4FD0A

Crystal structure of a putative cell surface protein (baccac_03700) from bacteroides caccae atcc 43185 at 2.07 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
391
structure length
391
Chain Sequence
SAENPAEPVGALLEDFSIEQLPAKTIYALGENIDLTGLNVTGKYDDGKQRPVKVTPEQISGFSSSAPVDKQEVTITIEGKQKSFSVQISPVRVENGVLTEVLKGHNEIILPNSVKSIPKAAFRGSQINKVVLNEGLQSIGDMAFFNSTVQEVVFPTTLEQLEENIFYYCRNLKKADLSRTKLTKLPASTFVYAGVEEVLLPATLKEIGAQAFLKTSQLKTIEIPENVRTIGLEAFRESGITTVKLPNGVTTIAQRAFYYCPELTEVTTYGTVINENPEAMIHPYCLEGCPKLTRFDISKSIRILGQGLLGGNRKVTQLTIPANVTQINFSAFNNTGIKEVMVEGITPPQVFEKVWYGFPDDITVIRVPAESVEKYKNANGWKDFTNKITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine rich hypothetical protein
publication title Crystal structure of a leucine rich hypothetical protein (BACCAC_03700) from Bacteroides caccae ATCC 43185 at 2.07 A resolution (CASP Target)
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 113
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07523 Big_3 Bacterial Ig-like domain (group 3)
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3630 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fd0A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fd0A02
1OTMA 3E6JA 5B0NA 4WYKA 1P8TA 4U09A 1M10B 4LI2A 4R5CA 4RCAB 3UL8A 3G3BA 3O53A 4C2AB 3RGXA 4L3AA 1XECA 4KT1A 1DCEA 1OGQA 1SQ0B 3RGZA 2V70A 1KOOA 4ARRA 1XCDA 4R58A 3BZ5A 2BNHA 3ZYIA 2UZYA 4R07A 1W8AA 1XEUA 4EZGA 4LSCA 3PMHG 4FCGA 4Q62A 3ZYNA 5AWCA 4FHOA 3WPCA 2IFGA 4PQ8A 5GQRK 4Z8GA 4TZHA 4CNMA 3E3ZA 5A5CA 2ASSB 3DZEA 4Y61B 4XGOA 2WQVA 2WFHA 4H09A 2ASTB 4KNGA 3OJAB 4M7EA 1G9UA 4CNCA 3RFJA 2Z82A 3C6NB 1DS9A 2Z64A 1GWBA 4PEQB 1U0ND 4HQ1A 4R09A 4KXFB 1OOKG 2JQDA 2Z7XB 4RCWA 5CMNA 5CMPA 2O6RA 2Z63A 5AWDA 1K5GC 1FQVA 4QC0A 3W3MA 4FD0A 4LSAA 4MN8B 5GMHA 4U08A 3G06A 1OTOA 3M19A 3RW6A 2XWTC 4LI1A 1YRGA 2OMXA 1WWLA 3C6PB 3VQ2A 4ARNA 3E4GA 3WPDA 5AWAA 3RJ0A 1A9NA 2A0ZA 3CVRA 4QXEA 3TSRE 3OGMB 4CILA 4MQWX 1JL5A 3ULAA 3WPGA 4L3FA 2P1QB 5D3IA 3OGLB 2Z62A 5IJCA 4PSJA 4Q3GA 3RIZA 4Z64C 3WPBA 1P8VA 3C6OB 4J0MA 4R08A 3UL9A 4V2CA 2RA8A 3ZYJA 4NKGA 3UL7A 1M9SA 1M0ZA 3FXIA 3E2JA 4R5DA 5IJDA 1A4YA 5LFNA 2BEXA 2P1MB 3RFSA 2Q4GW 3G3AA 4R6JA 4BSUA 3A79B 5B0TA 4V2DA 4Q3IA 5AZ5A 2OMYA 2Z7XA 3W3KA 4OQTA 3M18A 4R0AA 4BSSA 4U06A 2Z81A 1OZNA 4GLPA 1FO1A 4LSXA 1M9LA 5IJBA 4WP6A 4LXSA 4G8AA 1DFJI 4FDWA 3G39A 4CC4A 4M7EC 4R6AA 2Y5QA 2WQUA 3WN4A 4LSXC 3CIGA 2OMUA 1O6SA 4Z61C 4P8SA 4U7LA 3RFEA 1XWDC 1PGVA 5GS0A 1ZIWA 4CC4C 3ULVA 4P91A 2V9TB 3ZYOA 4LXRA 5GMFA 4Z79A 1O6TA 4BSRA 2OMVA 3CIYA 4B8CD 1IO0A 3RW7A 5HZLB 3W3JA 4YEBB 5B4PA 1O6VA 4V2EA 3WPIA 3KJ4A 4Z94G 3JB9j 3ULUA 4CP6A 1H6TA 2OMWA 1OTNA 4ECNA 3P72A 4J4LA 2P1NB 2Z66A 1P9AG 4R6GA 2Z65A 3OGKB 2OMZA 5GMGA 4QBZA 4AW4A 3WPHA 5FTTB 4FS7A 1H6UA 2UZXA 4ECOA 3OJAA 3W3NA 4PKIG 5GS2B 4IM6A 2P1OB 3SB4A 2CA6A 4I6JB 2XOTA 2WQXA 5IYXC 5HDHA 4AY9X 4UFRA 4XSQA 4BV4R 4GT6A 1Z7XW 2V9SA 2O6QA 1QYYA 3G04C 2ID5A 4RWTC 2P1PB 1FT8A 1LTXA 2FT3A 4XOSA 3VQ1A 2R9UA 1K5DC 2RR6A 4K17A 1FS2A 2ELLA 2WQWA 3REZA 2OMTA 2JE1A 4C2BB 3WPFA 2O6SA 3W3GA 1XKUA 3GOZA 3WPEA 4R6FA 3O6NA 4PERA 1D0BA 5AWBA 2JE0A 1KOHA 4NKHA 3UN9A 3W3LA 4FMZA
chains in the Genus database with same CATH superfamily
3E6JA 4L4TE 1WCQA 3GS0A 1S9YA 2O72A 1OZTG 4JM2F 3ZL4H 3RX7A 1C5CL 2OL3B 4JHBA 1DUZA 2DZEA 1D5IH 1OIOA 1CURA 4ZQKA 2GBAA 5LHDA 1M10B 1F4XH 1CDBA 4TUJA 43C9B 2V37A 3O53A 2BSED 1NL0L 2BMKA 3CGTA 4FJZA 4HIIB 4KDTC 5D1QB 3ISYA 1CDUA 2OV0A 2G0KA 1HKLH 3CFKB 2ITCA 5JXED 1A6WH 2C9SA 1E8ZA 4FFTA 2Q20A 3NN8A 1R3KA 4PJCF 4PTTB 4KO5A 5IFAH 1OP4A 5J0BA 5HHOD 4HKZB 5DJ6B 1CD9B 5C7ZA 1WCBA 1W16A 4CN1A 3SE9L 1SLVA 2Z65C 2B4CC 3CHRA 3FFDB 3VXRE 2QVFB 4HHGA 2HKAA 5A2LH 5D1ZI 1GSKA 3EGDB 4EI5D 3VYOA 2CIIA 2VJXA 4D9QE 4QF1B 2Q8BL 3FN0H 3L2LA 3QO0A 4QI3A 5AOKA 5HYQB 2AJZB 4MJID 4OZFG 3H42L 2VXVL 3TFKD 1DJIA 1CDCA 5GJSH 3ZYNA 1HEHC 3QXUA 4BKSC 3U0TB 1WGVA 4I3SL 3ATBA 2VLJB 4JDEA 1E65A 3UO1L 1EAPA 2W38A 1U95A 2ZUXA 3RNKA 4J1UB 3ZN6A 1U8JA 2G2RB 3C09C 1HHJB 5F70A 3ZTJG 3BDYH 2L7EA 1L7IL 4XPAH 5B1AB 1TVHB 1DFXA 3HLAB 3RPIB 3D2TA 4YC2B 3RFRA 2ROXA 4X9GA 3SJVB 4KTYA 5FECA 2WTRA 3GZOA 4CA4A 2W65B 3IPBA 4HUWB 3TJPA 5D6CB 2ASTB 2UY7A 2D9CA 2KC0A 4KNGA 2ERJC 1QD0A 3BN9C 3KYNB 1FNFA 4FXKB 1N67A 1DQVA 3SZKC 2BWDA 1CLOL 2ZXAA 5JW3H 3RWCA 1NEZB 1M2VA 4PGDB 4R26L 1PZ5A 1BXAA 1SLWA 2Z82A 4N90E 1RPUA 3KXFE 3GXDA 4ZMZA 5T5FA 3DSNA 4UCFA 1KLUB 2Y1YA 3TIDB 4NYLB 4P9HC 4PLKD 1DO6A 2O5YL 3L17A 1KIPA 3TO4A 5FDYA 2IANB 1QMUA 4W6XB 3FT0A 1BPVA 1DBKH 2VL5B 4X5PA 2R2HB 4RFOH 5E1AB 3TN0A 4HH9B 4XC1L 3QCTL 3LIZA 4KNTA 5F7DB 1T1ZB 1JNJA 3RTQB 3FH8A 4EKXA 2WIMA 1BECA 3WL9B 1OTOA 2W94A 1FAIH 1K3IA 3COOA 1QFWI 2O6FA 4IEFA 4MNQB 3W82A 4R5TA 1EMTL 1XGTB 3WDIA 3EYOA 2UY6A 1P5VA 1PCSA 3PXLA 5FO7B 3U4KA 5I0VA 1BW8A 1FZKA 4UTBA 4FERA 2BSDA 4APXA 4LCUA 1IAIL 1ULVA 3KYKH 3GXFA 2EDFA 1MF2H 5L4JA 1WWLA 2OQJB 1L3WA 2OCJA 1B6UA 5I8KH 4PJDE 1HCZA 2FX9H 4UT9L 3ASOB 5I0WA 5DK0A 5IK3A 1J5IA 3U30B 3I02A 1MJ7L 2P4AB 3A5VA 1RVFH 2FVNA 3FAWA 2VAAB 3L7FA 1HI6B 4OT1L 4Y5XC 2CUIA 2B59B 3G6JF 4XAWL 3WPDA 4JRFA 4XZ4A 5SWSD 5TD4A 2NY1D 4HDIB 1N6VA 4GO9A 3UTZB 3NABH 3NSFA 4ODXA 2APFA 1C12B 1RI8A 5ITBH 1LXMA 2CJ3A 3NK3A 1VA9A 3EDEA 3RWFB 2AJSL 1A7BA 4Y4KC 3W2DL 4U1KB 2VGLM 3RUGA 4B6ZA 4XT1C 5CEZL 1CBVH 1FYHB 4RZKA 3RVUC 4DN4L 3VD5A 1G87A 2CZNA 1AFVL 1E5YA 3D5OF 2EYTB 5HVWA 3CH8A 4OFYA 2CBOA 5GRXG 5ADPH 2IDCA 1OAKH 2AI0H 4M7JL 1QI4A 1KTJA 2GJJA 4GIOA 4P4KA 3WGVB 1NCOA 4L4TB 4F37K 3V4VH 1QBLL 4FL4C 2I26N 1P7QB 1JOIA 3ZYJA 1AVAA 2IV8A 1AYRA 3LEVL 4U3XA 1ORSB 4HUMB 2GBVA 3II1A 4MJHA 3TEXA 1VFUA 2J5WA 2CLZA 4ZSOA 2BP8B 5EZPA 2XKNB 3X13B 3EFDL 4R83A 4WFFD 3DX2A 1AOHA 5E24E 4RZCB 1V7MH 5EFIB 5EOTB 5I6LA 4U2YA 3U25A 4B5EA 2GQHA 1BBJA 1MREL 1P2CA 2VUYA 4LNRA 3VXRB 5EG6C 3TURA 3QJSB 5FGRA 4YSAA 3O41A 2VE6B 1NJ9A 2ZYIA 3SGDH 1Q94A 3QHZH 5E4AA 3UC0H 5K9OB 4V2DA 2L8AA 2VSCA 1Z9LA 3KR3L 3NDYE 4HHAA 1K6QH 4MD0B 1ZV5A 4RFEA 4FQQB 4XCNB 2NXZD 2Y1ZA 1YEHL 2A9BA 3M18A 2YD8A 2QBWA 1J11A 2RCSH 4GLRH 1D2PA 4P2OD 3JWDH 3QZLA 4MMZA 1U8CB 2E9IA 3MODL 1UXMA 4HCRA 1OSPL 5IJVA 2VABA 5E23A 5F96L 4JG1L 3D39A 4KQ4H 1PG7X 4PJBF 2XN9D 4XRCA 3TLRA 3VXNB 4P5SA 1DFJI 4G1MB 1MH5B 2HH0H 3LZFL 4JY6B 1B0RA 5F9OH 4PHXA 2VDRB 1NPUA 1NZRA 2ATKA 2E76C 4QT5B 2IH3B 1PX4A 3KYMB 2ISDA 4APQB 4ZFOA 4KK9D 2FUQA 3DJRA 2V5TA 1BX2A 1XFPA 5E5RB 2NOYA 3NJIA 1T4KA 3KPSD 4GP4B 4G6AD 1BPLB 1NAMA 4QRAA 1FYTA 1IILE 4RGND 5AUMA 3D34A 4F58L 1UTDA 2CHZA 2ZCLH 3CLFL 3KXFB 4EBQH 5H2BA 2H32B 1OZUA 3QWOB 4TYUA 2ESVA 3AREB 2ZG1A 1DQDH 3NIGE 4GQZA 3HKZA 3GZPA 4HJGB 2V8LA 2B5IB 3V0IA 2P8MB 1EGJL 4GQPH 3BIKB 2LW3A 3NCMA 5C0GA 1CXKA 5E1GA 3JV4A 4OUUA 1N7ML 4G7SB 1VGEL 1AP2A 4G80A 3WNIA 1HXMA 4MS6A 2CR6A 3L3OB 4YBQD 1MEXH 4ZYKA 4L0YA 1FJ1B 1OQXA 4G8GA 3FT1A 4JCLA 1DLHB 3IDYB 1XGQA 1JHLL 1YSOA 3ARFC 3LY6A 4HKJA 4UILL 1YNKL 2HT2C 1K8DB 3L08A 1NGWA 4LF3B 5B38G 1G9NC 4HXBH 1ZOXA 3SCMB 2H0FA 2NUTA 5AAMA 3D85D 4TVUA 2FATL 5LJYH 5E08L 1EAJA 1UGKA 2WMPB 1I1AA 3S7GA 2NY0B 4P05A 2EXWC 1PZCA 4XVTH 2F58L 4U7KA 2WSPA 3GHBL 3IMUA 1DFBL 5KJRL 1UKSA 4AG4L 4BRJA 3EW3B 1CGYA 1X5LA 2HJKA 4FI7A 1B2YA 1I85C 1BQKA 1CD1A 2BNUA 3BAJA 2WO2B 4PJDB 3SDDD 1HSBB 4FFZL 4JVPA 2X05A 1WSST 1JGEB 2OYPA 4UM8B 4M6ML 3RUGE 3M88A 1WZKA 2PPCA 3JXAA 3NT0A 4H20H 3GSVB 1K5NB 4YHPA 5FGSA 4AIXA 1TLKA 3GBDA 2DPKA 5CSZA 2Z65A 2EH7H 4LSPL 4NS0A 2Y5TB 5GXBB 2VXTL 3VWKD 4I8DA 4JZNA 3SE3A 3FTYA 2WV3A 1S9YB 5DMIH 1EJFA 3ABZA 2FHFA 4YHML 4OV6F 2O6PA 1A6VL 2YKLL 2DL2A 4U1GB 4ZSOE 3QCVH 3Q01A 2BMKB 4I18A 4G72B 4QPEA 3UPCA 2ITCB 4W9GC 3D0AA 1PKQE 2M26A 4L23A 3VAEA 4FADA 3INUH 2P1OB 3NN8B 1R3KB 4HU2A 5I73B 5DFVD 3HG1D 5HYJD 1FL3A 4Q6IA 5DK2A 5DSCA 5CD5D 5JHLH 1A64A 5AYUL 5D93B 4LOVA 2Y3NA 4QTIL 3HR5B 3J8F7 3PABA 1SOSA 4QIRA 3KWTA 3RL1A 4XMKL 3UYOD 2A9NH 5IYXC 4LOEA 2CIIB 2YK1H 2Z7ZA 3GXNA 3T6VA 5C07A 3NQKA 3LVTA 2WCGA 5EIIA 4OCYH 2X1WL 2BOCA 3P0VL 3QUML 1BAFH 3S35X 1WICA 4G9FA 2JVUA 1U41A 4ICXA 4ONOA 4PB0L 1RKRA 1DN0B 5C0RL 3T65A 2H47C 1T5KA 1X4ZA 1YNLL 4JDEB 4AKOA 3Q43A 1EAPB 2E59A 1NBQA 2ZUTA 3T4AC 5LGHL 1U95B 2P1PB 4RWTC 3JWNE 3RNKB 2APTA 2VNCA 3D39E 1U8JB 1TJMA 1LO2H 2VR8A 4Y4FA 3GSWA 3Q2NA 4WI0A 5TE7L 1XR9A 1GW0A 1LWJA 4CMMB 5GZOD 5FECB 2WTRB 5BZZA 3H9SA 3CH1A 1DLFH 4PYGA 1AAJA 1BDYA 4LESA 2X1XR 3T2PA 2UY7B 1B4JH 3KLKA 3TGXA 3UBXG 4YSCA 4OGYH 3F6JA 4KZEL 5DEZA 3MUGA 4YFEA 4PMFA 2FIRT 3O6MH 3RWCB 1M2VB 2YA1A 5KVMC 1PZ5B 4Z95H 2WZ6A 4X80L 1A7RH 3QIWD 2Y24A 3A67L 2CRZA 2ESVE 2LVCA 3DSNB 1QKZL 2BVYA 3P4OA 2G60L 2Q7YA 3GB7A 4AK1A 3W3GA 4HJJL 3VXMA 1F3JA 4M5YH 1KIPB 1MFBH 4OCLC 3TO4B 1JE6A 1DQJA 1MRDH 3QR2A 1JGDB 3A0OA 4Y5XA 4NKIH 1B88A 2GFBB 5B39A 4UTAL 4FNQA 3SQOH 3TN0B 2EADA 4M8VA 2XRAL 3FQ4A 1BVKA 1IQWH 1N19A 4I3RL 3NIGB 1U6AH 5J57B 2N1TE 5JXAL 4FFYA 4IDJH 2Z1KA 1N3NA 5L8KB 4KKPA 4IEFB 1ZJBA 4TF4A 4CN6A 5A2CA 5JIPA 3EKCA 1OKEA 2CO6A 3DA0A 4ZO9A 1WFNA 2GABA 2WVUA 2UY6B 1P5VB 2X4RA 3EYOB 1FZKB 5EOCJ 4LCUB 1AJ7L 5IW6A 1QFOA 4GW4A 2ED9A 3L13A 5C2BH 1IV8A 1H9VA 5C09D 2JSFA 3CN3A 5DS1A 5DK0B 3EZ8A 1DJGA 2CRYA 1X5YA 2PXYB 3AXHA 3BQUC 3GWJA 5IK3B 3I02B 1MFAL 1KBKA 3F5WA 4U09A 3L7FB 4EDWL 4F9LA 4GXFA 2AQTA 3KHQA 2UYLA 1SOKA 3CCHA 1ZLUK 4WSKA 5GS3A 3FHAA 5B3JF 4PS4L 4H13C 4NKQB 2COVD 3MXVH 2OM5A 3QUYA 3WS6A 4BGDA 5IB1A 2VZ3A 2CIKB 4I9WE 4P9HL 2PCXA 2FBJL 3RUGB 5IT2L 2VTFA 3RA7L 3VVVA 4ZFGL 2ZOWA 3CBRA 4HK3N 5F3BA 5AW5B 5ID1A 2JQZA 2PWEA 3EOYG 4R07A 1QLEL 5AAPA 1YPZA 1UATA 1FORH 4NN7B 1L0XA 1CJYA 1MWAA 5FR3A 3ZLQC 2DWEA 4LASH 1G43A 1OCZB 3ARDA 3ROOB 4WW2F 4L18A 3QEQD 1F6FB 1M3IA 4M8QA 2RD0A 2JF1A 4LIQH 2P5EA 1T1YA 2R69A 2VZ1A 3KBFA 1INEL 3V0JA 4U3HA 2C4FT 4FHKA 3CIAA 3FYIB 5C07E 3KE0A 3NCFB 2CLZB 4TNEA 4ZSOB 2D3NA 5DO8A 2WQVA 5FHAH 3A6CH 2EXSA 3MOBH 2M1KA 3HTLX 3E2HB 4N0CD 2IPKA 2D4DA 3CFIC 3AVEA 5IHLB 1JZDC 2CXKA 3GDBA 4WTZA 3HFMH 1BBJB 1F8TL 1JMXA 1AH1A 1PTZA 3M1OA 5HY9B 4LNRB 4BINA 3O0RH 1AXSA 2DMCA 1U21A 3UZVA 5ABAA 4ZZFA 1KFAH 4NQUA 2ICWB 4OQTH 5F7LB 3KPPA 3O41B 1KEMH 5CEZD 1IIIA 1GWBA 1Q94B 1DVQA 3K6SB 2MSPA 4HHAB 1TQWA 5E70A 3QRGL 2CHDA 5DFAA 5EZOL 1KCLA 1A7QH 4RFEB 4A7GF 3H9SE 1G9HA 2YD3A 3AQXA 4NZDA 2A0LD 4M02A 1QVOA 4K3HA 2UX6A 4MMZB 4NIYE 3OSVA 3QRBA 4PJFA 5ISZA 4AVHA 4PRID 4RDQF 5IJVB 2VABB 2RIKA 3D39B 4N26A 4BZ2L 1IC1A 4XRCB 2VUKA 3P9WB 1KBWA 1B0RB 3H4HA 3HNSH 3PRZA 1WZ1L 4C4KT 2ATKB 3D52A 3WTWA 2HFEA 1KV3A 4WIQA 3P11H 3G06A 5ADOH 3ARFA 4RDQG 2VSDA 4PRAA 2AJVH 3VD3A 3VXME 4HC1A 1BX2B 4LVHB 5CJXC 4XTRD 5AG9A 1S7UA 1T4KB 2H3KA 5I9QC 3QWRD 1NAMB 2WWKO 4OF0A 2VOTA 1NTDA 1F42A 1ANUA 3E1F1 2VR4A 3CLWA 4FQIH 5H2BB 3U7WH 1NSNH 3AT0A 3CSBA 2ESVB 3NJMA 5KW9H 1BIHA 1UT9A 4AQ1B 5E2TH 1IAII 1A47A 4ZMPA 3VQMA 3GMMA 2BY0A 3Q2CA 2P80A 3A24A 1A3LH 5C0GB 4RCAA 2O93L 1TR7A 3JV4B 4OUUB 1QASA 1AP2B 1O75A 3QFJE 4G80B 4N2GA 5H37H 1HXMB 3NACL 1OP3H 4QHUA 4ZYKB 2EC9U 2R0ZL 1QPKA 1N5YL 4FYSA 2IIJA 4G8GB 4QTHA 4LSQL 4BZ1L 5I6KA 3OPZL 3GPSA 4HLZG 5IGXH 2GEQA 4L3EA 5EMYA 2NLJA 3BUYA 3QUZD 1EO7A 1XGQB 1F2QA 3F83A 4HKJB 1HNYA 1OP5H 1GSMA 3ULAA 1NGWB 2NY3B 2NUTB 3X1GA 3UTTA 4HVBA 5BPPA 5DQJA 1CLZL 1I1AB 3H2WA 1UD3A 1IVTA 2W07A 4UV7H 1RERA 3VFTA 1NCDL 2FRGP 4X9FA 1N18A 2P8LA 4Y1TA 4P49A 2AQRA 2HJKB 5KOVC 4DKAA 2F1EA 4ODVL 1DR9A 3GHEH 3ARRA 1CD1B 1L6ZA 2BNUB 2FLBT 2XVBA 2MQCA 3PHSA 5D7LE 1YJDC 2BHUA 1EHLH 1T1XA 2ICES 2X70A 4LMQE 4A2GA 4YHPB 4AL8L 4GW5B 4YGVA 2AITA 1YPZE 5CSZB 3QWNA 4HMCA 2A38A 5DQDH 3PAZA 1E90A 1JK9A 1QI3A 3MRGA 2B20A 1E2VA 3CLEL 1I1FA 5LN4A 4H8WL 4JZNB 1TJGL 2VKWA 3FMGH 2P5EE 3U6XA 1XCWA 1JPST 5DVLA 2B2XL 5DD3L 2LLLA 3RFSA 1BBDL 5EO9A 2Q4GW 4X5QA 5D8JH 5TH2A 2SEBA 4M1CC 4O51A 1AS8A 4NO0D 2HLAA 1PJWA 5A2FA 3STLA 4KQ3L 3NJGA 5DFWH 1WK0A 4EUPA 3T04D 1CQKA 3W3KA 5DJAB 5AG8A 4RGOL 3AACA 3LKRA 1W0YT 2N7SA 4PSRA 5F97E 5C0IA 5L6YH 1G9NL 1FL3B 1F4YH 3N44F 1O0VA 4Q6IB 5DK2B 2PO6A 1Q72H 5DSCB 5J89A 1SZNA 4TLSA 3PABB 4BBWA 2Y3AA 2ERJB 4X6FA 3RL1B 1TITA 4K4KA 4DFIA 1OCOB 4FNUA 5C07B 3R8BB 1EEUA 4J39A 5SV3A 4J3WA 5EIIB 1NGQL 4CC4A 4NERA 2BOCB 2GCYA 3BKJL 2PWFA 3KCWA 1CR9H 2NXYC 3T65B 4YDJA 4TLUA 4JKNA 5J13C 3MLSL 4QRPA 3RWGA 1UKTA 3KD4A 4H40A 4XXDA 5C7XL 3CJJA 4HGMA 4PJFE 5ISZE 1QHOA 5G2NA 2EEAA 2ZX7A 3TBVB 2GBTA 1ZA3A 1IZJA 4K7PL 1T2JA 2BHFA 3G9AB 2F74A 4Y4FB 4F2FA 3GSWB 1U2YA 4JM2D 4WI0B 1AXTH 1G6RA 1XR9B 3ULVA 3NSJA 3H9SB 4MA7L 3CH1B 4F7CA 2PYFA 4FKEA 4N0YL 1OD9A 4K94C 4PREA 3KW7A 4X4MA 5HJBA 2E74C 3DOSA 4AMWA 2QTEA 1E5ZA 3ARSA 3K2KA 3POCA 2JKIS 3MUGB 3KLHC 3AG3B 4JO8A 3O6LH 1E4KA 1FO0A 1C1EH 2I60L 3QG7H 2ATPA 4FGMA 2NRDA 1KCKA 2BINA 2JLLA 4YPGB 5L7XL 4KU1A 2Z6FA 1UYWH 4PB9L 3VWJC 3RNQA 2FJFA 3P4OB 1KPRA 3MV7D 2Q7YB 2IGLA 3GB7B 5HYSG 3GLEA 1U3HC 1FIEA 2XIIA 5K9JH 2EVFA 3VXMB 3RX5A 1I3VA 4NZUL 4AYID 1DQJB 4P3CH 1IVLA 2I5YH 4Y5XB 4MJIA 1MFDL 4LSSH 4WNSA 5FUZL 4B9FA 5B39B 4L3EE 2EVIA 2ZCHH 4IRJA 2GJ6D 1ZHLA 3CDZB 3NJHA 2QGEA 1LQSR 2VYRE 3VGBA 4XP6L 1RQ5A 4CGTA 3UTTE 5EIVA 2QVTA 2E7LA 2XA8L 1N3NB 2APSA 5AW6B 4PRDA 4R6GA 2PR4H 2OPCA 4Y4KB 2CO6B 4R3SA 4Q58C 3JVGA 2X4RB 3TVMD 4JREC 5IW6B 2ICWI 4UWQB 5JIDA 2FUTA 4GW4B 4E9TA 5KVEL 4JHWL 3QDMD 4Z3FA 1J1PL 4KO9A 4FS7A 3HS9A 3Q8CA 4Y5VC 2X9YA 3VFUA 1AI1L 2QHLA 3BZDA 1TEYA 5IOKA 3RGVC 1TZGH 3MTXA 4PJ5A 3F5WB 1PFOA 4PCTA 1Q9KA 4BCXA 4QDGA 3QRLA 3MX0A 4TSCL 4PJXF 5FO8A 3ESNA 1HQ4B 3CCHB 2CG9X 3M07A 2YR3A 2X2JA 3CZGA 4I5BA 3SB4A 5E1QA 1MI5E 4GQ9H 2GY7B 3HBQA 3QUYB 2DQHL 3OKEA 3IWUA 4IHBA 5D7LB 3TBSA 3U48A 5IB1B 1GGYA 2TAAA 4YDMA 4L1SA 3U4AA 2WUBH 3UJIH 4JFXA 4BFBD 5F3BB 1OT2A 3E0GA 1DO5A 1YPZB 4YE4H 3S8WA 2RTTA 1NCJA 2Y5EA 4DKFH 1ITBB 4IQHA 1WO2A 5KS9A 1MWAB 3UMTA 2DWEB 1PF3A 3FBKA 4OLXH 2WLHA 4Z7VE 5CZVH 1C8QA 3ARDB 1SMOA 3B2XA 4YSQA 5KVEE 3D3VD 2BY3A 1A8ZA 4FNLL 4M8QB 1TTUA 3CPLA 4ABWA 2P5EB 3QFGA 1T1YB 2QGCA 1WIOA 4Q8BA 1J0IA 4X98A 2DMGA 3DWTA 3V79C 3FFCE 3M17A 1GIGL 1P53A 5CEYB 4TVPD 4ONGH 4R90L 1AR1D 4ATTA 2H1PH 2SODB 4GKSA 4KRPB 3DDGA 4DJMA 3EJUA 3DNKA 3QP3A 3F05A 1UZ8A 4XP1H 5ITFB 2QDVA 1INDH 2V3DA 4OLZH 4Y16A 2IPKB 5EBMA 1C7SA 2Q9OA 3LD8B 5SWZA 4D7PA 1ZEAL 4QRPE 1L9NA 1S78D 5HVGB 4R4FL 3VW3H 3FU9A 4WUUA 4JANA 2DI9A 1AXSB 3V55A 1WYJA 1I82A 1AXIB 2DQJH 3MYJA 5FHBL 3L9BA 1U36A 3S5ZA 3KPPB 1RULL 1E43A 4NCC1 3ULVE 2BH0A 3QJQB 1WBYA 3GQFA 5E03A 2O6SA 3KS0H 3M86A 1I1RA 1WBXA 2WVVA 1QVOB 5GS0C 4NOBA 4PJFB 5ALBL 5ISZB 4JFSA 2R29L 4EZKA 3HHSA 3O6NA 3DHMA 2Y1VA 4AZUA 4NENA 1OAXH 2JI1A 2DICA 2R39A 2O6CA 2HFEB 3VFVA 8CGTA 3ARFB 4HFWA 4PRAB 5T1KA 3VXUD 4XPTL 5CSBA 2KHAA 1S7UB 3V7AE 3I9GH 3JYBA 1W72H 2AJYL 5IB3A 2G2NA 3PWNA 4URTB 4TNFA 3K81A 1OTMA 3LS4L 5K39A 1PU0A 5D96C 3BZEB 2XY2A 3V10A 2HG0A 1J87A 4GBXC 1GY1A 3N04A 2C9UA 1UACH 2P44B 2VZSA 5AENA 3GMMB 2A77H 3WSQH 1JZ8A 5GRUL 1ZLDA 1NGZA 5AVUB 4RCAB 1RUML 2R0KL 2DN7A 3RGXA 5LDUA 3ZT5A 1V10A 1EO8H 1CPUA 1EAQA 3QEGH 2CK0H 2DW5A 1FDLL 3L81A 3EOTL 4QTHB 3PL6D 4L3EB 3M8OH 2CKBA 4ARRA 3NGBC 3BUYB 5IIEA 5FYKH 4FE9A 1Y18A 3ULAB 3ZYIA 1OGPA 2ICEA 4DPCX 4LAQH 4XXCA 3UTTB 1MHEA 2UZYA 2CDEA 3OZ9H 4PJ5E 2I69A 1PMYA 5DQJB 3WLWD 4ESKA 1EJ6A 2YWYA 2W07B 2XN9A 4R84A 2E7BA 3VFTB 3BPNC 2E27L 3DHPA 1OSYA 2B9BA 2P8LB 4KXAA 4P23C 2ZXBA 2CHWA 5AFAA 4Q62A 1L9RA 4TNWF 5IHWA 3QJVB 1VPOH 2PYED 4K9EC 4KZDH 2CGRL 3VI4A 1T1XB 2V2TA 4KFZC 3KPSA 5T33H 1UOWA 1KY6A 3MJ7A 3BD3A 3VD4A 3O6FC 1RZKH 1YMHA 4YGVB 3DZEA 1OTTC 3MRBA 5I19L 4JM0A 4M4PA 1KELL 2YMOA 3WFDH 1JK9B 1SJEA 3B4NA 3MRGB 4N8VA 3WHXB 1GS6X 5IBTL 5I15H 1I1FB 4B53A 2OZNA 3LEYH 4PY7A 3O4OB 2MKLC 4NHCH 1JCKA 5E9NA 4CNCA 3APMA 2I7OA 5EO9B 5E99L 5ERWA 5TH2B 2SEBB 4FRWA 4O51B 3FUNA 4XVUC 2F54A 4N6RA 4PM1A 2XV6B 2HLAB 3STLB 3CVHH 3EG9A 4G7YL 3B7SA 4GPVA 4ODBD 5KBMA 4CAGA 3S9DB 4NWUL 5DC9B 4EUPB 1L6XA 1OOKG 4GUCA 3KPRE 4Z7VB 5IFHL 3D85A 3LKRB 5DD0L 5SWZE 4TPRL 1QQDA 5C0IB 1MXGA 1OTSD 3U2IA 2PO6B 1WAAA 1IRAY 4WUUE 4W9HC 3CG8A 5FPIA 1HVXA 4X6FB 3HOGA 2WXLA 2CJUL 5TDPA 4CSPA 4GXUM 2P49B 2Y23A 2YXWA 4NQXA 4MN8B 4BFOA 1MY7A 2GCYB 1KPVA 2DQDH 3OM3B 5CNHA 4F57H 3EHBD 5I71B 1J5HA 4PGEA 4PJHA 3NVQA 5GS1C 1B4RA 1L0QA 4YDJB 3O3BB 4OGXL 4YHYC 4QRPB 1FGVH 3RWGB 3VWJA 5IM7B 4XXDB 3CU7A 4C56D 4OB5H 1J0KA 2OMXA 3O6KH 1MCWM 5KVGL 3HN5A 2AS5M 1ZA3B 1B2WL 4N2FA 4ENED 2DJ4A 4RVBA 2X6UA 5LCVA 2F74B 2ZX9A 5CZKA 5E2UH 1G6RB 1YEJL 2WLMA 2XFGB 2WGXA 4I77L 2HLEB 4YR6A 2YRBA 2EDBA 4QNPF 1NCBH 4F7CB 2PYFB 3O2VH 2BIHA 4PREB 3P3SA 3LRSA 2HA1A 2J88L 2UVEA 3DOSB 2AHIA 2F5AL 3BUPA 1BF5A 3BLBA 4R97C 1KN4H 1P84K 3VE0B 3BO8B 3AM8C 5TQ2L 1ZHBA 4YL9A 2IG2L 2XZQL 3HRZA 4I7ZC 3UDWC 2J6EA 3AWFA 1FO0B 3HMXA 2ATPB 1CICA 1RCYA 3VQ2C 2ZWLT 3HG1A 2I85A 5C6PB 4OZIF 2B16A 3RNQB 2FJFB 4OGAD 4TQEL 1KPRB 1QW9A 1OANA 3FU6A 3MUJA 4GEJA 2Z62A 2HKFH 2XIBA 4FCAA 1T80A 3BQUB 4PRNA 4Y5VA 3RFZC 2KLTA 4G6FD 1WC7A 4RBPK 4LCYA 2JH2A 1XB3A 3RY4A 4HQQL 3S37L 1DCLA 4IRJB 1CBJA 5JOFA 2G3XA 2GK2A 1ZXQA 1MLBB 4LRNH 5DD1L 4F3FA 3AFLA 1H8NA 4L3CA 4GEIA 1ZT7A 3HE7C 4PRDB 2E9BA 5E8OB 1NGPH 1HL5A 2XN9E 2P28B 3EJRA 3FUEA 3HAEG 3NRQA 3T77A 3H3BC 3HNTH 2VIRA 1ICTA 2X4PA 4DCQA 4R5DA 5GZOA 5ACLA 5L2KD 1A4YA 3H7LA 5BMFL 3RB5A 5J1AA 3ETBJ 4AGNA 2P24A 3KPSE 3L45A 3MGTA 3VFUB 4LSUL 4KXZH 4K94L 5DEFA 4PJ5B 3WIAA 1Q9KB 2Z93A 3HS0A 2FX7L 3MX0B 3P2BA 3QIWA 5FO8B 1W8NA 2D3VA 1ZT1A 4KJQD 3O11A 1JGLL 4HOXA 3DLQR 2OW6A 3QZOA 4I5BB 4ADIA 4M9PA 3OKEB 3TBSB 1DSFL 4YDKH 1B0WA 3GJFH 3RIFK 1G1YA 5HDOA 2DMKA 2O5XH 1DQQA 1T89C 4S1SL 3HC0A 4GT0A 3HI6L 1SXNA 3TYFA 2F54E 2Z1PA 4JFXB 4TTGA 1IE5A 2J57A 4BWTA 4X6DA 1I9JL 1SXZA 2OZ4H 2R2BA 4WFGE 5AKTA 4GS7C 3TCLB 1QWNA 4X0NA 1KXTA 1NCCH 2FD6H 4ZOBA 4XWGL 1L9SA 4B9PA 1DDHB 1B0IA 1BXVA 3CPLB 3QG6A 4FG2A 3WD5L 2DQUL 1VCAA 1I9IH 3IMTA 1WAAE 4OCWH 4S0TD 2ADFL 4X98B 2HRPH 3OXSA 3E9UA 2HTLD 4HBCL 4KJWC 1RP8A 3M17B 3PV7A 5GS0A 1JXDA 1ZIWA 4GKSB 4MA3A 3U9PH 1CFTB 4C4KO 1UZ8B 4M1GH 1J1XL 1MCBA 3ZYOA 5JIIA 2VDOH 4P57A 2MRYA 1HCYA 3LZNA 4PJHE 5F93C 2FO4A 4Y16B 5EBMB 3UH8A 1U8IA 5SWZB 1KTLB 4P06A 3ZHNA 1IJNA 1Q9LA 4GOSA 3UBXI 4MVBC 3VUAA 1PLCA 1AIZA 3IJYA 4POZC 3EOAA 3ZKMD 4BUGA 3D33A 4WUUB 1IO0A 2EE6A 1T5WA 3MYJB 4XOEA 5I9QB 3W3JA 1NMCC 3JT2A 1M6OA 3TF4A 1PD6A 3FPXA 3CV5A 1WBYB 4JJ5A 4V2EA 4PWHA 5KYXA 1P0SE 5F6HJ 4KJPC 2FBOJ 3NCWA 1J5DA 1WBXB 2AXWA 2WVVB 1BREA 3WN6A 3MJ8A 2JTYA 2J44A 4MMYA 1G5GA 4JO3L 3HHSB 4KMTH 1VZIA 2EKJA 2EECA 5FYJL 4WY7H 1G7LA 1EBAA 1KDJA 3IDMA 4NENB 1Q90A 4XO4A 3CVIH 1JZ2A 2QV4A 1MIEH 3BWZA 4P48A 3EH2A 3VFVB 4TNVF 4CBZA 3ZDXE 2MCPL 2J8OA 3RKDC 4HFWB 4IRSD 5T1KB 3CFNA 5FUOL 3ELQA 4N1CA 5E2WH 5SX5H 3RVTD 1YEGH 3GTVA 1FAKT 2OR7A 5J6SA 3K72A 1BZ8A 5EDXA 3PWNB 5CJ8A 5K39B 4IYKA 1E3ZA 2OXHB 1DEEA 3O2DH 3HZVA 1EPFA 1JTPA 5TE6H 4B9ZA 1IEAA 2GJPA 2M8XA 3DVNA 3RWJA 5GS2H 2O1AA 2X0VA 3GLDA 4GH7B 3SGJA 4A2HA 4FQXD 2QT6A 3VYNA 3V52L 1NGZB 2YMXL 3T2QA 3KPNA 4X9BA 1DBML 1BEXA 2AQ3A 4E9XA 5I1CH 5J8OA 3IDXL 2NY5C 1D6VL 3NJNA 3BGFC 3DC0A 1HYSC 2VC2B 3L4CA 5CJ5A 2CKBB 1UH2A 2HN7A 5IIEB 3MLYL 4E5XB 1KB5L 2XOTA 1Y18B 4XZUA 1EEQA 3DGDA 4JW3A 3MV11 4FTVA 3NBNA 15C8L 4Q4EA 1MHEB 2UZYB 2CDEB 3KLLA 5CN3A 1I7TA 5F2FA 2WKGA 3QHFH 2XN9B 3HG3A 1JNLL 1G7MA 1OAZL 3IFPA 4HETA 4KY2A 4NUGH 5ES4B 3GIZH 3CXFA 2XVKA 5E8DL 1TTCA 3BRGC 3L1GA 2WXQA 5GGTL 3DHUA 1ZRUA 4UOW0 2W95A 3N55A 4NNPL 1XCTA 3QDGA 4PWIA 3VI4B 1RURL 2V2TB 3PWVA 1ONQB 3WE6A 3KPSB 4MCZA 5I1IL 1UQSA 3HC4L 3U46A 3MJ7B 4NJ9H 3QDJD 4FYRA 1BCIA 3V4PA 1YMHB 3S88H 2CLRA 3MRBB 1K5DC 4XMZA 3IFNL 4Z3IA 5AOJA 4WUKL 4JKLA 1OD7A 1SJEB 5JQIB 5KOMC 4F91B 4IMKC 2UVFA 3BGMA 2GK0A 1GJUA 1FZOA 3RVVC 3ALXA 2CSPA 4MD5A 2UZPA 4HUNB 3PUUA 4Q0XH 2NXYB 5AKVA 1GJIA 4LL1A 1PLAA 1JRHL 5J13B 3LHPL 3DTUB 5KVDL 2F54B 1QBML 2CKNA 2G5UA 3GI9H 3QUZA 4PJAF 3EG9B 2Q3AA 4B0MB 4GUOA 3U79A 1FZJA 3D85B 1GHFH 4ZBJA 5IV2A 5C1MB 4MJ2A 1P6WA 4JO2L 1S9VA 4UMGA 3T4YA 5C9KA 1R33A 5DHYB 2BZ7A 1BQLH 2ZJSH 2WZ5A 1TTAA 1MNUH 1N64L 4ZPTA 4F2MA 1IGIL 4O02H 5LG6A 1HIML 1R46A 1D0BA 2MJWA 1Z6JT 4H1LA 3AM8A 5PAZA 4NQXB 3LPFA 3ZDZE 1H3WM 2FX8H 2VRKA 4JZOA 1KPVB 3U2SB 3IJSA 4YH6A 5F7FA 4PGEB 2J71A 4C47A 1FFRA 2D9QB 3DK2A 4PJHB 4OAWA 3NCJH 4P5KA 5KBLA 2NZ9D 4WZ9A 1NIBA 3FT9A 1KV7A 2NY7H 4LP4A 3VWJB 1ZMYA 3C6SA 4JGJA 2OMXB 3X3FH 4G8IA 4X2UA 3OX8A 4PQXA 1QTYT 5DA4A 3W9EA 4C57C 4ZW3A 1U92B 1WFIA 4IIQC 4YZFE 5C0DA 1OWRM 4JVWA 1D7DA 3KBPA 1FV1A 2BVOB 3IMVA 2IAMC 5D4IA 5DURD 1E2WA 4F8TA 3DETC 4JO1L 2VZUA 2B1AL 3NFSL 4HJIA 4YR6B 5JUEL 4FYQA 5FW8A 3EJSA 2ADGA 3AY4C 3G3BA 3LRSB 1A7OH 4NO0A 2FWLB 1ZD6A 3D4YA 4U1IB 1MCWW 1SQ0B 3RGZA 1JERA 5B7EA 2L7UA 1LDPL 2O4EA 4TRPL 4V11A 2H2SC 3HRZB 5G4MA 3ARYA 1PLGL 1KOOA 2HB0A 4JPKH 4JQIH 4GFXA 1FNGA 4Z7UA 4XMWA 5EU3A 1CICB 5JW4Q 3T2NL 4JREB 2R23A 1BAGA 2IADA 4DGVH 1A25A 3WJLC 3ZDXB 5EORL 4Q9CA 1ILUA 1XEUA 3N1GC 3ML9A 1CIUA 1XH0A 4YQXH 4PCSA 4PRNB 4Y5VB 2ZX5A 1BQSA 3RGVB 4L4JA 3LNEA 3SBWC 2QSQA 2MPVA 4JPWH 2D73A 4FHOA 4LDLB 1FH5L 2XBDA 1WQVT 5F0LB 5T3ZE 2ASSB 4JKMA 1ADQH 4FTVE 4NO5A 1JZ7A 3CHQA 1KENL 3TA3A 4F3FB 2JKSA 5IVOA 3C2SA 5D71H 1UXWA 1SQ2N 3RI5F 2FGWL 2E8ZA 1ZT7B 3GPEA 2UWEE 4PWFA 5HD8C 3EOBB 4TULL 3T77B 4HIHA 4HJ0C 4UIKL 5DT1L 1FQ9C 3P0YH 3SYPA 4JM2A 2VIRB 4Y8DC 1T3FA 3MFGB 4B5ZA 2IEPA 1XGRA 4L48A 4RAVA 1ZS2A 4LARL 5J1AB 1USQA 3FRPG 3QDGE 4OZGA 2QV2A 4GXVL 5K59F 2P24B 3MGTB 1CFVL 3C6NB 1OGAA 2J21A 4HIJA 4J3TA 1A9BA 5DEFB 4E9SA 1TZIA 4M7LT 3CFTA 3KM1A 5CMAA 3HS0B 3QIWB 5DD5L 1TTFA 2BRRH 4OZFA 3IAGC 3FU8A 2PTVA 1ZT1B 2A74C 3GSNH 3O11B 4NPJA 4F27A 3MV7A 4NWTL 5KANI 4DOHE 3SE8L 1AZCA 4YN3A 5GRZA 3W3MA 5D1XC 5JIQA 3QAZC 4OCRL 1BFVL 4KTEL 1IO4C 5EIQA 1DQQB 3N43B 4N5UA 2BS71 3HC0B 2TSBA 3Q1SL 1L7TL 2XYCA 4RAUA 3T0BA 3TYFB 2VZOA 3G6AA 3TPUB 1UM4H 5MENA 1KGCD 2GJ6A 3D9AL 2ZTBA 2ZWYA 2R2BB 3GNML 4X6DB 5AVYB 5GMHA 5D70L 4W9FC 4R4ND 4BCYA 2H7WA 3KPLA 4FX5A 1KCUH 4IOFD 1KXTB 1OE3A 2VISA 3MRIA 4HK3J 3T8XA 3QG6B 3SDAC 3NH7H 3LNGA 4LSTL 2KZ1B 1UUSA 4LLMA 3TVMA 3VXTA 4NZTM 3OXSB 4NDMA 2Y36L 3G5XA 4YDNA 5FW7A 4F2ME 4ZMQA 3GMOA 1FGNH 3EO9L 1MZZA 1ETJA 5JHDA 3S36H 5KSVA 3QDMA 2XFXA 4MA3B 1FNSL 1MAJA 4X4ZA 3UAJD 1OARH 4N2HA 4P57B 1S7TA 2ZWKA 2CO1A 2FO4B 3NOIA 1U8IB 4ORZC 5FO9A 4J8QA 3UG3A 1Q9LB 2QJDA 4PJ9C 5HI3C 2CHXA 4CUCA 3CVRA 3F64A 1CLYH 3PNRB 3IJYB 2XNAB 3EOAB 2DIAA 2RGSA 3IDJA 4RISL 3VFOB 4XVJH 1T5WB 2XQBL 4KMQA 4NRXB 3N2JA 2N01B 1YEIH 2OSWA 4CILA 1SXBA 2Q0ZX 2BJMH 3AQYA 3ULUH 1N26A 2F8IA 5TF1L 3ZDZB 1OV8A 2Z35A 4JJ5B 5EC2A 1WZAA 1JFHA 5D96B 5KYXB 4LO9A 1RD6A 1T7YA 3ASNB 4QHKJ 3D0LA 4GBXB 3MJ8B 4JFDA 1OHQA 4LE8A 3LN5A 4HXAH 3T6ZA 2Q6WA 1E8WA 3C6OB 4J0MA 4MMYB 2BERA 4GRLD 4Z0BH 4ZMVA 1OY3B 1VFBA 3R06A 3UL9A 1RL1A 2W0KA 3WIHL 3MQIA 4WI2A 3FFOA 1G7LB 1VIWA 1O5DT 3IDMB 4P5MA 5A3ID 4Z7UE 2IF7A 2AAVA 2Z34A 5LGYA 3WE1A 1RUKH 2WJ7A 3N5AA 4JRYD 4LEXL 3NGBB 3AQZA 4BIKA 3DRQB 1I3GL 3WY2A 5KBDA 4GRMA 5GRJH 2ZXGA 2IOIA 2YRLA 3CZFA 4U1JA 1IGFH 4JPSA 4ORGA 3R4RA 3OGOE 1DJZA 3K72B 4UV4L 4JDTH 1F11A 3B2VL 1RHHA 1VFAA 1F4HA 5INDA 1DEEB 3HZVB 4LQFL 4LSVL 1WEJH 3CN2A 4NP4H 1ADWA 3DVNB 1G9MH 3RWJB 1W0VB 1OM3H 5C0AD 4AJ0A 3HPJA 3RJQB 3KPNB 5KAQF 4ALAC 4A6YA 1ZDQA 2A73B 3SPJA 5FYJU 1WFOA 5CIPA 1U8MA 3VU2A 4ODUA 3IMSA 4A2FA 1IL1A 2HN7B 4LGPB 1D5MA 5FYJD 4JY5H 4OZGE 5KAQG 4XZUB 5IJBA 4PBVC 3T0EC 4HZ1A 4FTVB 4IMKA 2H9GA 1OGAE 4K73A 3ZVVA 4AMKL 1CS6A 1I7TB 2PABA 5A6MA 3R19A 4LPWA 3FUJA 1G7MB 3IFPB 3TM6A 4EXPX 5BV7C 3BPCA 1U91A 1WS7A 4QCIB 4HP5A 2JFCA 1IM9D 2GSGA 3MV7E 5JDJA 1PPIA 2QTVA 1PNDA 3WN4A 4UZGA 3TT3H 3QDGB 2ED8A 4U0RB 5BOJA 4LSXC 3SDXF 2K6YA 4BUQA 1VCBC 2EXYD 4KHXH 4MCZB 1AG0A 3X3GH 3U46B 2A6DA 4N2LA 4L4VD 2IFFL 3DIFA 4X9IA 5DMJB 5MENE 4IBVA 2CLRB 3PWLA 2GJ6E 3RVWC 4PP1C 3FS9A 3V9FA 2ZKXA 4M3KB 3B2UD 4LP8A 1TZ8A 1TQUA 2W81C 3H2PA 3NZUA 1C9SA 1RUAH 3BGMB 2GK0B 3PP4L 1LL1A 1FZOB 2J8UF 3QVAA 4WW1A 4XP9H 4B41A 4DOHB 1UWYA 5CFAA 4MD5B 1TCRA 4J3XA 3MFFA 3QUXC 3QORC 4W4OC 4M6OH 1YCSA 1XD1A 2IBBA 7CGTA 3PL6A 4KPHH 4HCIA 1FC2D 1NOLA 1XH2A 2NY5L 5JHDE 3QDME 2R0LL 3BAEH 4V1DA 1F58L 2AEPH 1HINL 4FKHA 2IAMA 5FK9A 1FZJB 3WEXA 3KJ4A 3FTZA 4HS6A 5IV2B 4NBYB 4KKAC 2VITA 4MDJA 1S9VB 3T4YB 2VH5H 4Z7AA 3P9MA 5LG1A 3KH4A 3AY4A 3ESUF 4ZPTB 4F2MB 4ZI8A 4JL2A 3P72A 4R97B 1A1OA 2H45A 1IGCL 1TXKA 2PYEA 2ZSWA 4LLAA 4FLSA 4FZ8H 4JZOB 2LTQC 3IJSB 4PJGA 1P9AG 5F9WC 3MKGA 4OAWB 4P5KB 2VT0A 4JFDE 1ZLSL 3C6SB 1OCWH 3TEUA 5BO1L 4G8IB 3AJ7A 3OX8B 2P8PB 3W9EB 3BFQG 4GI6A 2XICA 3TZVC 5C0DB 4QBZA 4WWPA 1PZUB 3MBXL 4AGPA 4M5TA 1C5BL 1FV1B 5GHWH 1ZVNA 4JG0L 3SBWA 5B38A 1J8SA 5ICYA 3MUHL 5AKRA 1UCTA 3FZUD 4AIEA 4FNTA 2AJUH 3MUUA 1H6UA 2VB5A 2PR9A 1SN5A 2ADGB 3ZQXA 1F41A 2J56A 2BW5A 1BM3H 1DN2A 3BUTA 3I9PA 4NO0B 4TVPE 1GZPA 2C1PB 2XDHA 4G5ZH 4KX9A 1IBZA 4JHAH 3MRFA 1NGXA 1T20A 1NUGA 2KPNA 4G7VL 4HAKA 4TN9A 4FQ2H 5EU3B 1FNGB 1QYGH 4Z7UB 3HJEA 3H55A 1PEWA 3FXIC 1SDDB 2R23B 1UJ3A 2IADB 3KGTA 3WO4C 3ZE1F 5DJCA 4NZRM 5E2VH 4ZFZA 4K3JH 4UFRA 3WUWA 4DZ8A 4M6NL 4B9GA 1WV7T 3B3BA 4GO8A 4TKWA 3CHOA 2MCG1 4KX7A 2BP3A 4LHUG 1CGTA 2YIHA 4KHTL 3T9WA 5INCA 2DQFA 2H0EA 1IUZA 2YEZA 4DP6X 4MJJA 3KPTA 4LHQB 1WWWX 1JFQH 4XO3A 1I8AA 4NO5B 3MA7A 5IROD 3TA3B 2OYMA 5FM5O 1UXWB 2WZAA 2DD8H 3I84A 1XR8A 5E5MA 4CKQA 1J5OL 1N4XH 1BEYH 4HIHB 3BZ4A 3NCYS 4KJYA 1AZNA 3A6BL 3CE1A 3ZIMA 3DXAA 5D5ME 4S1QH 4YNYA 3BJ91 4K17A 3WTYA 1QSFD 4KY1H 1T3FB 3BEWA 2X09A 1XGRB 4GAJL 2BNQD 4Q52A 1X4XA 4RAVB 4L8SA 4P2QA 4RA3A 1JHKL 4MAYC 3HI5H 1B3JA 2F7QA 2ZQKA 3NRPA 2BOLA 4HSCX 4WAFA 4OZGB 4MQXD 1OPOA 3HG2A 3EBAA 1OGAB 5BVPH 4HIJB 1A9BB 3VQ1C 1QFHA 1TZIB 3TH2T 5CMAB 4IGBD 2VDQB 1UM5L 4U05A 2W1NA 1CZ8H 5FYLL 1JRHI 5C0CD 1HOCA 3CFDB 1S7WA 5CGYD 3IBEA 4RWYL 4HAFA 3RWIA 2VMFA 3MV7B 3QS2A 1FIGL 3R8QA 5EH1A 4WWKC 3T6WA 4BSJA 2VLKD 1F90H 4NQCA 5AB1A 3FOLA 4YS4A 1GTFA 1U4FA 4PJ9A 4DAGH 3CBJB 4RAUB 4EIBA 2X6VA 3G6AB 5MENB 2GJ6B 4ZUUA 1X7TA 4FG6C 4V1DE 5KSAC 2DB8A 3KPLB 3C12A 1NMCB 4OIIL 4DFHA 3W5NA 2VISB 3MRIB 1A9VA 3T8XB 4LLWA 3UBGA 1T7ZA 2YWZA 4KROB 1KF9B 4FMFA 2BXYA 4LLMB 3VXTB 5EHFA 4KRMB 4N87A 1AACA 3MLWL 4NDMB 3G5XB 4U6XA 2XX1A 5B0NA 3GMOB 2B08A 4JGMA 3QDAA 5LWYH 2JIXD 3CSYB 1QFWH 5JHDB 3ECBB 5J9PA 2WLKA 3QDMB 5KSVB 4R9HA 1AGFA 2XFXB 4KAQL 3WEBA 3FH7A 5FYLE 3LH2H 5BOZG 2H6OA 1UD5A 3DO7A 2WKOF 1X5GA 4PJGE 1S7TB 3GMQA 2WXRA 4W68A 4C2AB 3GM0A 4RRPA 2GUOA 3OAZH 1L9OA 5FO2A 5FO9B 4XNYH 1T1WA 4XNAA 2WZPD 2HYMA 3HR6A 1CU4H 5DHVH 1Z1WA 2CHNA 3RP1A 1XCDA 4MDIA 1MFEL 4IRZL 1HJBC 5T1MA 3AU0A 3EXLA 1BQ5A 2D4FA 5FB8A 3U1SH 1RFDH 1I8LA 1LK3L 1MHPH 1L0PA 2CE6A 3LQAH 4P59H 4YWGL 4BHUA 2WYZA 1IFHL 1CGSL 3K2IA 3D0LB 4WRLA 4B0MM 3FF8A 4JFDB 1VZGA 3LN5B 4PRHA 2Q6WB 4ZMLA 3PGFH 1W6WA 2FK9A 1OB0A 1VFBB 1RMFL 1W8OA 3R06B 3EF4A 4FQLH 4JQXA 5KG9A 3L3HA 1MRCH 5HDBE 1QUPA 3C87A 2LLNA 4EJ1C 4P5MB 5GQRK 3FC8A 5HHVH 3P4LA 2DTML 3DYPA 3E3ZA 3QPXL 4H26A 4JPIA 1IGTB 5FLVA 5EWIL 2FYYA 1NM9A 3U0WH 2X40A 4HBQA 4Y61B 3CXHK 4WV1C 3T0EA 4GRMB 1AR1B 3CZFB 1FPTL 2DYSB 5ECJE 4ORGB 3H7BA 3CBKB 3TJEH 1F11B 4EOWL 5HVHC 5DUBA 1RHHB 2FLRT 5CILL 4WHYH 4BFIB 1VFAB 4GRWH 1A5FL 2DQIH 2V33A 4YXKH 5LBSA 5INDB 3QZWA 4B9YA 1FLRL 1MLCA 2XZCH 4M7LH 3HPJB 2ZOUA 2ZIDA 3OWEA 4HGKC 3MBWA 2BIMA 2EUWA 4LCIH 4MS8C 1H8OA 4A6YB 3CMOL 5CN1A 3DXAE 3VQLA 5CIPB 3QNYA 1U8MB 5C3TA 2O6RA 2Z63A 3FQYA 3PFUA 2KS0A 2ZNXA 4ODUB 3VSVA 3FUKA 2X0UA 1IL1B 4P2QE 2ENSA 1D5MB 1SVZA 4YHKL 1OPGH 4OD1H 1FL5A 2D03H 5I6MA 1ESOA 4WW2A 1MCOH 1X6LA 2ENPA 1SY6L 1Q1JH 2H6PA 3QUXA 4Q2ZA 1MHCA 5DQ9A 4WNQA 4W4OA 2R0WH 5IESH 3II2A 1Z3GH 3BPCB 1FN4A 2HZHA 1U91B 4XPHL 3PWPA 4G3YH 5LNGA 3M19A 4Z9KB 3IU4H 2GSGB 3VRIB 2VW7A 4EIGB 1WISA 2AQQA 4IOSA 3KBEA 3MLXL 1JD9A 2I25N 1RZ7L 4NQCE 2IOMA 3DX7A 4NM4H 3WS3A 5F7HA 3QGVA 1A6AB 3DIFB 1YLBB 2EC9T 3EO1A 3PWLB 4F15B 4E68A 2BSSA 3STZA 3ZL2A 3ZQ9A 1AHMA 5HVFB 1AO7A 5EZLA 2XT1B 1OEZW 4ARNA 2ENYA 1JN6A 3GYRA 3S4SG 3WMSA 2FH8A 3I2CH 4HIEA 1DVZA 2F8VA 4WW1B 3IN0A 3VTTA 2A0ZA 1YYLH 1YEFH 1TCRB 3N9GL 3P73A 3X1EA 2KZWA 3MFFB 1UM6L 4A7GA 3TXAA 2HKHL 2NY4C 3PL6B 1CK0L 4NGHL 3P3UA 1NLDH 1SN2A 2Q8AL 5IHZA 4IIQB 4V1DB 4ZRGA 4OZ4A 3PJNA 2CO2A 2ADJA 4K2UL 2IAMB 3KJ4B 4RQQB 2BSCA 5FK9B 1U8HA 4HS6B 2V7HA 4KBPA 3WEXB 2E5EA 3ZTCC 4ZO6A 1DL7L 1NBVL 2VITB 4Q74A 4MDJB 4ZD3L 2JJSA 1EX0A 1YO4A 4HPYL 5T3XL 3FN9A 5DJDA 1J86A 1I31A 1P1VA 3P9MB 4MA8H 5IF0B 4UUJA 4FXLA 3IXAA 4ZS7H 1A1OB 3I9AA 5BV7L 4MXQC 1KXVA 2VDNL 2ZSWB 5CP3H 5EF1A 4ISVA 4DT2A 3NFPA 4JPVH 4PJGB 4M5SA 1N0LA 5KBKA 2DQCL 2FHCA 3RWEA 2R8SL 3FXIA 4BV1A 3WJJA 3ET9F 4Z7OF 4NQSA 4R7NA 3HE6C 4XC3H 4PRHE 1X5AA 2YD7A 3QCUL 3CX5K 4P2RA 5F1SA 1ZA6A 2DF3A 3ARBC 4NQDD 4PS8A 6FABL 5IR1B 4B96A 1K4DA 5I1HL 2J8HA 4KMLB 4N5EC 4MAUL 3ZE2F 1GKOA 5ICYB 4L1HA 4YUEL 5BRZA 4PI0A 1CFBA 1HYSD 1S3KL 2G3NA 3GHPA 2Y6TE 4HKXA 5K93A 1XH3A 1TMCB 5EEXA 3ZTDC 3T0EE 1GZPB 2B1HL 4QHLA 2JB5L 2ZYRA 1HHIA 1TG8A 3MRFB 1NGXB 1KCRH 3QE5A 5F72S 4R2GC 1DZBA 1HS6A 4LLYA 3G6DL 1A6ZA 5HDBB 1E4JA 4P3DA 4B97A 2BY2A 2CRMA 4DO5A 3FSZA 1UJ3B 1OAUL 3F6IA 1RIVL 4A2EA 3D2UB 4FDWA 4HWBH 3U4BH 5DJCB 4ERSL 5IBLC 3RIAF 1LWRA 4ZFZB 1NM4A 3KCPB 4M7EC 3WUWB 4DZ8B 4EZMA 3EH3B 2VDPB 4JRWA 4QRUA 4Y4HD 5E6IC 5BRQA 1H5BC 3RPBA 2IAAC 1RZJH 2CU9A 3MCKB 4DKEL 4R8WH 1WHOA 5INCB 1BM7A 2AXGA 2DQFB 3MA9L 1DBBL 4JM4L 3K4ZA 1SBSH 2YEZB 5EBLA 1BQUA 2A74B 5ACMA 5TE4L 2MOVA 3VO0A 2ZNWA 3MA7B 1A14L 1R3LB 2HT3C 2L3BA 3QFDA 4JO4H 4WWKA 5D7SL 4Z3JA 2Q87A 1J8HD 1XR8B 5E5MB 3GRWH 1R5VB 4A55A 3M6DA 5HSFA 3BZ4B 3O2WH 2D3JA 4Y89A 5CBAA 1OAYL 4KJYB 1YC8A 3VD9A 1KCVL 2Y1AA 3DXAB 3IJEA 2HFGL 3PWPE 3QUGA 2V9UA 4J6RL 4OM1L 4UT6L 3CSTA 4YNYB 3BEWB 4L8SB 4P2QB 1IBFA 4YHZL 4G6JH 4LT7A 2OMVA 2ZKWA 3AZUA 4H0GA 3CIYA 5DUMH 2ITFA 3E6FA 3OR7A 4N86A 1U58A 1UWGH 4RFNB 3K1KC 2FQEA 2J20A 4CVWA 1Q38A 3N3EA 3MJ9L 3WNMA 1IKNC 2WBJD 3SD5A 1AO7E 1VHPA 1HOCB 4DGYH 3PNWA 1S7WB 1G7IB 1SUJA 2B0SH 3OAZK 4E36A 2YPKA 3BIBX 2NYYC 3KS0J 4ZUVB 5HTSA 3ZKXB 1ML0A 3PQYD 1H6TA 1BMZA 2VO5A 2P45B 3LS5H 4NQCB 3FOLB 5CJOH 3CC5A 4X7SH 1Z7JA 4PJ9B 2PW2A 5EO0A 1X7QA 3BAKA 1JHTA 4J4LA 3HMWH 4ZUUB 3BH8B 4PU2A 5JW5A 4PVBA 2ZX8A 2G0LA 3V4VA 5D2NA 1DBJH 1PQZA 3V9EA 4LLWB 5AVTB 1T2QL 1Z5LA 3DETD 1CXLA 1SDAB 2BVTA 5ETUA 4LB8A 3KWWA 3GUTA 4U6XB 4DESA 2QMJA 3C5JB 2Z7YA 3MBED 2DWXA 4M29A 5AL8A 1SUHA 3RDTC 5J9PB 2LU4A 1FE8H 1AGFB 2C7FA 3BT2H 5DYOA 1CTMA 1J10A 3FUMA 3NRFA 2FL5A 4ZTOH 2JI2A 3DO7B 2RQ8A 3QHTC 5E94A 1KYOJ 3TS8A 1HH9A 4KVNL 3GK8L 3I3DA 1YNTA 5E7FA 3LNDA 1T1WB 5JA9A 4HLJA 5CHNA 4P2RE 1N0XH 3L3JB 4OV5A 2OTUA 3QR0A 1BVZA 2F18A 2CA6A 3NG5A 4MDIB 3EFOA 3TEZA 5T1MB 3WAKA 3BSGA 1SF5A 1ES0A 5BRZE 1C5CH 5DZJA 5GGSY 2YJQA 2Y9RT 4HJUA 4XSQA 2QSCL 4ZMOA 3VD7A 2OI9B 3Q2VA 5L2JA 3H3KA 1NL0H 1KEGL 1XO8A 4PRHB 1TUPA 1N59B 1MF2L 5HYFA 3MNZA 3SBQA 2B1OA 5KG9B 4FNPA 3L3HB 4E9WA 4F7PA 2XYBA 2O6QA 2K6WA 1EBPA 3AU1A 1QYYA 1UWFA 5DZNA 1UFUA 1BP3B 3VGFA 1J18A 3J2PA 1FT8A 1XIWD 4LOUC 1ZPUA 4H26B 4JPIB 3SE9H 1JPGA 4AJWA 5CCKL 5TDOA 1QZ1A 2E9GA 2FYYB 3GBML 3N42F 1IAKA 2D7MA 4FFWD 3T0EB 3TCTA 2BDNL 3U0PA 2ZXCA 3BUBA 1FS2A 3H7BB 3H42H 2VXVH 3VA6A 3WELA 4XNQA 4YDVA 2HCZX 5DUBB 3PV6A 1Z9OA 3CK0L 2R56L 2VZVA 3B1UA 4LVNB 1Q0XL 4I3SH 1ZV9A 5BV7B 3ZR5A 3QZWB 4H88L 2VQUA 3T8VA 3UO1H 5AW0B 2X4UA 1MLCB 2Y07L 4N2NA 4YZWA 1D5XA 4ZW6A 4KV5E 1L7IH 5CR1A 3DV6A 3MBWB 2OMTA 3MYZA 3IDGA 2VDMH 3K5RA 4HMDA 3D87B 4ZUWA 2EC8A 3O4LD 3QNYB 4HLEA 3UZQA 3CZUB 2XY1A 3TNNA 5FAAA 1C08A 2DY2A 5BVJA 4N2AA 1EUTA 5AW9B 4Y19D 4QRTA 2VJ0A 2YD9A 3HVNA 2YUVA 1CLOH 1XF3A 4R26H 3THML 4N8CL 3GJEA 1FL5B 2HLFC 2GVYA 3OKYA 4WW2B 1NDGA 3JV6A 3VA2C 2H6PB 3UJJL 1I8MA 3QEHA 3QUXB 1MHCB 3ZE0F 5DQ9B 4WNQB 4XX5A 5EB9A 3NZ8A 3QAQA 1QRND 1FN4B 3DROA 3IFLL 2Z31D 4DVBA 3PWPB 2WYHA 2O5YH 1MXDA 2BSTA 5CM1A 4BJLA 3HN3A 4AUJA 4E9LA 4NT6A 4EEEA 2YPVL 1U3YA 2WWOA 5J3HD 4AQ8C 3WS3B 3LNHA 3CSGA 4PI2A 3A47A 3KEHA 3UC0L 3VDAA 1K6QL 4X7EC 4XC1H 3QCTH 1RY7B 3O3EA 2BSSB 3STZB 3KGRA 1J0YA 1RZGA 1AO7B 5EZLB 2BS8A 4YGAB 1T03L 3BSZL 4TUKL 1D5BA 1JN6B 1MCQA 2PCFA 3PP3H 5D2NE 3UADA 1AR2A 1MRFL 4HIEB 1EMTH 1KGIA 1M05A 9CGTA 3P73B 1JUFA 2NY6D 5F9WB 4DP4X 4N0FA 2XWDA 3EYSL 5BW7A 1IAIH 3IEAA 1RZIA 5KTEL 2FO8A 4A63A 4C83A 1R75A 3IRZA 4HKBA 4HFUL 2YGOA 4UT9H 1FCCA 4PYHA 3TZVB 5CS7A 1UWXH 4XB8A 5IG7A 3ZRFC 3QQDA 2AEOA 1MJ7H 4PLJD 1FI8C 5K9QG 2ADJB 3D18A 4A7VA 1U8HB 1ZWIA 2V7HB 5JHLA 4OT1H 3IGKA 3IGFA 3PREA 4XAWH 4RMWA 2AGJL 4QOKE 5KSBF 4AOFA 4ONHA 2OR8A 5DJDB 2X3CA 2Q5BA 3V5DA 1VB9A 3KLQA 4X8CA 3F12B 4UUJB 3IXAB 1IM9A 3BE1L 1JSYA 3NPZB 5H94A 1M1SA 1TKWA 4XN1A 3K4AA 3S36X 2AJSH 2J1XA 4NKDA 3W2DH 1JI2A 1J0ZA 4ISVB 4NFCA 1I7ZB 4L5FL 4KZCA 5CEZH 4ZAKC 3UPRA 3DIDA 1N0LB 3RWEB 4F33B 1NC2A 2JWYA 3DX8A 4R7NB 1NKRA 3WO4B 1BJ8A 3IMBA 1AFVH 4UBDD 3A22A 4P2RB 5L4MA 5EZIL 1ZA6B 4KGLA 5FXCH 4M7EA 3UROR 3AS0A 3BP6A 4HD5A 1AD9A 4XVSL 3CZJA 4M7JH 4NNXA 1PVHA 1H5BA 1CTNA 5ESAA 1QBLH 2GI0A 2IXQA 5BRZB 5E6UB 5HPMA 1WG3A 5J11C 4OCXL 3LEVH 4WKZA 5F0MB 1U0ND 1CT8A 1XH3B 4QWWD 3RJDA 2OW7A 1LO5A 3C60D 5BOPA 4QHLB 2CM6A 4FABL 1HHIB 4NN5C 2V17L 1WIUA 2QSTA 1QO3A 2YA0A 3ARUA 4LLYB 1A6ZB 4RMTA 2OK0L 3WDHA 2Z4TA 4P3DB 3DOHA 1MREH 5DJZA 4WQOA 3V4PH 1J0HA 3RZCC 1GR7A 3OG6B 1MCJA 1DSWA 1KSRA 3RAJL 2X41A 3ZPDA 5BZXA 2HJLB 1XTMA 4QRUB 3KR3H 3VM7A 2GG1A 4K55A 3LH9A 1TZAA 4GNKB 1YEHH 3U9WA 5IVXF 4E42B 2P5WD 4OF3A 2AXGB 2DM2A 3IK2A 5DMIL 5FWRA 3BXNA 3VH8G 3UJTL 5EBLB 3MRRB 3MODH 1CGVA 1OSPH 5F96H 2FDBP 3B43A 4G6KL 1S8DA 3QFDB 4JG1H 1AKJD 3SDCC 1KTKE 4WWKB 3LZFH 5AVRB 2X4TA 5DURB 5CBAB 3L95A 7FABL 3INUL 3IJEB 3X14A 2XWCA 2O5NA 3CFUA 5I23A 3FB6A 4TQPA 3WFEL 1U3NA 2OMVB 1JF5A 3EYVA 3TSRE 4GSDL 3F58L 4M00A 4ZW8A 4X7FC 2DS4A 2GTZA 3E6FB 3OR7B 4ZDHA 4F58H 3WTSA 3CLFH 2R1XA 1U58B 3NJLA 4JFED 3IE9A 5E8PA 1HZHL 4LLUA 5FGBC 1JL5A 4EAEA 3VTMA 3STBA 4F8PA 2NNXA 5MERA 3OGLB 5E0QA 2IBZY 1GZQA 3FTSA 1R5WB 3S34L 3NCYP 3PNWB 3ZTNH 1L9TA 4MZ2A 1EGJH 4YAQA 2YPKB 5IJKA 2CBQA 3NK4A 3RDJA 1N7MH 1VGEH 1EQWA 3EH4B 2VW6A 3MXWL 4FKKA 5E9DD 1E5BA 1EIBA 1AIFB 2O6EA 4PJ8D 2HX8A 4PSPA 4UTCA 3CC5B 2DQMA 2EKSA 2PW2B 2Y22A 1X7QB 2KBGA 2EEBA 4M6AA 3CQFA 1JHLH 1U93A 2A7BA 4UILH 4WFHE 3VJ6A 5FUCE 1YNKH 3G5WA 1JWUA 5E6ZA 5JW5B 1A4AA 1UG9A 4AM0A 2OTWB 4RNRA 3HVDA 2FATH 3V4VB 5IROA 5E08H 2NR6A 5D2NB 4O4YL 1PQZB 1HFUA 2H4EA 2XPGA 4LLQA 2F58H 4PJIF 1Z5LB 3GHBH 2OJ1A 5KJRH 3SE4C 4AG4H 5L9DL 5ETUB 3JV0A 3MUY1 2DDQL 3VG9B 3GUTB 4ZTPL 1QSFA 1G4RA 2MHAA 1D9KD 2BNQA 2P1MB 4OQ1A 2QADC 3D48R 4HIQA 3SO5A 3LKPA 4FFZH 4PV9A 4XWOC 1JV2A 5DYOB 4M6MH 2FL5B 2W9LA 2C9PA 5B0TA 1EERB 1G1CA 4YC2C 5E94B 3OD3A 2ZKMX 1T83C 5F0PB 4LPUA 1HH9B 1JDAA 1O9ZA 5M95B 1YNTB 4IGBA 1UOVA 4QOKB 4PY8J 2F5BL 4OZIA 4OQTA 2XV3A 1QWHA 3F7QA 4LSPH 2Q7NA 4DQOL 1SRDA 2OTUB 4FEMA 4FXKC 4J7RA 4M4RA 2VXTH 4WWNA 5C0CA 2AK1H 5I1EL 5JNYB 2ADYA 3DTDA 2XWZA 3EFOB 4OLWL 1BD2A 3I75A 1SGKA 3GXUB 1ES0B 4ZZKA 2VLKA 1AQKL 4YHMH 5D7JC 3JWNH 2JI3A 4L1BA 1AZZC 4OF6A 1KLFA 3EYUL 3V9CA 2B77A 4I0PD 2D8KA 1A6VH 2YKLH 2Y4SA 4DGIL 5L2JB 1HKFA 3W11C 2I24N 2ZAGA 3QDHA 1DANU 1MCKA 3MNZB 3OL2A 1F3DH 2CWRA 3QXDA 3VI3F 4YSEA 4F7PB 1HTYA 1A21A 2D7QA 2Y5QA 2ZG3A 3BMWA 2AEQL 3FSWA 3AROA 4EXKA 4FULA 3AU1B 2Y7QA 5DHXB 5K69A 5B1BB 5AYUH 1EO5A 2PN5A 4ANVA 4QTIH 1JPGB 1M42A 3B2MA 5TDOB 4XMKH 2C3GA 5M7QA 1IAKB 1PX8A 3FSVA 4MAYD 1KUMA 1JP5A 2PPFA 3P3TA 3WV0A 3U0PB 5LQBL 2E8YA 3P0VH 3QUMH 4ZFQA 2IPUG 4PB0H 4G5AA 2FH6A 2VDLL 4XNQB 5SX4I 3L4XA 4YDVB 5C0RH 2FQDA 1NBZA 3DUHA 4P5TC 3PV6B 2XWXA 5DR5L 4BQCA 4HWUA 4YEFA 4QY8A 5K9KA 5DRXA 3ZTJH 1UZ6E 1YNLH 2QGBA 3L5JA 3QK0A 4YL4A 1KGJA 4EN3C 2X4UB 1HWWA 2DJMA 5LGHH 4OJDH 4JLRA 3TV3L 5H37A 3D50A 1D5XB 5C8JA 4XP5L 1OTUC 4WDIA 2VR5A 3B6SA 5B4PA 1TVDA 2H2PC 3DV6B 3G5YA 4OFQA 3IDGB 5AB0A 5TE7H 4AQ8A 3FJTA 3O45A 3K71A 4HALA 4U33A 3JTTA 1PG7W 3UZQB 4XAKE 4KH9A 3TNNB 1KC5L 1C08B 5BVJB 3S6CA 1WDAA 1T0PB 4KZEH 4JCMA 1RUQL 4QRTB 4Z3HA 1OTNA 1MIML 1NEZG 2FQFA 5I66A 3GJEB 4OJEH 1ZVHA 4X80H 1NDGB 3JV6B 3QQ9D 4TQ8A 3A67H 1I8MB 3QEHB 4YDIL 1QKZH 2W80C 1F6AA 3NZ8B 3PAUA 3BQVA 3DROB 5HHMD 4DVBB 2WLYA 1OE2A 1QSED 2YAQA 2G60H 4OU3A 3RIFF 1X4YA 4HJJH 1ZTXL 2BSTB 2ZX6A 1LMIA 1CVSC 3DJSA 4N2CA 4NT6B 1JGVL 3L5HA 2ZXDA 3S97C 5AOIA 4QRRD 5F7EL 4ONFL 4UTAH 2VN3A 3RB7A 1KJ2L 2A9CA 5KSUA 4N2IA 1Y6MR 2ZOOA 2XRAH 3O3EB 4QXWA 3LZOA 4EVNA 4I3RH 1AKPA 1CC3A 1IU1A 3ABGA 3EGSA 3MRLA 1RZGB 2WY3B 2UZXA 4Y9GA 1D5BB 2PCFB 3BHBA 4PBWD 4MMXA 1M05B 2IDTA 2FCBA 3T6XA 1JUFB 3H9ZA 4ZAKA 1JZ6A 4E9QA 3ILPA 4N0FB 5EN3A 4JZJA 1AJ7H 1RZIB 5A7EA 5I8OL 3CDFA 3HNSL 4C83B 4HKBB 3ENEA 3BCDA 3I9IA 2BNQE 3S98A 1KCSL 1MVUA 4LPTA 3OXRA 3OKDA 4Y88A 3I74A 4JFOA 5IG7B 4L9LA 3QQDB 1Z9SA 3BKML 1MFAH 2F53D 4D8PA 3D18B 3VRJA 1ZWIB 4EDWH 3ABKB 3EJTA 3QC5X 3R7QA 4Z7IA 1RPKA 4CVZA 3CN0A 1NAKL 4Q6YA 3A4FA 4ONHB 1JXFA 2Z8WC 3V5DB 3C6EA 4PS4H 2V9SA 4UINL 5C0CE 1ZAGA 1ZV2A 1IM9B 2WANA 3ESVF 1TKWB 1BD2E 1G94A 3DTXA 5JIMA 4NKDB 1XB6A 2EE9A 2EIMB 1XCXA 2FBJH 4JQVA 5LBGA 4ES8A 5IT2H 3RA7H 3WMPA 1XF4A 4ZFGH 4W70A 3UPRB 1NC2B 4LLVA 4U4IA 1QLEH 3DX8B 3RZCA 3NEXA 1I3UA 2VRQA 3RVXD 4DK3A 1P69B 4ZX5A 5DI8A 4XMUA 4G8AC 3BP6B 1AD9B 2X1OA 3FO9A 4NNXB 2BCMA 1T5XA 1H5BB 5ESAB 4FLRA 4FLOA 3GGWA 1M4KA 5EBGA 1FFOA 2IXQB 5AW1B 4C4BA 3V95A 1INEH 5HPMB 5K5YA 2VDKL 1JDDA 4LK4A 4N9OB 1UOKA 4WKZB 3QQ4A 1CT8B 3EBHA 2B5IC 1LO5B 3BISA 3CN1A 4TNGA 3HC3L 3S5LA 3SDCA 5BRPA 4KGJA 4RRPM 1SXSA 5LDSA 1QO3B 1MFUA 3WFBH 3KLDA 1ZVYA 3LJ3A 1II4E 1RUPL 2GI7A 1F8TH 2LAGB 3IDYC 5DJZB 4XO9A 1PSKL 4YPJA 1YY8A 3E8UL 5GIRA 4X6CA 2IV9A 3NSXA 3SCMC 3OJDA 1P7BA 3DBXA 3QRGH 2NY0C 4NKHA 2GJZA 1G84A 3BXNB 3MROA 1WFUA 2Q76A 2X12A 2WXKA 4R7DA 3HG5A 3RBGA 2IOOA 3CC1A 2CR3A 3WO3B 1QABA 1S8DB 5TQ0L 4BZ2H 2XXFA 4NQDA 3SQBB 1R0AL 3GSRB 3IXTA 1IC5L 2X4TB 1WZ1H 4NI6A 3L95B 1D7CA 4J3OC 2EYSB 2PWHA 4LI2A 1DBAL 4LEOB 3ATAA 1BWWA 2NY4D 2KL6A 3FB6B 2EIKB 3P77A 4RMBA 5HI4C 2X3BA 2VUOA 2MIZA 4L3AA 3EYVB 4YIQA 2WOYA 4BK5C 2L04A 1WVZA 2GTZB 4ZDHB 1NEUA 2R1XB 1TJXA 1MG3C 5E8PB 4LLUB 1M71A 2IALA 5MERB 1GZQB 3QI9D 3K5SA 2DQTL 1EJOL 2C3XA 2R1YA 3PF2A 2C1OA 4YAQB 3JSSA 2EDRA 3GLAA 4XMLL 4AH2A 1JNHA 2F7IA 1KNOA 4W6WB 5C0ND 3NACH 3ZRSA 1YEKL 5FW6A 5I73C 1KJMA 1XD0A 2R0ZH 3J07A 3LXUX 1MQKL 1N5YH 3DX1A 3BAYA 4BZ1H 4LSQH 4PLNC 3WPCA 3OPZH 2AZAA 2EKSB 1AXTL 2XZAL 5D93C 2QQKL 3IU3A 1U93B 3VJ6B 3I85A 4ZS6D 1BZ9A 1JWUB 1X44A 4YBLB 2IVFC 3SGEI 4AM0B 3O8XD 4PJDF 4WO4D 1CLZH 4RMRA 3EJYC 4EDXA 2W60B 3B9KD 2XPGB 4LLQB 2CBPA 4AGQA 4Q9QL 1NCDH 1Q9WA 2ZD0A 5D7JA 3QZNA 3QJXA 4BSVA 4J3OF 4DN3L 2FR4A 5TJWK 1NFDE 2P43B 2EE0A 4ODVH 2MHAB 2BNQB 1L5GA 1PD0A 1JS4A 3N50A 4PRPA 4TSBL 4UQIM 1JV2B 3FTWA 4R2GD 2BK8A 4KK8C 4J3OG 5GJTL 4AL8H 4J2XA 4R09A 5E8EA 5JMRA 4LSRL 1KJ3L 5C6TL 1L9MA 4IGBB 4MCNA 3HS8A 2WBJA 3B9AA 3L9RA 4M4RB 2HT4D 5C0CB 3GMNA 2OL3L 3CLEH 1TTBA 4H8WH 1KJ2B 1TJGH 1RPQA 4R5XA 3AG4B 1UXSA 3WG7B 4DP8X 1BD2B 3I75B 3K4DA 2X4OA 4KI5C 3TL5A 3ZHLA 3PQYA 2B2XH 3LTVA 5DD3H 1RK1A 2VLKB 1BBDH 3DX9A 4P5TA 2FIKA 1EHXA 4XCCL 1KLFB 4J4PD 5JPNA 1ACYL 1E30A 3TWYA 5K1NA 5F3HA 4EN3A 4KQ3H 2X4SA 4X8GA 2XXGA 1CFNA 3RW6A 5F1KC 3TO4C 1I7UA 3CXHJ 3K2UL 2VERN 3QXDB 4MZ3A 4RGOH 4XNUL 4CJ0A 5M94B 1X5MA 4HX1A 4I0CC 2IH8A 1G9NH 1CDGA 2Y7QB 4YHIA 3SQRA 3TN0C 5DC4B 1T6VN 2ZF9A 4JEGB 3Q0HA 4X6CE 1H6EA 1G7HA 3ARQA 4BM7A 2BSRA 1W72A 3MNVA 1EVTC 2FECL 3NTCL 1CD0A 3QJFA 1F1AA 1NGQH 2XZZA 1UADC 3L2MA 1BA9A 4AEFA 3BKJH 4OM0L 4UNTA 5D7KD 3WEAA 1INQA 1UVQA 2PPEA 3SKMA 3MDJA 1NBZB 3MRKB 3RX9A 3EGXA 3HZKA 3MLSH 4XNDA 5K9KB 4QY8B 3WNJA 2C26A 4QXEA 1RH8A 5DRXB 1H0DA 2EIJB 4HWZB 1T7WA 5C7XH 4PS7A 2AMGA 4ZXBD 1M7UA 4UYQA 2WO4A 3ARGD 4JLRB 2EINB 3OJMB 5FS5A 4K7PH 5C8JB 1H19A 4WDIB 3B6SB 2WLNA 3G5YB 3KPOA 4XE5B 1FBIL 3CFJB 5FIEA 5I5MA 4ZT1A 5JYLA 5D3IA 3O45B 3PHAA 4J3BA 4K3DL 1PNCA 3B2DC 3K71B 1TYJA 4MA7H 3TX4A 3JTTB 3OQ3B 3SKNA 2AMUA 4N0YH 4CU7A 2OP4L 3VTAA 5DMGC 2QLYA 1EH9A 5I66B 2EEDA 2YN3A 4AMXA 2I60H 4TL4A 4K8RL 4DPAX 2O5ZL 5L7XH 3FT3A 1F6AB 2OCCB 4Q9RL 5ILTL 2VLJE 4KVCL 2R4RL 3UL7A 1JYNA 2JELL 2E46A 2XTJE 3NIGF 4GO6B 4NZUH 3RDTD 4A2DA 4DTGH 2X53A 4NAQA 2HTKC 3K6DA 4P4KC 3FU3A 3DURA 1QRKA 4DQAA 3OMAB 3FU7A 1MFDH 5FUZH 5HDQL 1GOHA 4IHOA 4EZJA 2J72A 5KSUB 3OQRA 3QULA 4ZO7A 4HS8L 2FT6A 3EGSB 5EU6D 3MRLB 4XP6H 3P40A 2UZXB 3B9VA 2WC7A 2XA8H 3BHBB 3KLAA 4GY4A 1TETL 4XNBA 1QG3A 1WWAX 3E2HC 4MMXB 3QRFM 5F3FA 4XPBL 4ZAKB 1MFCL 5FFGA 3R0NA 5LGJA 3ILPB 5C2UB 4WTWA 4JZJB 5F44A 3O4LA 2VRAA 3CVHA 3UCQA 5E4EB 3H1ZA 4JE4B 3PXJA 1M9LA 1J1PH 1PYWA 3IGAA 1MVUB 4Y19A 4PRPE 5AKSA 3OKDB 3KZ8A 4JFOB 1AI1H 4G8AA 2IMNA 4L9LB 3HG4A 3G39A 4D8PB 2YAPA 3VRJB 4AVIA 2EICA 4TSCH 3RUGF 4CVZB 4PBDA 4X42A 3ZGIA 4MQSB 1OK8A 3TOPA 4XMTA 3B9DA 1QRNA 4NZJA 4XGZA 2NY2D 2VLRA 1NFDB 4BFEA 4MMZC 3L2NA 2O30A 1G1KA 3FTGA 2HUEA 1QA9A 4J8RA 3UIYA 3LH8A 4NN5B 2OMUA 1ERNA 1GYVA 3DTXB 3KEDA 5CUSL 5D1ZD 3PQYE 3N41B 3FQNA 3ME0A 1QFUL 5AVVB 5MEQA 1XF4B 3WAJA 2V3EA 4CMHB 1K9TA 1F97A 3LB6C 2MOQA 2JKRM 3RZCB 4P0DA 1VACA 2YO3A 1A4CA 1J05A 4AKPA 3IPEA 5DI8B 2ETWA 3QWQB 2QELA 3FO9B 3QYNA 1T5XB 1VEOA 3L3IA 4FNLH 3PUCA 4QJ3B 1KIUA 3BGAA 3H6AA 3KYAA 1CXFA 1FFOB 2YA2A 1MN4A 3BVUA 4OJYA 1FH2A 3EDKA 3VDBA 1CMOA 3GINA 3WIFB 1GIGH 4R90H 3ES6A 3EBIA 4GAYA 1HEJC 2Z91A 3RHWK 5AZUA 3S5LB 3SDCB 3QO1B 3VXPA 4LRIC 1MUJA 3TEWA 3LZPA 2QZQA 5B7MA 2P48B 4AXWA 4R4FH 2HX9A 2GT9A 2ZONA 4OLUL 4MCYA 1YY8B 4XO5A 5GIRB 4X6CB 3PYCA 5FHBH 4A66A 1MELA 5JYMA 3R4DA 1RULH 3GS7A 2VN6A 4TLKA 2NY3C 5IHBA 3NCCB 3F04A 1UA7A 1VAHA 3OJDB 1MAML 3DBXB 1TNNA 1I1AC 3N91A 4CNIA 5IWLC 1EV2E 4D2NA 3QIBD 5FYKE 4WSGA 1F13A 2GJZB 4KKCC 1H8SA 3OVUB 4FI6A 1JGUL 2XVLA 2OMZA 4YSRA 3MACL 3VGEA 1OF0A 1QP1A 3MROB 2Q76B 4R7DB 3LIUA 1EANA 5ALBH 1RAMA 1I7RA 2VDRL 2R29H 3RPKA 3GC3A 3JWNG 3U1PA 3WPHA 2WYIA 3AS3A 1J9QA 4P4RA 4BKLA 3QNFA 1YMMD 4XP4L 2J8UA 1XQ4A 5TK4A 4WLCA 4ABQA 2WSDA 3K46A 1J8RA 2D0FA 4K3GA 1ROWA 1T66D 3FQUB 5I1DA 1BJ1J 1IE4A 3MLVL 4JDVB 3OJAA 1PZAA 3E7JA 4OCMC 3P77B 3QIUC 4XPTH 3DJTA 4FA8A 3FQTB 3G08A 4YIQB 3C60A 3SY6A 2AJYH 4JFQA 2ZWZA 1JXJA 2H8PA 2JKJA 3LRLA 3RJOA 3SE3C 2HFFA 3LS4H 4M48L 3WTXA 1MPAL 1M71B 3ARZA 2IALB 3BH9A