4LSXC

Plant steroid receptor ectodomain bound to brassinolide and serk1 co-receptor ectodomain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
NLEGDALHTLRVTLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTNITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSHPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Steroid binding protein/protein binding
molecule keywords Protein BRASSINOSTEROID INSENSITIVE 1
publication title Molecular mechanism for plant steroid receptor activation by somatic embryogenesis co-receptor kinases.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 46
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4lsxC00
3DZEA 3UL8A 4P8SA 5GMHA 4FDWA 2OMUA 4BV4R 2ID5A 3CIYA 3G06A 2OMWA 3CIGA 3G3BA 3OJAB 2Z65A 3W3NA 3M19A 2Z64A 4M7EC 4CNCA 4EZGA 4GLPA 5AWBA 4PERA 3RGZA 1ZIWA 2XOTA 1K5GC 4QBZA 2FT3A 4L3FA 1DFJI 5IYXC 5GS2B 4AY9X 3ZYJA 5FTTB 3O6NA 1WWLA 2O6QA 1JL5A 5AWAA 5A5CA 1PGVA 2OMTA 3RFEA 4MQWX 1DCEA 4FD0A 4C2AB 3O53A 3C6PB 2XWTC 4UFRA 4R08A 4GT6A 3C6NB 3A79B 2P1QB 4TZHA 2UZYA 1LTXA 3WPEA 3WPHA 1P9AG 1M10B 3G04C 2P1MB 3M18A 4U09A 4V2DA 4LSCA 3SB4A 4NKHA 5AZ5A 4Z79A 3UL7A 4J0MA 4Q62A 4U7LA 2UZXA 4V2EA 2Z7XA 4R09A 3W3JA 2OMYA 4PSJA 4LI2A 4RCWA 4FMZA 2P1PB 2OMVA 5AWCA 1A4YA 2R9UA 3JB9j 1OGQA 1O6VA 3E6JA 1FO1A 4LSXC 1YRGA 4L3AA 3KJ4A 5D3IA 3RFSA 2V9TB 4LXSA 4Q3GA 2RR6A 1M0ZA 3TSRE 1FT8A 4Z61C 1XWDC 4R6GA 3ZYNA 1H6UA 3W3MA 5IJDA 3BZ5A 1M9LA 1G9UA 1XEUA 2WQWA 1U0ND 2RA8A 4FCGA 3G39A 4CC4A 2OMXA 3OGLB 4U06A 4C2BB 2WQXA 2ASSB 3VQ2A 4R5CA 1P8VA 3W3KA 5GMGA 4RCAB 2O6SA 4LSXA 3ZYIA 4ARRA 2WQUA 5AWDA 1XCDA 2JE0A 1O6TA 4IM6A 1D0BA 2BEXA 3FXIA 4J4LA 3ULUA 3UN9A 3G3AA 5CMPA 2P1OB 4ECNA 4OQTA 4G8AA 4LXRA 4MN8B 1XKUA 3UL9A 4Z8GA 2OMZA 4PKIG 3RGXA 4R6JA 2WQVA 3GOZA 3WPCA 1FQVA 4WP6A 1DS9A 5IJBA 4XOSA 1FS2A 2BNHA 4CC4C 3CVRA 4KNGA 3WPIA 4K17A 4NKGA 3ZYOA 1W8AA 2V70A 3E2JA 4ARNA 5LFNA 2ASTB 3E3ZA 4R6FA 4BSSA 4WYKA 4R07A 3VQ1A 3RJ0A 5GQRK 3C6OB 4KT1A 2P1NB 1H6TA 4CILA 4PEQB 3W3LA 2O6RA 4FHOA 3RFJA 1K5DC 3OJAA 4P91A 3RW7A 4R58A 3WPFA 4XSQA 3E4GA 3WN4A 4XGOA 3ULAA 4Z64C 2Z63A 4Z94G 1OZNA 4I6JB 4LI1A 2IFGA 3OGKB 3WPDA 1M9SA 4BSUA 5HZLB 2WFHA 5IJCA 4AW4A 1KOOA 1OTNA 2CA6A 1SQ0B 1O6SA 1OTOA 4QXEA 4Y61B 2JQDA 2V9SA 3WPBA 4ECOA 2Z62A 2JE1A 3P72A 4CNMA 5B4PA 5GMFA 4YEBB 4QC0A 3REZA 5HDHA 4B8CD 3PMHG 4CP6A 2Q4GW 3OGMB 4Q3IA 1KOHA 1IO0A 5CMNA 2ELLA 4M7EA 4R6AA 4R0AA 4H09A 3WPGA 2Z81A 4KXFB 4BSRA 2Z7XB 1GWBA 4FS7A 1QYYA 2A0ZA 5B0TA 1OTMA 4RWTC 4LSAA 3RIZA 1OOKG 5GS0A 3ULVA 2Z82A 3RW6A 5B0NA 4PQ8A 1P8TA 1A9NA 1Z7XW 2Z66A 4R5DA 2Y5QA 1XECA 4V2CA 4U08A 3W3GA 4HQ1A
chains in the Genus database with same CATH superfamily
3DZEA 3UL8A 4P8SA 5GMHA 4FDWA 2OMUA 4BV4R 2ID5A 3CIYA 3G06A 2OMWA 3CIGA 3G3BA 3OJAB 2Z65A 3W3NA 3M19A 2Z64A 4M7EC 4CNCA 4EZGA 4GLPA 5AWBA 4PERA 3RGZA 1ZIWA 2XOTA 1K5GC 4QBZA 2FT3A 4L3FA 1DFJI 5IYXC 5GS2B 4AY9X 3ZYJA 5FTTB 3O6NA 1WWLA 2O6QA 1JL5A 5AWAA 5A5CA 1PGVA 2OMTA 3RFEA 4MQWX 1DCEA 4FD0A 4C2AB 3O53A 3C6PB 2XWTC 4UFRA 4R08A 4GT6A 3C6NB 3A79B 2P1QB 4TZHA 2UZYA 1LTXA 3WPEA 3WPHA 1P9AG 1M10B 3G04C 2P1MB 3M18A 4U09A 4V2DA 4LSCA 3SB4A 4NKHA 5AZ5A 4Z79A 3UL7A 4J0MA 4Q62A 4U7LA 2UZXA 4V2EA 2Z7XA 4R09A 3W3JA 2OMYA 4PSJA 4LI2A 4RCWA 4FMZA 2P1PB 2OMVA 5AWCA 1A4YA 2R9UA 3JB9j 1OGQA 1O6VA 3E6JA 1FO1A 4LSXC 1YRGA 4L3AA 3KJ4A 5D3IA 3RFSA 2V9TB 4LXSA 4Q3GA 2RR6A 1M0ZA 3TSRE 1FT8A 4Z61C 1XWDC 4R6GA 3ZYNA 1H6UA 3W3MA 5IJDA 3BZ5A 1M9LA 1G9UA 1XEUA 2WQWA 1U0ND 2RA8A 4FCGA 3G39A 4CC4A 2OMXA 3OGLB 4U06A 4C2BB 2WQXA 2ASSB 3VQ2A 4R5CA 1P8VA 3W3KA 5GMGA 4RCAB 2O6SA 4LSXA 3ZYIA 4ARRA 2WQUA 5AWDA 1XCDA 2JE0A 4NZRM 1O6TA 4IM6A 1D0BA 2BEXA 3FXIA 4J4LA 3ULUA 3UN9A 3G3AA 5CMPA 2P1OB 4ECNA 4OQTA 4G8AA 4LXRA 4MN8B 1XKUA 3UL9A 4Z8GA 2OMZA 4PKIG 3RGXA 4R6JA 2WQVA 3GOZA 3WPCA 1FQVA 4WP6A 1DS9A 5IJBA 4XOSA 1FS2A 2BNHA 4CC4C 3CVRA 4KNGA 3WPIA 4K17A 4NKGA 3ZYOA 1W8AA 2V70A 3E2JA 4ARNA 5LFNA 2ASTB 3E3ZA 4R6FA 4BSSA 4WYKA 4R07A 3VQ1A 3RJ0A 5GQRK 3C6OB 4KT1A 2P1NB 1H6TA 4CILA 4PEQB 3W3LA 2O6RA 4FHOA 3RFJA 1K5DC 3OJAA 4P91A 3RW7A 3WPFA 4R58A 4XSQA 3E4GA 3WN4A 4XGOA 3ULAA 4Z64C 2Z63A 4Z94G 1OZNA 4I6JB 4LI1A 2IFGA 3OGKB 3WPDA 1M9SA 4BSUA 5HZLB 2WFHA 5IJCA 4AW4A 1KOOA 1OTNA 2CA6A 1SQ0B 1O6SA 1OTOA 4QXEA 4Y61B 2JQDA 2V9SA 3WPBA 4ECOA 2Z62A 2JE1A 3P72A 4CNMA 5B4PA 5GMFA 4YEBB 4QC0A 3REZA 5HDHA 4B8CD 3PMHG 4CP6A 2Q4GW 3OGMB 4Q3IA 1KOHA 1IO0A 5CMNA 2ELLA 4M7EA 4R6AA 4R0AA 4H09A 3WPGA 2Z81A 4KXFB 4BSRA 2Z7XB 1GWBA 4FS7A 1QYYA 2A0ZA 5B0TA 1OTMA 4RWTC 4LSAA 3RIZA 1OOKG 5GS0A 3ULVA 2Z82A 3RW6A 5B0NA 4PQ8A 1P8TA 1A9NA 4NZTM 1Z7XW 2Z66A 4R5DA 2Y5QA 1XECA 4V2CA 4U08A 3W3GA 4HQ1A
chains in the Genus database with same CATH topology
3DZEA 3UL8A 4P8SA 5GMHA 4FDWA 2OMUA 4BV4R 2ID5A 3CIYA 3G06A 2OMWA 3CIGA 3G3BA 3OJAB 2Z65A 3W3NA 3M19A 2Z64A 4M7EC 4CNCA 4EZGA 4GLPA 5AWBA 4PERA 3RGZA 1ZIWA 2XOTA 1K5GC 4QBZA 2FT3A 4L3FA 1DFJI 5IYXC 5GS2B 4AY9X 3ZYJA 5FTTB 3O6NA 1WWLA 2O6QA 1JL5A 5AWAA 5A5CA 1PGVA 2OMTA 3RFEA 4MQWX 1DCEA 4FD0A 4C2AB 3O53A 3C6PB 2XWTC 4UFRA 4R08A 4GT6A 3C6NB 3A79B 2P1QB 4TZHA 2UZYA 1LTXA 3WPEA 3WPHA 1P9AG 1M10B 3G04C 2P1MB 3M18A 4U09A 4V2DA 4LSCA 3SB4A 4NKHA 5AZ5A 4Z79A 3UL7A 4J0MA 4Q62A 4U7LA 2UZXA 4V2EA 2Z7XA 4R09A 3W3JA 2OMYA 4PSJA 4LI2A 4RCWA 4FMZA 2P1PB 2OMVA 5AWCA 1A4YA 2R9UA 3JB9j 1OGQA 1O6VA 3E6JA 1FO1A 4LSXC 1YRGA 4L3AA 3KJ4A 5D3IA 3RFSA 2V9TB 4LXSA 4Q3GA 2RR6A 1M0ZA 3TSRE 1FT8A 4Z61C 1XWDC 4R6GA 3ZYNA 1H6UA 3W3MA 5IJDA 3BZ5A 1M9LA 1G9UA 1XEUA 2WQWA 1U0ND 2RA8A 4FCGA 3G39A 4CC4A 2OMXA 3OGLB 4U06A 4C2BB 2WQXA 2ASSB 3VQ2A 4R5CA 1P8VA 3W3KA 5GMGA 4RCAB 2O6SA 4LSXA 3ZYIA 4ARRA 2WQUA 5AWDA 1XCDA 2JE0A 1O6TA 4IM6A 1D0BA 2BEXA 3FXIA 4J4LA 3ULUA 3UN9A 3G3AA 5CMPA 2P1OB 4ECNA 4OQTA 4G8AA 4LXRA 4MN8B 1XKUA 3UL9A 4Z8GA 2OMZA 4PKIG 3RGXA 4R6JA 2WQVA 3GOZA 3WPCA 1FQVA 4WP6A 1DS9A 5IJBA 4XOSA 1FS2A 2BNHA 4CC4C 3CVRA 4KNGA 3WPIA 4K17A 4NKGA 3ZYOA 1W8AA 2V70A 3E2JA 4ARNA 5LFNA 2ASTB 3E3ZA 4R6FA 4BSSA 4WYKA 4R07A 3VQ1A 3RJ0A 5GQRK 3C6OB 4KT1A 2P1NB 1H6TA 4CILA 4PEQB 3W3LA 2O6RA 4FHOA 3RFJA 1K5DC 3OJAA 4P91A 3RW7A 4R58A 3WPFA 4XSQA 3E4GA 3WN4A 4XGOA 3ULAA 4Z64C 2Z63A 4Z94G 1OZNA 4I6JB 4LI1A 2IFGA 3OGKB 3WPDA 1M9SA 4BSUA 5HZLB 2WFHA 5IJCA 4AW4A 1KOOA 1OTNA 2CA6A 1SQ0B 1O6SA 1OTOA 4QXEA 4Y61B 2JQDA 2V9SA 3WPBA 4ECOA 2Z62A 2JE1A 3P72A 4CNMA 5B4PA 5GMFA 4YEBB 4QC0A 3REZA 5HDHA 4B8CD 3PMHG 4CP6A 2Q4GW 3OGMB 4Q3IA 1KOHA 1IO0A 5CMNA 2ELLA 4M7EA 4R6AA 4R0AA 4H09A 3WPGA 2Z81A 4KXFB 4BSRA 2Z7XB 1GWBA 4FS7A 1QYYA 2A0ZA 5B0TA 1OTMA 4RWTC 4LSAA 3RIZA 1OOKG 5GS0A 3ULVA 2Z82A 3RW6A 5B0NA 4PQ8A 1P8TA 1A9NA 1Z7XW 2Z66A 4R5DA 2Y5QA 1XECA 4V2CA 4U08A 3W3GA 4HQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZE A;  3UL8 A;  4P8S A;  5GMH A;  4FDW A;  2OMU A;  4BV4 R;  2ID5 A;  3CIY A;  3G06 A;  2OMW A;  3CIG A;  3G3B A;  3OJA B;  2Z65 A;  3W3N A;  3M19 A;  2Z64 A;  4M7E C;  4CNC A;  4EZG A;  4GLP A;  5AWB A;  4PER A;  3RGZ A;  1ZIW A;  2XOT A;  1K5G C;  4QBZ A;  2FT3 A;  4L3F A;  1DFJ I;  5IYX C;  5GS2 B;  4AY9 X;  3ZYJ A;  5FTT B;  3O6N A;  1WWL A;  2O6Q A;  1JL5 A;  5AWA A;  5A5C A;  1PGV A;  2OMT A;  3RFE A;  4MQW X;  1DCE A;  4FD0 A;  4C2A B;  3O53 A;  3C6P B;  2XWT C;  4UFR A;  4R08 A;  4GT6 A;  3C6N B;  3A79 B;  2P1Q B;  4TZH A;  2UZY A;  1LTX A;  3WPE A;  3WPH A;  1P9A G;  1M10 B;  3G04 C;  2P1M B;  3M18 A;  4U09 A;  4V2D A;  4LSC A;  3SB4 A;  4NKH A;  5AZ5 A;  4Z79 A;  3UL7 A;  4J0M A;  4Q62 A;  4U7L A;  2UZX A;  4V2E A;  2Z7X A;  4R09 A;  3W3J A;  2OMY A;  4PSJ A;  4LI2 A;  4RCW A;  4FMZ A;  2P1P B;  2OMV A;  5AWC A;  1A4Y A;  2R9U A;  3JB9 j;  1OGQ A;  1O6V A;  3E6J A;  1FO1 A;  4LSX C;  1YRG A;  4L3A A;  3KJ4 A;  5D3I A;  3RFS A;  2V9T B;  4LXS A;  4Q3G A;  2RR6 A;  1M0Z A;  3TSR E;  1FT8 A;  4Z61 C;  1XWD C;  4R6G A;  3ZYN A;  1H6U A;  3W3M A;  5IJD A;  3BZ5 A;  1M9L A;  1G9U A;  1XEU A;  2WQW A;  1U0N D;  2RA8 A;  4FCG A;  3G39 A;  4CC4 A;  2OMX A;  3OGL B;  4U06 A;  4C2B B;  2WQX A;  2ASS B;  3VQ2 A;  4R5C A;  1P8V A;  3W3K A;  5GMG A;  4RCA B;  2O6S A;  4LSX A;  3ZYI A;  4ARR A;  2WQU A;  5AWD A;  1XCD A;  2JE0 A;  1O6T A;  4IM6 A;  1D0B A;  2BEX A;  3FXI A;  4J4L A;  3ULU A;  3UN9 A;  3G3A A;  5CMP A;  2P1O B;  4ECN A;  4OQT A;  4G8A A;  4LXR A;  4MN8 B;  1XKU A;  3UL9 A;  4Z8G A;  2OMZ A;  4PKI G;  3RGX A;  4R6J A;  2WQV A;  3GOZ A;  3WPC A;  1FQV A;  4WP6 A;  1DS9 A;  5IJB A;  4XOS A;  1FS2 A;  2BNH A;  4CC4 C;  3CVR A;  4KNG A;  3WPI A;  4K17 A;  4NKG A;  3ZYO A;  1W8A A;  2V70 A;  3E2J A;  4ARN A;  5LFN A;  2AST B;  3E3Z A;  4R6F A;  4BSS A;  4WYK A;  4R07 A;  3VQ1 A;  3RJ0 A;  5GQR K;  3C6O B;  4KT1 A;  2P1N B;  1H6T A;  4CIL A;  4PEQ B;  3W3L A;  2O6R A;  4FHO A;  3RFJ A;  1K5D C;  3OJA A;  4P91 A;  3RW7 A;  4R58 A;  3WPF A;  4XSQ A;  3E4G A;  3WN4 A;  4XGO A;  3ULA A;  4Z64 C;  2Z63 A;  4Z94 G;  1OZN A;  4I6J B;  4LI1 A;  2IFG A;  3OGK B;  3WPD A;  1M9S A;  4BSU A;  5HZL B;  2WFH A;  5IJC A;  4AW4 A;  1KOO A;  1OTN A;  2CA6 A;  1SQ0 B;  1O6S A;  1OTO A;  4QXE A;  4Y61 B;  2JQD A;  2V9S A;  3WPB A;  4ECO A;  2Z62 A;  2JE1 A;  3P72 A;  4CNM A;  5B4P A;  5GMF A;  4YEB B;  4QC0 A;  3REZ A;  5HDH A;  4B8C D;  3PMH G;  4CP6 A;  2Q4G W;  3OGM B;  4Q3I A;  1KOH A;  1IO0 A;  5CMN A;  2ELL A;  4M7E A;  4R6A A;  4R0A A;  4H09 A;  3WPG A;  2Z81 A;  4KXF B;  4BSR A;  2Z7X B;  1GWB A;  4FS7 A;  1QYY A;  2A0Z A;  5B0T A;  1OTM A;  4RWT C;  4LSA A;  3RIZ A;  1OOK G;  5GS0 A;  3ULV A;  2Z82 A;  3RW6 A;  5B0N A;  4PQ8 A;  1P8T A;  1A9N A;  1Z7X W;  2Z66 A;  4R5D A;  2Y5Q A;  1XEC A;  4V2C A;  4U08 A;  3W3G A;  4HQ1 A; 
#chains in the Genus database with same CATH topology
 3DZE A;  3UL8 A;  4P8S A;  5GMH A;  4FDW A;  2OMU A;  4BV4 R;  2ID5 A;  3CIY A;  3G06 A;  2OMW A;  3CIG A;  3G3B A;  3OJA B;  2Z65 A;  3W3N A;  3M19 A;  2Z64 A;  4M7E C;  4CNC A;  4EZG A;  4GLP A;  5AWB A;  4PER A;  3RGZ A;  1ZIW A;  2XOT A;  1K5G C;  4QBZ A;  2FT3 A;  4L3F A;  1DFJ I;  5IYX C;  5GS2 B;  4AY9 X;  3ZYJ A;  5FTT B;  3O6N A;  1WWL A;  2O6Q A;  1JL5 A;  5AWA A;  5A5C A;  1PGV A;  2OMT A;  3RFE A;  4MQW X;  1DCE A;  4FD0 A;  4C2A B;  3O53 A;  3C6P B;  2XWT C;  4UFR A;  4R08 A;  4GT6 A;  3C6N B;  3A79 B;  2P1Q B;  4TZH A;  2UZY A;  1LTX A;  3WPE A;  3WPH A;  1P9A G;  1M10 B;  3G04 C;  2P1M B;  3M18 A;  4U09 A;  4V2D A;  4LSC A;  3SB4 A;  4NKH A;  5AZ5 A;  4Z79 A;  3UL7 A;  4J0M A;  4Q62 A;  4U7L A;  2UZX A;  4V2E A;  2Z7X A;  4R09 A;  3W3J A;  2OMY A;  4PSJ A;  4LI2 A;  4RCW A;  4FMZ A;  2P1P B;  2OMV A;  5AWC A;  1A4Y A;  2R9U A;  3JB9 j;  1OGQ A;  1O6V A;  3E6J A;  1FO1 A;  4LSX C;  1YRG A;  4L3A A;  3KJ4 A;  5D3I A;  3RFS A;  2V9T B;  4LXS A;  4Q3G A;  2RR6 A;  1M0Z A;  3TSR E;  1FT8 A;  4Z61 C;  1XWD C;  4R6G A;  3ZYN A;  1H6U A;  3W3M A;  5IJD A;  3BZ5 A;  1M9L A;  1G9U A;  1XEU A;  2WQW A;  1U0N D;  2RA8 A;  4FCG A;  3G39 A;  4CC4 A;  2OMX A;  3OGL B;  4U06 A;  4C2B B;  2WQX A;  2ASS B;  3VQ2 A;  4R5C A;  1P8V A;  3W3K A;  5GMG A;  4RCA B;  2O6S A;  4LSX A;  3ZYI A;  4ARR A;  2WQU A;  5AWD A;  1XCD A;  2JE0 A;  4NZR M;  1O6T A;  4IM6 A;  1D0B A;  2BEX A;  3FXI A;  4J4L A;  3ULU A;  3UN9 A;  3G3A A;  5CMP A;  2P1O B;  4ECN A;  4OQT A;  4G8A A;  4LXR A;  4MN8 B;  1XKU A;  3UL9 A;  4Z8G A;  2OMZ A;  4PKI G;  3RGX A;  4R6J A;  2WQV A;  3GOZ A;  3WPC A;  1FQV A;  4WP6 A;  1DS9 A;  5IJB A;  4XOS A;  1FS2 A;  2BNH A;  4CC4 C;  3CVR A;  4KNG A;  3WPI A;  4K17 A;  4NKG A;  3ZYO A;  1W8A A;  2V70 A;  3E2J A;  4ARN A;  5LFN A;  2AST B;  3E3Z A;  4R6F A;  4BSS A;  4WYK A;  4R07 A;  3VQ1 A;  3RJ0 A;  5GQR K;  3C6O B;  4KT1 A;  2P1N B;  1H6T A;  4CIL A;  4PEQ B;  3W3L A;  2O6R A;  4FHO A;  3RFJ A;  1K5D C;  3OJA A;  4P91 A;  3RW7 A;  3WPF A;  4R58 A;  4XSQ A;  3E4G A;  3WN4 A;  4XGO A;  3ULA A;  4Z64 C;  2Z63 A;  4Z94 G;  1OZN A;  4I6J B;  4LI1 A;  2IFG A;  3OGK B;  3WPD A;  1M9S A;  4BSU A;  5HZL B;  2WFH A;  5IJC A;  4AW4 A;  1KOO A;  1OTN A;  2CA6 A;  1SQ0 B;  1O6S A;  1OTO A;  4QXE A;  4Y61 B;  2JQD A;  2V9S A;  3WPB A;  4ECO A;  2Z62 A;  2JE1 A;  3P72 A;  4CNM A;  5B4P A;  5GMF A;  4YEB B;  4QC0 A;  3REZ A;  5HDH A;  4B8C D;  3PMH G;  4CP6 A;  2Q4G W;  3OGM B;  4Q3I A;  1KOH A;  1IO0 A;  5CMN A;  2ELL A;  4M7E A;  4R6A A;  4R0A A;  4H09 A;  3WPG A;  2Z81 A;  4KXF B;  4BSR A;  2Z7X B;  1GWB A;  4FS7 A;  1QYY A;  2A0Z A;  5B0T A;  1OTM A;  4RWT C;  4LSA A;  3RIZ A;  1OOK G;  5GS0 A;  3ULV A;  2Z82 A;  3RW6 A;  5B0N A;  4PQ8 A;  1P8T A;  1A9N A;  4NZT M;  1Z7X W;  2Z66 A;  4R5D A;  2Y5Q A;  1XEC A;  4V2C A;  4U08 A;  3W3G A;  4HQ1 A; 
#chains in the Genus database with same CATH homology
 3DZE A;  3UL8 A;  4P8S A;  5GMH A;  4FDW A;  2OMU A;  4BV4 R;  2ID5 A;  3CIY A;  3G06 A;  2OMW A;  3CIG A;  3G3B A;  3OJA B;  2Z65 A;  3W3N A;  3M19 A;  2Z64 A;  4M7E C;  4CNC A;  4EZG A;  4GLP A;  5AWB A;  4PER A;  3RGZ A;  1ZIW A;  2XOT A;  1K5G C;  4QBZ A;  2FT3 A;  4L3F A;  1DFJ I;  5IYX C;  5GS2 B;  4AY9 X;  3ZYJ A;  5FTT B;  3O6N A;  1WWL A;  2O6Q A;  1JL5 A;  5AWA A;  5A5C A;  1PGV A;  2OMT A;  3RFE A;  4MQW X;  1DCE A;  4FD0 A;  4C2A B;  3O53 A;  3C6P B;  2XWT C;  4UFR A;  4R08 A;  4GT6 A;  3C6N B;  3A79 B;  2P1Q B;  4TZH A;  2UZY A;  1LTX A;  3WPE A;  3WPH A;  1P9A G;  1M10 B;  3G04 C;  2P1M B;  3M18 A;  4U09 A;  4V2D A;  4LSC A;  3SB4 A;  4NKH A;  5AZ5 A;  4Z79 A;  3UL7 A;  4J0M A;  4Q62 A;  4U7L A;  2UZX A;  4V2E A;  2Z7X A;  4R09 A;  3W3J A;  2OMY A;  4PSJ A;  4LI2 A;  4RCW A;  4FMZ A;  2P1P B;  2OMV A;  5AWC A;  1A4Y A;  2R9U A;  3JB9 j;  1OGQ A;  1O6V A;  3E6J A;  1FO1 A;  4LSX C;  1YRG A;  4L3A A;  3KJ4 A;  5D3I A;  3RFS A;  2V9T B;  4LXS A;  4Q3G A;  2RR6 A;  1M0Z A;  3TSR E;  1FT8 A;  4Z61 C;  1XWD C;  4R6G A;  3ZYN A;  1H6U A;  3W3M A;  5IJD A;  3BZ5 A;  1M9L A;  1G9U A;  1XEU A;  2WQW A;  1U0N D;  2RA8 A;  4FCG A;  3G39 A;  4CC4 A;  2OMX A;  3OGL B;  4U06 A;  4C2B B;  2WQX A;  2ASS B;  3VQ2 A;  4R5C A;  1P8V A;  3W3K A;  5GMG A;  4RCA B;  2O6S A;  4LSX A;  3ZYI A;  4ARR A;  2WQU A;  5AWD A;  1XCD A;  2JE0 A;  1O6T A;  4IM6 A;  1D0B A;  2BEX A;  3FXI A;  4J4L A;  3ULU A;  3UN9 A;  3G3A A;  5CMP A;  2P1O B;  4ECN A;  4OQT A;  4G8A A;  4LXR A;  4MN8 B;  1XKU A;  3UL9 A;  4Z8G A;  2OMZ A;  4PKI G;  3RGX A;  4R6J A;  2WQV A;  3GOZ A;  3WPC A;  1FQV A;  4WP6 A;  1DS9 A;  5IJB A;  4XOS A;  1FS2 A;  2BNH A;  4CC4 C;  3CVR A;  4KNG A;  3WPI A;  4K17 A;  4NKG A;  3ZYO A;  1W8A A;  2V70 A;  3E2J A;  4ARN A;  5LFN A;  2AST B;  3E3Z A;  4R6F A;  4BSS A;  4WYK A;  4R07 A;  3VQ1 A;  3RJ0 A;  5GQR K;  3C6O B;  4KT1 A;  2P1N B;  1H6T A;  4CIL A;  4PEQ B;  3W3L A;  2O6R A;  4FHO A;  3RFJ A;  1K5D C;  3OJA A;  4P91 A;  3RW7 A;  4R58 A;  3WPF A;  4XSQ A;  3E4G A;  3WN4 A;  4XGO A;  3ULA A;  4Z64 C;  2Z63 A;  4Z94 G;  1OZN A;  4I6J B;  4LI1 A;  2IFG A;  3OGK B;  3WPD A;  1M9S A;  4BSU A;  5HZL B;  2WFH A;  5IJC A;  4AW4 A;  1KOO A;  1OTN A;  2CA6 A;  1SQ0 B;  1O6S A;  1OTO A;  4QXE A;  4Y61 B;  2JQD A;  2V9S A;  3WPB A;  4ECO A;  2Z62 A;  2JE1 A;  3P72 A;  4CNM A;  5B4P A;  5GMF A;  4YEB B;  4QC0 A;  3REZ A;  5HDH A;  4B8C D;  3PMH G;  4CP6 A;  2Q4G W;  3OGM B;  4Q3I A;  1KOH A;  1IO0 A;  5CMN A;  2ELL A;  4M7E A;  4R6A A;  4R0A A;  4H09 A;  3WPG A;  2Z81 A;  4KXF B;  4BSR A;  2Z7X B;  1GWB A;  4FS7 A;  1QYY A;  2A0Z A;  5B0T A;  1OTM A;  4RWT C;  4LSA A;  3RIZ A;  1OOK G;  5GS0 A;  3ULV A;  2Z82 A;  3RW6 A;  5B0N A;  4PQ8 A;  1P8T A;  1A9N A;  1Z7X W;  2Z66 A;  4R5D A;  2Y5Q A;  1XEC A;  4V2C A;  4U08 A;  3W3G A;  4HQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...