 3O8XB 4B97A 4DGWC 2XYBA 3GSQB 4EI6A 4YDKH 2Z31A 1PEWA 3KZ8A 4PRBA 3S4SA 5JXED 3CFDA 5K9KA 3WPGA 2AV7A 2BSBA 4A7VA 4BCZA 2NSMA 3GTVA 3EJZD 1ET7A 2F7IA 1A7QH 1D5ZB 2R2BA 2ZP0T 4R2GB 3RIAK 3T8MA 4E0RA 4J3BA 4ZW7A 2Q8BH 5HYJA 5F1KC 3HE6D 5ETUB 2XRAH 4AYDC 4ABVA 3SDCB 5M94B 2AANA 5DRWB 3VGAC 5D7JD 4FXGC 3KYKH 5FTTB 2GCYA 3RWCB 1SUHA 3RWIB 2XLLA 5IQNA 5JW4M 1HOCB 3B9DA 4JNXA 1IAIH 4MA1B 3JWOC 4Q2ZB 1WZ1H 1T21A 2AAAA 5DJ8A 2Z9TA 1CFMA 3KYMB 3BE1H 2W65B 4JRLA 1MUJA 2VXUH 2HX7A 3QUXC 4PP1C 3QHZH 5EUOF 4F1ZA 4ZNEA 3PL6A 3C5JA 1A14L 2LU7A 3GBML 5FDWA 3WAJA 1QUNB 4JHUA 3ERXA 2R27A 3TT1H 3SPHA 2F8XC 5DFWH 1OT2A 2OSYA 4RETB 4WI4A 4FLSA 4P23C 2DZEA 1YPZF 5EWIL 3SD5A 4G8FA 5B1KA 2WO4A 2P9RA 3HN5A 3K6FA 4HFUH 3RWEB 1AKJB 3MJ9H 2Z6FA 5E4IA 4WHYH 2OMNA 1XGTB 2Q3ZA 4PM1A 3UPRA 1KYUA 1EUTA 3WDJA 4PG9B 3MRNA 3IFNL 2NY4D 3UAJC 4GP5B 3T1FA 4AKOA 4QOKB 2XIIA 1ASQA 1H6EA 3LH2H 1D5XA 2IXQB 4XCYA 1OAQL 4ANXA 4YSOA 5I1IL 2CRZA 1KXTB 2GIXA 2HJKB 4YHYB 4BUHA 2HUHA 5IW1A 1M05A 2VNCA 1YNTF 4ONHB 3QRBA 3ZR6A 5BUAA 2JF1A 3FRUA 3CQFA 1WZMA 3OKNB 3KPQA 5DD3H 5JIIA 3KXFB 1LO5B 4ZS6C 5AW2B 3X1BA 1WFJA 3ECQA 4L8BB 5FF6A 1OP5K 2YXMA 3BKYL 2I60H 5L4MA 3BSZA 3MRCB 4WTXA 2ZXCA 3DJ9A 1R3LB 3OHMB 1OCCB 1BVLA 2FQEA 4IHBA 3ARDD 3PV6A 1UEYA 2G2PA 1TVBA 4LVNB 1Z9SA 3MAWA 4PGZA 3TGXA 1I4FA 4NQTA 3N41B 4J4LA 2XFXA 3SYPA 5FOJA 1RD6A 4AEFA 3KYAA 3DHJA 3T3PF 1MHCA 25C8L 3Q43A 3WKNA 3EOTL 4Q9RH 2EDBA 1EJOH 2AEPL 4P2RB 4WK0B 3LH8A 1L3WA 1FO0A 3QNXB 3P2DA 3HNSL 1FYTB 4WUUD 3T3PE 2XJLA 4NN6C 1I9EA 2G75A 3A22A 2IPTL 5IFJB 3Q2CA 5CNHA 4U05A 1KNOA 2VW6A 3GK8H 4FDWA 1IGTA 1X5MA 2VDKH 1N5YL 4DF9A 2OL3A 1ZTXL 4NO0D 1U3HB 3ZHNA 3Q0HA 3GRGA 3MV7B 1OTUC 3QEHA 4N0FA 4YDIH 1MW0A 3QWRA 1QKZL 1IGIL 4XX5A 3IGAB 4KJWD 5JR1H 2FHBA 4MCMA 3HA0A 4PCTA 1R1CA 1GYUA 3BH9A 3D85D 5C07E 3VGAB 5DC9B 3HE7A 1AMXA 4OGXL 5JIKA 3IWUA 4EIGB 1ZGLM 1Q94A 3AS0A 1LEGA 4B60A 3H2PA 4K5OA 3JBG7 5CCHE 4G71B 4CGTA 1RUKH 1T7WA 3AITA 4KMTH 1CD1A 3DUUA 4CA4A 2X89D 4MD0B 4ZFFA 2C1OB 1ZVNA 1CIUA 2DEXX 5C6TH 3QUXB 2DKSA 5C7ZA 1BIHA 2CO6A 4JHVA 2ATAA 1HXMA 4X7FC 4N5ED 4PVNA 4YLBA 3NGBB 4S1SL 2BO0A 4AT6A 2Z8VC 4LSQL 1WCBB 1H5BB 3QCUL 5F7NC 3CZLA 4HQQL 1JHTB 1F4YL 2VZ1A 1NGWA 1KCRL 5GPRA 5ADPL 1T22A 3HVDA 4O02L 3UBXI 3DO4A 3QDJA 5DUPH 5HHOB 1UZ6F 3WLWD 3NCEB 2W94A 3SKNA 2R29L 1XO8A 1YECH 1CI5A 1WFMA 5E6YA 2X42A 1FRGL 1UZ6E 2MNUA 2OULB 2D0GA 3A23A 3QXUA 4HUVB 1CLYL 1LO0H 4BKTC 5BRZA 1E40A 1TTFA 3BN9D 2WQAA 4PW4A 2OM5A 4B27A 3CFJA 4AMXA 5E8PB 2IALA 1I8LA 2MWCA 1YRGA 3L8QA 4JO3H 4WQOA 5IK3B 2NX5A 5GS1C 3BAKA 1Q9OA 2VRKA 4WW2C 1D5MA 4D3CH 2HTLC 2YPVA 4KO5A 3HZMB 3MV9B 5IMKB 1HQ4B 4L9LC 3WIIH 1YEKH 4P2AA 3VXNB 4R0AA 1GZQA 2NY3C 2J72A 2H2SD 3LDBC 4GQPH 4XGZB 4YGVA 5D2NA 3WFEH 4PJEA 1OAZH 2XQYK 3VI4E 3X1GA 5LG6A 3K71A 4Z0BH 3TZVC 4UDUA 2V6HA 3MA9L 1DUYA 3L3HA 4WU5A 2ZCZA 3D4YA 4J3SA 5ISZA 1U2HA 4G82A 3SKJH 2FR4B 3TCXA 4YDNA 4KPHH 5D9SB 4L8CA 1DVXA 3OPUA 4QO1B 2JQAA 4HETA 3HNTL 4ZMNA 4KK5C 1MIMH 4JQVA 1N7MH 4OQTL 3MV11 4GAGH 4EKXA 3QORD 5IBUG 2CJSA 4F57L 2EVJA 4YSSA 2YWZA 3NP4A 1ETZB 4I2XE 3VQ2C 4U31A 3D87B 4NPYA 1ZVSA 1HHGB 5D1XC 1TVHA 1MI5A 1MWAB 3RNKA 2UUDH 4N68A 4F5CE 1HCYA 2W0LA 4F8QA 1S7QB 1Y18B 2XNAB 2B1HL 2YD5A 1GGCH 3GBDA 2JXMB 1SXSA 5LN4A 4ODXB 4K15A 1R3HB 4BQBA 4A2HA 5DWUL 2DQUL 4QRBA 1P1ZB 2XWTB 2R9HD 5JHDA 2GQHA 2K78A 2QGDA 2RACA 2XG5A 4IRZL 3GF8A 3MO1A 5C7XH 5I8OL 3CN4A 4DVRH 1ZT7B 2LU5A 4LCIL 5IV2A 2VDLB 3FDWA 4UIMA 5BS0A 1DFBL 5M7QA 2LT9A 3NPSC 4XZUA 4X6FA 4OLWH 4QRTB 4R6JA 1VGKA 1EFQA 1UUNA 4CC4A 4I3RH 4N85A 2NQ3A 1BVKA 3QUZB 2YSSB 5C0CD 3STZA 1GY2A 1GJIA 2Y23A 3H9YA 4HJUA 5JYLA 3TONA 4TLSA 2DWTA 1RUQH 5TFSL 5CBAA 1VZIA 2DY2A 2IAMC 2LAGB 3MGAA 4FRWA 1RP8A 4BDVB 2P24B 2ENSA 3EXLA 1N59A 2PCPB 4U6HA 3LZPA 2E7HA 4P48A 2HVKA 3U7YH 3L16A 1M0ZA 1YEWA 3JZ7A 1Z9OA 2NY0D 4GG8A 4RGNB 5BOJA 4JGNA 3FT9A 3C09C 4PRPB 1K6QH 3KPRA 1OSZB 1U58A 3C6LB 3LPWA 3NJLA 3NTCL 4U6YA 3CC5A 3PNRB 2JKTM 3LKSB 2BVQB 1JRHI 2BY3A 2PKDA 3EJPA 2PR4H 1XR8A 4PJ9A 3DX4A 3VE0A 3VGFA 1K3ZA 2E7LA 2VZVA 4LPXA 4TOYL 4M8RA 1IAMA 4U6VH 4Z5RA 4NENA 4XCCH 3BRGC 4GS7B 4JFFB 2YGQA 1Z3RA 3CFBB 5E5MB 3VXSA 5IEHB 3ARBC 1HWWA 5KW9H 4NQEE 4QEGA 3NFSL 3QCTH 1HNFA 4L9LB 5FXCH 1JRHH 4Z78A 2A6DA 2DYPA 4PYGA 1U8QB 2NY3B 3HBGA 5ENWB 3C2AH 3QJHA 4IU3A 1PNDA 2WOBA 4DP0X 4A7SA 1SNRA 2JIXB 3IS1X 5DYOA 5FUOL 4AQZA 1VEMA 3CK0H 4WI6A 2FD6H 3BVNA 1MJ7H 1FLRL 4Z7WF 3O11B 4TUJB 4KWUA 3S5LB 3MA7A 5EIIB 1MCIA 2DIBA 3LAFA 1SUJA 5CZVH 3BZ5A 3DOIA 4ZDHB 1XQ4A 2G60H 1HK6A 1XGZA 3PWPD 5H4YA 4E9QA 5IJDA 4MX7B 2A6IA 3G5ZA 4LEBA 1Q0EA 4WO4A 2WKOF 3HC4L 3DV4A 1TYEB 3RDTB 4PUBH 4JFOB 5D1XB 1L4IA 1DQVA 1WD8A 2A73A 4X6CF 4JKPH 3BIAX 3P0GB 4P49A 3HCVA 1PY0A 5KSBB 5H8DA 1XZ0A 3ZR5A 4BV4R 4BZ1L 4EOWH 2ZX8A 2CRYA 3NABL 5C09A 3V4UL 4X6CE 4H0IA 3MUJA 1A9EA 4PB9H 4PTUB 4CSZA 2XIBA 1MN4A 2OMUA 1A3LH 4GINA 1ADQH 5HI3C 5CCKL 4KC3B 4HZ1A 3MFGB 2QSVA 4LMQE 1ZLDA 1T0NA 4FXTA 5AW8B 1KXHA 3FTWA 2NLJB 5JXEC 4ATTA 2O6SA 1EK3A 3QPXL 2ZOUA 4MJ6B 5EZIL 2JK5A 3EJZC 2OMVA 2ZE0A 1OPOA 4KJYA 4OV6F 2Y7MA 4QXVA 2NNRA 1CE6A 3L3KB 2ZX7A 4G8EB 3FN0H 1DDHA 5H2BA 5IVZB 3UGUA 1BG1A 1YEEH 1DLFL 4UV4L 1A7RL 2Z62A 5A6LA 3HE6C 1KMGA 4FHOA 1HT6A 2B1AH 3CN3A 4AUUA 3CE1A 3P11L 4AYBA 5D7JC 4AL8C 4NKQB 1U9KA 3N0PB 1Z66A 1J8HB 1QSEA 3FOLB 4HKJB 2PR9A 3CZFB 4JR9H 4UQ2B 3SE8L 1G94A 1T03H 5IT2H 2UXFA 1GKEA 1BPVA 1XFPA 3MCKA 3MLUL 3PWJB 2AJ3A 5BQDA 1OD9A 4KZDL 1QRNE 3F7YA 5ABZA 4K8RH 1E5CA 4XMKL 3QNFA 2LVEA 2FJFA 3REWB 3U4BH 1IFHL 4BSWA 4LAJH 3BPLC 1YQVH 4DCQA 5K9QI 3BGMA 5CP7A 3W39B 5DC0A 3H0TA 3SPGA 4CMMA 1PKQA 1AO7B 1YN6A 3NRQA 1CTOA 3ARBB 3TCLB 2VC2H 1KY7A 1XWVA 3A6OA 1NANI 3IGFA 1E5ZA 4A38A 3DUHA 3S35H 3MU3A 5GRUL 1BREA 15C8L 3IJYB 4D0DB 1NBYB 4OFYA 2WZPD 3UABA 1L0PA 3BO8A 4DUXA 1XCTB 3AXLA 4S0SD 2HFFA 2NY4C 3HHSA 4YLCA 4KVCL 3KLKA 1PKOA 1PZ5A 2E3VA 2W59A 5DS8A 3WELA 5C0RL 1BLNA 1BDYA 2ZIDA 2OMZA 1NANH 4BUQA 4FKHA 2FB4H 2CKBH 3FT0A 5GRZA 1S9WA 3OKLB 4JHBA 2QHRL 3KM1A 4V33A 3PS6A 4Z0XA 3SHSA 2AJXH 1EJ8A 3G6AA 4L8SC 3OG4B 4X4ME 4YN3A 2GBVA 5F7EL 2V70A 2NTSP 2XKUA 1BXVA 3QH3B 1U8CA 4GKZB 4JFEE 4GRLD 2E7CA 4JFXA 4FQLL 4DAGL 1URZA 1PLAA 4K73A 3WPFA 3HRZA 3LXBA 1SYVB 1EZLA 4PRIA 5DJAA 2GI0A 2BFVH 3NCBB 2EDEA 1TQSA 1XEUA 4ZNCD 1AG6A 2IFGA 2QQLL 1IM3A 3V5HB 4H1LH 3ARDC 4M8QB 2RIKA 3B7RL 3T6VA 4AYID 4AY0A 5TDOB 4P5KA 1U8MA 1QZNA 4FG0A 1KWKA 3B6SB 4JUTA 1NGXB 1QFOA 1FZMA 3X1EA 2WGXA 4QHLB 3S3SA 4PP2A 3KWWB 4G7YL 3EYVB 3F7KA 3BN3B 3FSAA 4IBTA 3G6JB 4PFEA 4OZHF 1KCVL 1NDGA 1SGKA 1OCWL 4JPWL 3L45A 4NQDE 1R24B 1EGJH 1U33A 3PDGA 1I7UA 4X5XB 5DJ2A 5I1AA 3DZEA 4ZUVB 3NIGE 2I85A 3QI9A 4MSWA 1EAQA 2RH0A 3TBVA 4DK5A 4FFTA 3CMGA 2HG5B 3T8XA 5D6DA 4AG4H 3RIAF 2IG2H 4UYQA 3UN9A 3MJ7A 1QSFD 1JI2A 4KJWC 4LLMB 5E94A 4YL9A 4NPJA 2D4DA 3WG7B 5HY9B 3PFUA 5EU6A 3Q7JA 4XPHL 2J20A 1GYCA 5SWSD 2R0ZL 5KYUB 5D1ZD 3V0HA 2H1PL 3F65A 3KWVA 3IPEA 5D93C 2EABA 2YJLA 3EJTA 5C08D 1MFBH 1PZCA 2XKNB 1G0DA 5FYKD 4N6RA 4RGOH 5AOLA 1I8IB 5IESH 5KSUB 4HLJA 4N5EC 5FHAH 4DQOL 2Z64C 4Y5XB 1E27B 5J6SA 2K8MA 1XMEB 2J6EL 4ARNA 2GPZA 5GRXG 4D9RD 2YKLL 4RWHA 2XV0A 2DMBA 3HG1D 1INQB 2DQFA 2KT6A 3FQXA 4JCLA 2XZQH 2YAFA 3WLWC 3NZ8A 2GK2A 3G06A 4QKTA 2MNWA 4ATWA 2BX5A 4PS4L 2O61A 2ED7A 4F7PA 3KAAA 5DFVD 3MUY1 4WEMB 5SX4I 3WEMA 4G7RB 5J5EA 1G7MB 3SY0A 3SZKC 2NY4B 3AY2A 3QRGL 1C8QA 4MZIA 3GMMB 3BN9C 3TBYA 1OSPL 1V3MA 5DR5L 3VXRD 2ZCLL 5IJBA 3HIZA 1K72A 3FUEA 2Q7NA 5DTFA 2DI9A 3UIYA 2VZ3A 2ZUUA 2COVD 1QFPA 2EEBA 3U1SH 4RX4D 4O00A 5T5FA 5SX4H 3KR3L 3EYFB 3OB8A 4Q4EA 1KLFB 1LD9B 4BSJA 1PZAA 2YRBA 2GSGB 3JV0A 3WTSA 1FSKC 5KVEE 1Q9LB 1JGVH 2H2SC 3UIZA 5IUCA 1N9PA 1RIHL 2GUYA 4MMYA 5A43C 3CHSA 3X2QB 4KKZA 1A64A 1XH1A 2IV9A 3LNGA 4YSTA 1J8KA 4BCXA 1DLHA 1MHHA 2WBKA 4XO8A 4DO5A 4JPQA 5E2WH 1NMCC 3P30H 4ZXBA 3N1GC 4LARH 3CFUA 1DBMH 1P5VB 1JF6A 2NOYA 5C2UB 2BNRE 4LXRA 3J7HA 2X9YA 4UOW1 2DKUA 1RZGA 1I7ZA 2X2UA 3EIFA 4ZOCA 5L8KB 5BO1L 4QAMB 5KSVA 3IGLA 2WNXA 3QORC 1KB5L 1E6JL 4LFHD 5DRZB 2CCVA 2B7DT 2UZPA 3I6LD 2WTRB 4XBGB 5EOCH 4ZTPH 3EFFB 3ZQ9A 1MREH 5D1QA 3T0VA 4DW2L 3OJAB 3TEUA 1HNGA 1C5DB 3QUMB 4YAQA 1JD7A 4TULH 2VSKB 5EV7A 1QW8A 4UT9H 1QR1B 2NDFA 3AW5A 3S37L 3IBEA 1V7NH 2HWZH 4G59C 5D7IE 3GSNB 2NYZA 3LNFA 2WXLA 5MEQA 2AJZA 4K23H 3TO4A 3IRCA 2H0JA 2BJMH 4HCRL 3K1KC 3CDFA 3DJTA 4JY6A 1OAXH 1PDKA 4BWWA 1J05A 1RZFH 2OSXA 2FT3A 5L0QC 4WCYH 3UL9A 1IGFL 4EMZA 1I9RH 1YJDL 1S78D 4NQCA 1S7RB 3IMVA 3KPLB 3SYCA 1MIEH 1P2CA 4B9IA 1TSHA 4W9KC 4F2ME 1NFIB 3G08A 1GCYA 2YGPA 5J9PA 1K4DA 3VXUD 3F00A 1EZVX 5LB1A 4PG2A 1QEXA 1A6TA 1D5BB 3C8KB 4NRZB 1QVOB 2HLAB 4M1GH 5DS1A 4DKDC 2W9EH 4DK6A 5BZDB 1W6LA 1KN4H 2UV3A 4ZPTB 5D8JH 3VRIB 2Q3AA 4GG6B 3KJ6L 1OP9A 4P0DA 5CR1A 4HV8B 4AW4A 4Y7MA 4KKLD 5GRYA 2BOCB 2NY0C 2IFFH 3CLEL 3VWJD 2GIYA 4B95C 2F58L 1U42A 3QC6X 1SVBA 5JZ7C 2I69A 5A2IH 1KGCE 3FUIA 3LRKA 2HVBA 1W72B 2UVEA 1YZZA 3K2MC 3E7JA 1E4WH 3QNZA 3ARFA 4G11A 2Z0BA 2B5IC 4YSUA 1FG9C 4AVKA 1PZDA 1DP0A 2FJHA 3T4YB 4L4VA 1KF9B 4EIZC 5HYSA 2FLBT 4W6WB 4JEGB 3CGTA 4B5EA 2WQUA 1IIKA 4QRRA 4X4KA 5F3HB 3GNML 5C0EB 4NO5A 3QA3A 1S7WA 3NFPA 1CICD 2P52A 2BSEA 2ZWZA 4NWTL 4PMFA 4HZLA 1K8DB 1NSNH 4XX1G 1ODUA 1VCBC 3LB6D 3QZMA 5JUEL 5CSZA 3H53A 4HH8A 4PRHB 4UB0L 1DSFH 2A9DA 3G04C 1T04A 3CJJA 4YXHL 4H5SB 5HGAB 4JDTH 4F7KA 5JQ6L 1DQTA 4GSRA 4MWFA 4NUMA 1TPXB 2K0RA 2PXYA 4OCLC 5DVNA 4BUGA 1NMCB 2WQSA 4L4TA 1G87A 2MOVA 5GXBB 1SDDB 4WK4B 1LEIA 3T6ZA 3H56A 4CU8A 2WBJA 2MPAL 5CZKA 2WXOA 2O5YL 5DA4A 4O51B 3QXDB 4F80A 1G84A 1J9TA 1XGYL 2RJMA 5C0BD 3QORB 2FQGA 4X8CA 2CIKA 3W56A 1HXYA 5D7LE 5TH2B 3AWEA 4AQ1A 3IETA 4HJGB 1QLRB 3WXVL 4FL4B 4K94L 4K2UL 1XSIA 1E9QB 4A2LA 4MNHA 1MCRA 4M7KH 4OGZA 2B9AA 1X9RA 1YMHA 1IGYB 2W0PA 4HPHA 5JW5A 5AVYB 4G6JL 5F44A 4K71B 3NVQA 1PMYA 2VDMB 1L9OA 3SKOA 5IW6B 2ZOKA 5GS2H 1BWWA 4FQ1H 2P26A 4CN1A 3AY4C 4PWIA 3QZBA 1F1GA 1U21A 3M17A 4BZYA 4XPBH 2GY7B 1QBMH 2Y72A 4BSVA 3DVIA 4UMGA 2N0MA 4CVZB 5GS0L 1F90H 4PREA 3IMBA 4W9LC 1YY8B 5DURD 2YK1L 5DRXB 3GMRB 2IO5A 2LGNA 1X7SA 4LSUH 4RISH 3Q2VA 2JE1A 5A6MA 5C0CB 3V52H 4CNIB 4OJCA 4ADIA 3LZQA 2C7UA 4UQ3B 4AYFB 1G7QA 4BSUA 5I0XA 5EZJB 1RZKL 1UB6B 1GZHC 3E9TA 3ZTEA 3TBWA 3LKQB 1HHKB 4XVJL 1J87A 1A6AA 3FTUA 1REIA 4MQ7A 4NNYA 1RULH 3MRIA 3PXLA 3MLWH 3AM8A 3OSVA 3CXDH 4WI9A 4FXKB 3WJJA 5DZ9A 4PGEA 4ZFGL 4QRPA 4Q9QL 1SHWA 2UZYA 3U4EA 3FUHA 2MHAB 4QJ4B 3T2OA 4Y1AD 1F0LA 5DLLA 1NGZB 2XBZA 1ITBB 2B5IB 4QTIH 2VE6A 2DBJA 2W38A 2VMFA 4L8DB 3CVIL 3DIVA 2GIMA 3HI1B 3H8NA 5JHMA 2E59A 1TJGL 2Y1AA 4PJ5D 4JFWA 3HG3A 1PQZA 3P0VH 5FK9A 1CYWA 1WA0X 3V4VA 2UUDK 2XN0A 3Q3GA 5DMGD 4OY9A 4YZFE 4WI0B 3WTUA 5HJGA 4PRDB 5I1EL 2WB7A 1VACB 4N0YH 1UACH 2EDYA 3US9A 1KCWA 3CCHB 3IFPB 5GGRA 1WFTA 4JFQB 4H0LC 2G5BB 4RBPH 1IKFL 2RFXA 3CFEA 3AMKA 3QEQB 4OLYL 3C8HA 1EAPA 4P46A 4ZNEE 3ZDZB 1OL0A 3Q2NA 2X4UB 5DVOA 2VR4A 3QIBD 3O45A 5IBUB 1DQJA 3QZWG 2BY0A 2MOQA 5TK2A 3IDMB 3OKKB 1ND0A 3U2JA 1RMFH 4UOQA 1TQBB 3P2TA 3II3A 4FQ2H 1TMCB 4GW1A 3BZEB 4TZHA 2X1PA 2XVBA 2WB1A 4G8GB 3SYAA 4AZ8A 4GRLC 2BS9A 2LFEA 3VRJA 2R56L 4YHKL 4XXWC 4Y5VC 5AKSA 4YDZA 1PZBA 4KKCD 3G5XB 1JZIA 5H94B 3AT0A 1KEGH 1L5GA 2ZTBA 3D39A 3QO0B 3D69B 2VDPH 1MCHA 2HKHL 1EEQA 1A3QA 4J8RA 3THMH 3OKMB 1JXJA 3ZKXC 1VFAA 4PV8A 1HL8A 2CWRA 3JTTB 3GSQA 4V11A 1A7PL 1DVYA 5IEKB 1PEZA 2FJGB 4JZNB 3QUYD 4WIQA 1YEFH 1EEYB 1BFVL 2WYIA 2ERJC 4X9GA 1D5ZA 2QJDA 2FHCA 5SWQB 2AHIA 3VG0H 5C0JB 4F8NA 4OCYH 3E6JA 3SDCA 1DUZB 4HYTB 1AZVA 1MFAH 3Q1EA 4JB9H 1AD0B 2EH7L 2HXAA 5DRWA 4GSQA 3RWCA 3M7FB 3CFIC 5JPNC 4WGKA 3WNNA 1UB5A 3DSFH 4DP9X 4C2AB 4NXSA 3RWIA 5A1AA 3QEGL 3BIKB 1HOCA 4U1KB 1D6EB 1MFEH 4JQXC 2HH0H 4PRAA 3JVGC 4Q2ZA 1U36A 3F05A 5KJ4A 1ZCRA 3D2UB 2GJJA 2J57A 3RI5K 4HK3J 3KGRA 2B20A 3KYMA 1ECYA 4TLUA 2W65A 4WKZB 5D1ZC 3LJ3A 1SOKA 3ZBMA 1SXBA 3C6NB 1JUFB 4YE4H 4Y2LA 2VQ1B 1SYSB 2EO7A 3B3IA 3B9EA 2DLGA 4OJYA 4HEMA 4R7DB 1QUNA 5LNGA 3ZYJA 5FO7B 3OKDB 3OPZL 4B7LA 5DF0A 4KTDL 3QEUB 3RFEA 3T2QA 2E6JA 3ZE1F 2QTEA 4L1TA 1GH7A 3T0XA 3X17A 4KRPB 4HSQA 4P4RB 2XZCL 3RWEA 2P5ED 1CF1A 1XF4B 1AKJA 4FI6A 1F3RB 1XGTA 5HYIA 1PSKH 1D7FA 3OQ3B 4O5LH 1NEZG 1ZLVH 2YPLB 3P40A 4QDGA 4PG9A 2NY2D 3L1GA 5DFVC 3FJTA 3KMDA 5I28A 2DMCA 4FEIA 3RHWK 4ORGB 3LEYL 3HMXL 1JPGB 3BCDA 3VNZA 2OTWB 5K9JL 4QOKA 3AWFA 1DVZA 3EH2A 2IXQA 3QISA 4JGUA 1KXTA 5BZWB 2HJKA 2E9GA 3FHEA 2AK1H 3T0BA 4LDLB 3U36A 5KBNC 3S8WA 3QWNA 4JPKL 4LOUD 1JL8A 2DL9A 5HHNB 5DLMH 5HHMD 3OKNA 2CA6A 5EDXA 2VUYA 4DH2A 3KXFA 1JHLL 2B08A 3CXFA 1LO5A 4X6DB 4L8BA 1EBAA 4JO8A 4AQEB 2KYIA 4GRLB 4ANUA 1PD0A 1RSFA 1EEUA 2CHDA 2Z93B 2WXMA 5FIEA 3MRCA 1TQWA 4GKOA 5MHSE 1R3LA 3EJRA 2NNCA 2FUTA 4MMZB 1RURH 4G80B 4QT5B 3MRQB 5E2TH 4OSUL 1SHMA 1KOHA 3L4ZA 5ITFB 1T1YB 5H37H 5BRZE 2XBDA 3HS0C 3LTVA 4U1GC 3SGKA 2O5XH 1B0IA 3ROLB 1O0VA 2YQ3A 5JMRA 4OUUB 4P2RA 3P54A 4UWQB 3S36L 3EUDA 3QNXA 1FYTA 2NX5E 3B83A 4OLZH 1WYJA 1OTTD 3IRPX 3BYTA 5IFJA 1MLBB 4PJEF 2AXWA 4U2ZA 4GRWF 1SQ2N 1TENA 3RB7A 3SYQA 5ECJE 3LNIA 4XH2B 3OAYH 1U3HA 4PJIB 2DD8L 3MV7A 4CSTA 3Q48A 3I9GH 4RDBA 5F0PB 1ETA1 4KDTC 4KXAA 5LCVH 3FUNA 3IGAA 1QPPA 2CJTA 4FHKA 3W9DB 1JPST 4J28A 5CJXA 5CF3A 1JPEA 4XN2A 1UXSB 1JTTA 1RPKA 3UTOA 4X5RA 4BINA 4ZSOB 4XMUA 2NNAB 2Z4QA 1JERA 1P6WA 2HB0A 5DHYB 2GFBB 2AJYL 1S78C 3EO9L 4PB0L 4OVUA 3QARA 4WV1B 4B9YA 4GQ9L 1WS7A 5ECGA 2C1OA 3QUXA 5IFAH 4HGKC 1DJYA 1SN5A 4N2HA 3ZZ1A 2QQNL 1MI5E 3RRQA 3KLAB 1WCBA 1H5BA 3VFSB 1JHTA 1P7KB 1EHAA 2ED6A 4MCNA 2CA3A 5HHOA 4OCWH 1MVFA 4KKLC 1T2QL 8FABA 1O7DC 3VWJC 4R0LC 1MFNA 4YHPB 3VG9C 2B9BA 5JHDE 3NJJA 4ZMAT 4WENB 5FUZL 2EAEA 2WQRA 3TWYA 4BH8B 4HUVA 1V27A 1MXDA 1WZLA 3WIHA 3D50A 2CR3A 3LZLA 4PW3A 1GYVA 2DWDB 2QPSA 5E8PA 4FYQA 4UT7H 1SEQL 4R97B 1HHJB 2A9BA 1TNMA 3VXRB 4CMHC 1HL9A 2P8PB 5AVVB 4LSRH 4ARRA 5IK3A 4XPFL 2FECL 5LGHH 2PLTA 4RZCB 4OZIE 4PHZA 4PJBB 1BZ9B 5IMKA 3HZMA 2V2XB 3MV9A 4OJFL 4A67A 1HQ4A 4M93B 2ODIA 3J27A 3B2VL 3AABA 3VXNA 1TDQA 2J8UB 2GHZA 1CICC 3RZCB 5ACZB 4XGZA 3PGFL 4KVPA 4QRUB 4LCCC 3CFMA 3LB6C 2LFGA 3BD3A 3IJHB 4EDWH 3KPRE 1RFDL 4EN3B 4BKSC 3L3JB 4ODSH 2A9CA 1EV2E 1DQDL 1URIA 2FR4A 1TZAA 2RGSA 3X3GL 5D9SA 2DTML 2CXGA 4WUUE 2QGBA 3TVMD 3HS0B 4U1GB 1LO2L 4QO1A 4M5YL 2EH8L 1OZUA 1FUNA 3PP4H 4MLSA 4P2QD 2MCPL 3IDYB 1TKWB 3WFCL 4A04A 5E4OA 3NRFA 1FLTX 2ZT9C 4M3JA 5LBSH 4P59L 3VXSE 2DL2A 2JKWA 3JUZA 4XCFH 5CN1A 1ETZA 4DEUA 4Z3HA 1CB4A 2VDNL 5CAYB 5EEYA 3W37A 3TASA 3BMVA 1HHGA 3JTBA 3NRPA 4A2EA 5I23A 1Y1UA 1MWAA 2Y3NA 1S7QA 1FS2A 1Y18A 2XNAA 1IC1A 4YSRA 3KD4A 2DWEB 4JO4H 1FZKB 4ODXA 3L4XA 1R3HA 3E8UH 4GMSH 4ERSH 4JDEB 2F6AA 2XWTA 3ULAB 4EIBA 4X8XA 3VD5A 4GO8A 4ENEC 1IBBA 4FTVE 2ZCKL 3GLEA 2C4FU 5KVDL 4N90E 4A6YL 1SBSL 2OW6A 1ZT7A 3MRMB 3H9SD 1T3FB 4LLWB 4LCWB 3MNWB 1Z3GL 2QV4A 5ESQB 4P8SA 4OT1L 4K7PH 2V37A 1T89A 4LHQB 3QUZA 4Q4IA 2E74C 4XB8A 4ZUWB 4K7FB 2P8LB 4NX0A 5FYJL 3V6OA 5TQ0H 2AK4E 3GIVB 4BDVA 1I7RB 1VPOH 2P24A 3QRFM 1XXDC 3U79A 2PCPA 3QXVA 4U06A 4PWJA 1D5IH 1V05A 5IMOB 4GAJL 4R4ND 1RJLB 2IDCA 3VX0A 3EF4A 1NLBH 2BHUA 2CQVA 3T0ED 5ALBL 4N2DA 4PRPA 1EO5A 5DHEA 3VWJB 4AYEC 1OSZA 3C6LA 1UFUA 3VM7A 2ADFL 4YFDB 1QYYA 4YQXH 2WIIB 1PU0A 2X7LB 3QDGB 3LKSA 2Y07L 2E7MA 2BVQA 1V55B 1CD8A 5FCUH 3GTNA 5I1KL 3O3AB 4P4KD 2I25N 1ZKAA 4NO2B 4CMHB 4KY2A 4JFFA 4KOBA 3IJEB 3CFBA 4YR6B 1RLWA 5E5MA 5IEHA 5AOKA 1KBGL 3Q6GH 1MH5B 4AMKH 6TAAA 4L9LA 2IGLA 2A3TA 2X53A 5DJDB 1U8QA 3FPYA 2JKRM 2LABA 3EW3B 1CICB 4N8VB 4W9GC 1RV6X 5DMGC 5ENWA 4KT1A 1ODAA 1QSEE 5F3BB 4Z3IA 4LCCB 5GGTH 1CF8L 1IARB 3TZVA 1TJIH 5HDQL 3S5ZA 2WQ8A 2GJZB 4HEPG 2JIXA 4MN8B 3ZDWA 2BY2A 1T1XB 4MBRA 1OWWA 4N25A 1KIRB 4L1DA 3WTVA 4UF7C 3ASOB 4AZUA 4HKBB 1OOAA 3O11A 3QIBC 1JK8B 3ISRA 2X2JA 3E9UA 3CNKA 5EIIA 1CI3M 1J1XL 5KBDA 1Q0XL 1C08B 3KEHA 5T1DH 4OUOA 1JZ3A 5L8LB 1PKQE 3CBJB 2XTJE 2R4RL 3FW6A 2L7EA 1D6VH 4MX7A 3L54A 5F96H 5ESAB 1F6LL 2WYHA 1H3PH 3RDTA 1G9NH 4KKCC 4JFOA 5D1XA 2C3HA 5CS7A 3IDUA 2N7SA 2AS5M 4UIKL 5KSBA 1JF5A 2DJ4A 4JKLA 1OAKH 3SOBH 3DGGB 3BISA 5HDBF 4Z7NF 4EZGA 1JPTL 3O6KH 3W2DH 3FAWA 3CHOA 4PTUA 2E46A 3HAEB 2M83A 5C97A 5HDBE 1KPRB 3HEIB 3L9YA 5AB0A 1MF2H 3VD4A 3VQ1C 3K74B 3LCYA 4FZEH 1TU2B 4JX0A 4KNGA 3OR6B 4BKLB 2NLJA 3RQ3A 4B0MM 1W0VB 3QUYC 2D4FA 4YEEA 5DI8B 3FBQA 1OOWA 1G4MA 35C8H 3LXCA 5CIPH 4HW6A 2QZQA 3L3KA 2V0AA 1R3IH 2WLHA 4G8EA 3G7TA 5IVZA 4PRIE 5D70L 1IL1B 2B59B 3OXSB 1A21A 4YXLH 2VR9A 2FQDA 5INCB 2ZYIA 5EZPA 3P0YH 1XF1A 1TZIB 4QHPA 3TH4T 2M8XA 1XB6A 3FOLA 1J8HA 5CMAB 1IGCL 4HKJA 1A7QL 3LZFH 2PTVA 4UQ2A 5F7KC 3ZY7A 3PWJA 2BVPB 2Q8BL 5EU7C 3PGCB 4ZI8A 2PPCA 3VVWA 5BVPH 4KUCD 4FEMA 3MCYA 1UENA 4QCIB 3WFHB 2DJUA 3KYKL 3S7GA 5LLIC 3REWA 2W9DL 1TF4A 4TNWK 2APBA 4OZFH 1P8VA 1IAIL 3W39A 1WZ1L 3WL9B 3S3PA 1AO7A 1U41A 3ARBA 3TCLA 4YX2L 2VDQH 2JCWA 3SJVD 5IB5B 1HSBB 2QR0B 2VXUL 3QHZL 5T1LB 3QYMA 4L18A 5DQDH 2EDKA 5SWZD 3IJYA 1PX4A 3SE6A 4D0DA 1NBYA 2C3WA 3TT1L 3MLSL 1MHEB 3KJ4B 3RJ0A 2NY2C 1S5HB 1XCTA 3U7AA 2O5NA 4XC3H 2IBZX 4JN1H 4RIRB 3MKKA 3CZJA 1N6UA 2FX8H 4HFUL 2NR6A 4A2GA 4AI7A 3WTTA 3MJ9L 3OKLA 4NCC1 2D03H 5I1DB 1P53A 2AI0H 4LOUC 4IEFB 5D5MB 2KDGA 1JP5A 3QH3A 2Z1PA 4GKZA 5CLYA 1VEOA 4EZMA 1VIWA 3PUUA 2H6PA 3BWUF 3CUPA 2VDRH 4GIOA 4FABH 2OMYB 3O4OC 5IG7B 1SYVA 4JE0A 4PSPA 1IVLA 1FFOB 2NZ9C 4M8QA 3RPKA 4EAEA 5TDOA 5F1SA 4X6EB 1E2VA 5DD3L 4K5LA 4FA7B 3B6SA 1NGXA 5C0AD 2NY1B 4ABQA 4G42A 3RTQD 4QHLA 4F20A 4BH7B 2MQGA 3KWWA 5JHLA 4NI3A 1YEDB 2V7HB 1H19A 1OVZA 2BDNH 3EYVA 4JFPB 1OTTC 3G6JA 5JXEA 4J6RL 4WZ9A 4ZPVB 4MZ2A 1R24A 4UI2A 4WU7B 4X5XA 2E9WA 2P28B 4HCIA 4JFDD 4ZUVA 3VFMB 4Q9RL 2P1QB 2F53D 1EJOL 5K59F 1AP2B 2HG5A 3CDZB 3T0WA 4N8CH 5EUOB 1CGSH 2DLHA 4GKLA 4LLMA 1P6FA 5HSFA 3L9EA 1B0WA 4JG9A 3SPCA 1KJMB 2KZWA 1A8ZA 4D9LH 3HFFA 2OMWB 2VDKL 3JTSB 4K3EL 1QNZH 5HY9A 4YSQA 2J2ZB 3SQRA 5KN5B 4RBPK 5L9DH 4NUPA 3I02A 4YDIL 4F9LC 4Y2NA 5CLXA 3BZDA 4PI2A 4WTZA 5KYUA 3U1PA 3RI5F 4M5SA 4XNZB 1WAAA 5JR1L 1B6UA 4G3YH 2XKNA 5CP3A 4XP6H 1I8IA 4AQ8C 5KSUA 2IWFA 3L5IA 5FM5M 2DIJA 4Y5XA 1E27A 2EEAA 3CDGB 3FB5A 2ICES 3ET9F 1RUKL 3KH3A 2XBTA 3GUFA 4NC2B 3PXHA 4XPTH 1INQA 3LPOA 1E3ZA 4OB5H 1E5YA 5LHDA 1OWRM 3MR9B 4XHJD 3T2NH 3CHXA 3WNJA 3BVVA 3VXMB 4N2BA 4QRQB 2YAEA 2YRZA 1AQDB 3VSUA 2YD2A 2P5WB 1G7MA 4PLOB 5E24E 3WPEA 2CPUA 4CBZA 1S7VB 2D7TH 2HKFH 4NQCE 4RMWA 3GMMA 2ISDA 5HHVH 4IOSD 1X5IA 1SLWA 4NZRL 1F8TH 3X11B 3UMNA 3F04A 1YECL 1HESA 4OCNC 4X4XB 3UTSB 4M3KB 4WWPA 5BW7A 1HHIB 4L5FE 3LV3B 1V3KA 1FDLH 2WLIB 1LO0L 3EYFA 1BYOA 4IRJD 1KLFA 1LD9A 5FA4B 5HHMB 4XNDA 3C9NB 3K72B 2GSGA 5KYXB 4L3EB 1Q9LA 4XCNB 1X5FA 1QG3A 2VLJB 3PWVB 4JO3L 4OM0H 4S2SB 4M1DL 3TBBA 3G3AA 4P5RA 4N2OA 4AGMA 3BRDA 1OP4A 4RMRA 1FQVA 3QWQB 3WIIL 3IEAA 4NC1C 1YEKL 1B0GB 1E50A 1EO8H 1ZY9A 3TVMC 4EBQH 3SBWC 1LEKB 1P5VA 1HOEA 3CVCA 4RWYH 3WFEL 1OAZL 2W07B 2DM2A 1FN4B 4JKWA 4L4VE 4Z0BL 3WN4A 2XSKA 4PEQB 5DMIL 4PRNA 5DRZA 1S6NA 4QRRE 1JFHA 1MAMH 3DMMB 3H85A 2WXHA 2EVGA 2WTRA 4XBGA 2VH5L 3SKJL 4C4KO 5CEXB 3EFFA 3L17A 1FGNL 3OJAA 1XIWB 4Q3IA 4JZOB 4Z7QF 1C5DA 3QUMA 1KYDA 3ULUE 3U30B 3SO5A 1XGPB 3CN1A 4YH6A 3KLLA 4DZBA 3DTXB 5B38B 1QR1A 2YLHA 4TUUA 1N7ML 1P1VA 2CSPA 3GSNA 3O6FD 5EIVA 1VLXA 4MJIB 1AQ8A 2QLVB 1ZLVK 3PJLA 4N5UA 4JCWA 1BECA 1BF8A 2QGEA 1I31A 4X4ZA 1CVRA 3NA4A 3WDIA 5CJ5A 1L0XA 3RJOA 1S7RA 3D34A 3FO0H 3KPLA 4TSBH 1GGUA 1U4FA 3V8CA 1NFIA 5J89A 3EBAA 3O9WD 3W3MA 1YNLL 2YA0A 1D5BA 3C8KA 3QJVB 4NRZA 1HH9B 1QVOA 2HLAA 1INEH 4WHDA 5BZDA 4GY4A 3S4SG 2JJVA 4I5BB 4ZPTA 2Z64A 5C7XL 3VRIA 4H13C 4GG6A 3ALWA 1N0LB 3D18B 4HV8A 5GGRY 4OLWL 2BOCA 3L7FB 4TM9A 4R4NC 4RRPA 4H4NA 1QLEH 4QI3A 4NN7C 4I3RL 4TF4A 2E8YA 3WHE0 5AB2A 4Z6AT 2DQJH 4YSDA 2XACC 3BT2L 1R46A 1B6DA 1RUQL 3HG5A 3LHPL 5HGBB 3P4LA 1T4KB 5EBLB 2EDXA 4ZO6A 2BP3A 3ATDA 1HL5A 6CGTA 1W72A 4DP4X 1G1YA 2SODB 2LW3A 3FB8B 3QIWD 3F3HA 1WFUA 4L5FH 4P4KC 4RSYA 3U7YL 2HP4A 4ZFOL 4OCXL 1A6ZB 1I1RA 1MJUH 4OIFA 3T4YA 2QSQA 3TYFB 5IJVB 5CLZA 1K6QL 3LN4B 2ORBH 5F3HA 5C0EA 3OAYK 2OP4H 2GG1A 4HG4J 2ZYSA 3COOA 3JWNC 1Z9MA 2DM3A 1R9FA 4U0QB 4FI8A 1K8DA 3QFDB 4MB4A 4YSCA 1PX3A 3CU7A 2EUWA 4XPAH 5EF2A 2CHWA 4K3JH 2XYCA 4U6VL 3K6DA 4XCCL 4XN4A 2R51A 4JO1H 4KO6A 2HZHA 4PRHA 4PQXA 4H5SA 5HGAA 2VKXA 4Q8BA 4NKDB 3RFZC 4QRPE 1Q1PA 1HJCA 3QCTL 3U4KA 2OR7A 1IC4H 1HN1A 1ZD6A 3TVMB 1SDDA 1X4XA 5DA0B 5DS2A 1U2CA 3C2AL 3U6XS 2AEOA 1J0HA 4U7LA 5D1ZI 2YUXA 4N1EA 4O51A 3QXDA 4U2YA 2P1NB 5FFOA 3T4AB 1UKSA 2LTQC 3E0GA 3QORA 4X4YB 4OD3H 3O3UN 2XV3A 3CK0L 4HJGA 3Q9PA 2FD6L 3BGFC 3QYCA 4TSCH 4CAGA 1PZ2A 4DP8X 1P7HL 1WITA 1E9QA 2RBLA 1MJ7L 3GLDA 3RL2B 1DJSA 1G1KA 3N55A 4KFMA 4OLVH 1KXVC 2WP3O 1IGYA 5ABAA 3VFOB 5CZVL 1HQRB 5IW6A 5KBPA 2FHFA 1DQQB 4KHTH 2G60L 4YSEA 2PP8A 4Y16D 5F2FA 5T1JA 1VEPA 3EOAB 3VWKD 3TF4A 2ZOLB 4H8QA 4PUBL 5LAXB 1P4LB 4JKPL 4UM8A 3BKJH 4DP7X 3BESR 3H9SB 2VERN 4CVZA 2AQRA 2XKSA 4DEPB 1TIUA 3D12B 3TO2A 1JVLA 1YY8A 3CLFH 3P3RA 3KYOB 1KLUB 4TQIA 4W1TA 5DRXA 3GMRA 3DETD