4LSXC

Plant steroid receptor ectodomain bound to brassinolide and serk1 co-receptor ectodomain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
NLEGDALHTLRVTLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTNITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSHPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BRASSINOSTEROID INSENSITIVE 1
publication title Molecular mechanism for plant steroid receptor activation by somatic embryogenesis co-receptor kinases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Steroid binding protein/protein binding
total genus 46
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4lsxC00
4QBZA 4RCAB 4V2EA 4U09A 2Z81A 4I6JB 5CMPA 4L3AA 2V9TB 3DZEA 4R5DA 4NKGA 4CC4A 4R6GA 4FCGA 5D3IA 4FDWA 5IJBA 3WPIA 4PSJA 3E6JA 3WPBA 1LTXA 4R5CA 4ARNA 4ECOA 3ULAA 2BNHA 3M18A 5CMNA 4Z61C 2Z65A 5GMGA 5B0TA 1O6TA 2ASTB 3OGMB 5HZLB 4Y61B 3G06A 1XWDC 1ZIWA 4R6AA 4AW4A 3E3ZA 5AWAA 2IFGA 2WQVA 4GT6A 1M10B 3W3KA 1OZNA 2XOTA 3PMHG 3O53A 4UFRA 3RGXA 2Z64A 4XGOA 1H6UA 3VQ2A 3W3NA 5FTTB 1K5DC 4U06A 4C2AB 3E2JA 1A4YA 4G8AA 5A5CA 3G3AA 4FMZA 3JB9j 4RCWA 4R08A 3ZYIA 3KJ4A 2O6RA 3W3JA 5IJDA 4KT1A 2ID5A 4Q3GA 3RGZA 2R9UA 1OGQA 1PGVA 4NKHA 4KXFB 2V70A 4FHOA 3FXIA 3CIYA 4QC0A 3E4GA 2WQWA 3WPEA 5IYXC 3ULUA 4BV4R 4CP6A 4Z79A 5GMFA 1IO0A 2WQXA 1DFJI 4WYKA 4CNCA 2Z62A 3M19A 3P72A 3ZYNA 4XSQA 3RIZA 3VQ1A 2OMYA 3OJAA 4HQ1A 5B4PA 4BSUA 3G3BA 4H09A 3WPDA 1XECA 4LI1A 3WPHA 3UL9A 4Z8GA 4LXSA 2WQUA 3O6NA 4B8CD 4XOSA 3C6PB 1P8TA 2V9SA 4PEQB 4Q62A 3RFEA 4LXRA 2Z82A 4PERA 4EZGA 2O6SA 5HDHA 5AWBA 3UL8A 2RA8A 1OTOA 3UN9A 1OOKG 3RW6A 4U08A 3OJAB 1P9AG 3W3GA 4R58A 4TZHA 4QXEA 4PKIG 2ASSB 3C6OB 3RW7A 3WN4A 1WWLA 3TSRE 4RWTC 4J0MA 2JE1A 3G39A 2OMZA 5GS0A 4CILA 2Z7XA 4Q3IA 5B0NA 1FT8A 4KNGA 4P91A 2A0ZA 5AZ5A 3RFSA 4M7EC 4M7EA 3WPCA 4C2BB 2OMWA 2Q4GW 4R09A 5GS2B 3WPGA 1M0ZA 1SQ0B 4ARRA 2UZYA 4K17A 2OMTA 5GMHA 5IJCA 2O6QA 1W8AA 2JQDA 3GOZA 1FS2A 1KOHA 2Z66A 4BSRA 4V2DA 2FT3A 4YEBB 2Z63A 3REZA 4Z94G 4P8SA 2Y5QA 2Z7XB 3ZYOA 2OMXA 2XWTC 4LSAA 2JE0A 1M9LA 1OTMA 4AY9X 2UZXA 4LI2A 3ZYJA 1M9SA 2ELLA 1A9NA 5AWDA 2OMUA 2P1QB 2OMVA 3WPFA 5LFNA 4MQWX 4CC4C 1P8VA 1G9UA 4R07A 4CNMA 4U7LA 1XKUA 1DS9A 1XCDA 3A79B 4J4LA 1H6TA 3W3MA 2BEXA 1U0ND 2P1NB 4FD0A 1OTNA 2P1MB 2P1PB 5GQRK 4WP6A 4ECNA 3BZ5A 3OGKB 3OGLB 5AWCA 3RFJA 3G04C 4LSXC 4LSXA 4L3FA 3UL7A 3CVRA 1Z7XW 3RJ0A 3C6NB 1K5GC 1DCEA 3SB4A 3CIGA 1O6SA 1FQVA 2WFHA 4R6FA 2CA6A 1XEUA 3W3LA 4GLPA 4V2CA 1JL5A 3ULVA 4R0AA 2P1OB 4MN8B 1GWBA 4IM6A 4R6JA 1KOOA 1D0BA 4OQTA 1QYYA 4BSSA 4PQ8A 1YRGA 1O6VA 2RR6A 4Z64C 4FS7A 1FO1A 4LSCA
chains in the Genus database with same CATH superfamily
4QBZA 4RCAB 4V2EA 4U09A 2Z81A 4I6JB 5CMPA 4L3AA 2V9TB 3DZEA 4R5DA 4NKGA 4CC4A 4R6GA 4FCGA 5D3IA 4FDWA 5IJBA 3WPIA 4PSJA 3E6JA 3WPBA 1LTXA 4R5CA 4ARNA 4ECOA 3ULAA 2BNHA 3M18A 5CMNA 4Z61C 2Z65A 5GMGA 5B0TA 1O6TA 2ASTB 3OGMB 5HZLB 4Y61B 3G06A 1XWDC 1ZIWA 4R6AA 4AW4A 3E3ZA 5AWAA 2IFGA 2WQVA 4GT6A 1M10B 3W3KA 1OZNA 2XOTA 3PMHG 3O53A 4UFRA 3RGXA 2Z64A 4XGOA 1H6UA 3VQ2A 3W3NA 5FTTB 1K5DC 4U06A 4C2AB 3E2JA 1A4YA 4G8AA 5A5CA 3G3AA 4FMZA 3JB9j 4RCWA 4R08A 3ZYIA 4NZRM 3KJ4A 2O6RA 3W3JA 5IJDA 4KT1A 2ID5A 4Q3GA 3RGZA 2R9UA 1OGQA 1PGVA 4NKHA 4KXFB 2V70A 4FHOA 3FXIA 3CIYA 4QC0A 3E4GA 2WQWA 3WPEA 5IYXC 3ULUA 4BV4R 4CP6A 4Z79A 5GMFA 1IO0A 2WQXA 1DFJI 4WYKA 4CNCA 2Z62A 3M19A 3P72A 3ZYNA 4XSQA 3RIZA 3VQ1A 2OMYA 3OJAA 4HQ1A 5B4PA 4BSUA 3G3BA 4H09A 3WPDA 1XECA 4LI1A 3WPHA 3UL9A 4Z8GA 4LXSA 2WQUA 3O6NA 4B8CD 4XOSA 3C6PB 1P8TA 2V9SA 4PEQB 4Q62A 3RFEA 4LXRA 2Z82A 4PERA 4EZGA 2O6SA 5HDHA 5AWBA 3UL8A 2RA8A 1OTOA 3UN9A 1OOKG 3RW6A 4U08A 3OJAB 1P9AG 3W3GA 4R58A 4TZHA 4QXEA 4PKIG 2ASSB 3C6OB 3RW7A 3WN4A 1WWLA 3TSRE 4RWTC 4J0MA 2JE1A 3G39A 2OMZA 5GS0A 4CILA 2Z7XA 4Q3IA 5B0NA 1FT8A 4KNGA 4P91A 2A0ZA 5AZ5A 3RFSA 4M7EC 4M7EA 3WPCA 4C2BB 2OMWA 2Q4GW 4R09A 5GS2B 3WPGA 1M0ZA 1SQ0B 4ARRA 2UZYA 4K17A 2OMTA 5GMHA 5IJCA 2O6QA 1W8AA 2JQDA 3GOZA 1FS2A 1KOHA 2Z66A 4BSRA 4V2DA 2FT3A 4NZTM 4YEBB 2Z63A 3REZA 4Z94G 4P8SA 2Y5QA 2Z7XB 3ZYOA 2OMXA 2XWTC 4LSAA 2JE0A 1M9LA 1OTMA 4AY9X 2UZXA 4LI2A 3ZYJA 1M9SA 2ELLA 1A9NA 5AWDA 2OMUA 2P1QB 2OMVA 3WPFA 5LFNA 4MQWX 4CC4C 1P8VA 1G9UA 4R07A 4CNMA 4U7LA 1XKUA 1DS9A 1XCDA 3A79B 4J4LA 1H6TA 3W3MA 2BEXA 1U0ND 2P1NB 4FD0A 1OTNA 2P1MB 2P1PB 5GQRK 4WP6A 4ECNA 3BZ5A 3OGKB 3OGLB 5AWCA 3RFJA 3G04C 4LSXC 4LSXA 4L3FA 3UL7A 3CVRA 1Z7XW 3RJ0A 3C6NB 1K5GC 1DCEA 3SB4A 3CIGA 1O6SA 1FQVA 2WFHA 4R6FA 2CA6A 1XEUA 3W3LA 4GLPA 4V2CA 1JL5A 3ULVA 4R0AA 2P1OB 4MN8B 1GWBA 4IM6A 4R6JA 1KOOA 1D0BA 4OQTA 1QYYA 4BSSA 4PQ8A 1YRGA 1O6VA 2RR6A 4Z64C 4FS7A 1FO1A 4LSCA
chains in the Genus database with same CATH topology
4QBZA 4RCAB 4V2EA 4U09A 2Z81A 4I6JB 5CMPA 4L3AA 2V9TB 3DZEA 4R5DA 4NKGA 4CC4A 4R6GA 4FCGA 5D3IA 4FDWA 5IJBA 3WPIA 4PSJA 3E6JA 3WPBA 1LTXA 4R5CA 4ARNA 4ECOA 3ULAA 2BNHA 3M18A 5CMNA 4Z61C 2Z65A 5GMGA 5B0TA 1O6TA 2ASTB 3OGMB 5HZLB 4Y61B 3G06A 1XWDC 1ZIWA 4R6AA 4AW4A 3E3ZA 5AWAA 2IFGA 2WQVA 4GT6A 1M10B 3W3KA 1OZNA 2XOTA 3PMHG 3O53A 4UFRA 3RGXA 2Z64A 4XGOA 1H6UA 3VQ2A 3W3NA 5FTTB 1K5DC 4U06A 4C2AB 3E2JA 1A4YA 4G8AA 5A5CA 3G3AA 4FMZA 3JB9j 4RCWA 4R08A 3ZYIA 3KJ4A 2O6RA 3W3JA 5IJDA 4KT1A 2ID5A 4Q3GA 3RGZA 2R9UA 1OGQA 1PGVA 4NKHA 4KXFB 2V70A 4FHOA 3FXIA 3CIYA 4QC0A 3E4GA 2WQWA 3WPEA 5IYXC 3ULUA 4BV4R 4CP6A 4Z79A 5GMFA 1IO0A 2WQXA 1DFJI 4WYKA 4CNCA 2Z62A 3M19A 3P72A 3ZYNA 4XSQA 3RIZA 3VQ1A 2OMYA 3OJAA 4HQ1A 5B4PA 4BSUA 3G3BA 4H09A 3WPDA 1XECA 4LI1A 3WPHA 3UL9A 4Z8GA 4LXSA 2WQUA 3O6NA 4B8CD 4XOSA 3C6PB 1P8TA 2V9SA 4PEQB 4Q62A 3RFEA 4LXRA 2Z82A 4PERA 4EZGA 2O6SA 5HDHA 5AWBA 3UL8A 2RA8A 1OTOA 3UN9A 1OOKG 3RW6A 4U08A 3OJAB 1P9AG 3W3GA 4R58A 4TZHA 4QXEA 4PKIG 2ASSB 3C6OB 3RW7A 3WN4A 1WWLA 3TSRE 4RWTC 4J0MA 2JE1A 3G39A 2OMZA 5GS0A 4CILA 2Z7XA 4Q3IA 5B0NA 1FT8A 4KNGA 4P91A 2A0ZA 5AZ5A 3RFSA 4M7EC 4M7EA 3WPCA 4C2BB 2OMWA 2Q4GW 4R09A 5GS2B 3WPGA 1M0ZA 1SQ0B 4ARRA 2UZYA 4K17A 2OMTA 5GMHA 5IJCA 2O6QA 1W8AA 2JQDA 3GOZA 1FS2A 1KOHA 2Z66A 4BSRA 4V2DA 2FT3A 4YEBB 2Z63A 3REZA 4Z94G 4P8SA 2Y5QA 2Z7XB 3ZYOA 2OMXA 2XWTC 4LSAA 2JE0A 1M9LA 1OTMA 4AY9X 2UZXA 4LI2A 3ZYJA 1M9SA 2ELLA 1A9NA 5AWDA 2OMUA 2P1QB 2OMVA 3WPFA 5LFNA 4MQWX 4CC4C 1P8VA 1G9UA 4R07A 4CNMA 4U7LA 1XKUA 1DS9A 1XCDA 3A79B 4J4LA 1H6TA 3W3MA 2BEXA 1U0ND 2P1NB 4FD0A 1OTNA 2P1MB 2P1PB 5GQRK 4WP6A 4ECNA 3BZ5A 3OGKB 3OGLB 5AWCA 3RFJA 3G04C 4LSXC 4LSXA 4L3FA 3UL7A 3CVRA 1Z7XW 3RJ0A 3C6NB 1K5GC 1DCEA 3SB4A 3CIGA 1O6SA 1FQVA 2WFHA 4R6FA 2CA6A 1XEUA 3W3LA 4GLPA 4V2CA 1JL5A 3ULVA 4R0AA 2P1OB 4MN8B 1GWBA 4IM6A 4R6JA 1KOOA 1D0BA 4OQTA 1QYYA 4BSSA 4PQ8A 1YRGA 1O6VA 2RR6A 4Z64C 4FS7A 1FO1A 4LSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QBZ A;  4RCA B;  4V2E A;  4U09 A;  2Z81 A;  4I6J B;  5CMP A;  4L3A A;  2V9T B;  3DZE A;  4R5D A;  4NKG A;  4CC4 A;  4R6G A;  4FCG A;  5D3I A;  4FDW A;  5IJB A;  3WPI A;  4PSJ A;  3E6J A;  3WPB A;  1LTX A;  4R5C A;  4ARN A;  4ECO A;  3ULA A;  2BNH A;  3M18 A;  5CMN A;  4Z61 C;  2Z65 A;  5GMG A;  5B0T A;  1O6T A;  2AST B;  3OGM B;  5HZL B;  4Y61 B;  3G06 A;  1XWD C;  1ZIW A;  4R6A A;  4AW4 A;  3E3Z A;  5AWA A;  2IFG A;  2WQV A;  4GT6 A;  1M10 B;  3W3K A;  1OZN A;  2XOT A;  3PMH G;  3O53 A;  4UFR A;  3RGX A;  2Z64 A;  4XGO A;  1H6U A;  3VQ2 A;  3W3N A;  5FTT B;  1K5D C;  4U06 A;  4C2A B;  3E2J A;  1A4Y A;  4G8A A;  5A5C A;  3G3A A;  4FMZ A;  3JB9 j;  4RCW A;  4R08 A;  3ZYI A;  3KJ4 A;  2O6R A;  3W3J A;  5IJD A;  4KT1 A;  2ID5 A;  4Q3G A;  3RGZ A;  2R9U A;  1OGQ A;  1PGV A;  4NKH A;  4KXF B;  2V70 A;  4FHO A;  3FXI A;  3CIY A;  4QC0 A;  3E4G A;  2WQW A;  3WPE A;  5IYX C;  3ULU A;  4BV4 R;  4CP6 A;  4Z79 A;  5GMF A;  1IO0 A;  2WQX A;  1DFJ I;  4WYK A;  4CNC A;  2Z62 A;  3M19 A;  3P72 A;  3ZYN A;  4XSQ A;  3RIZ A;  3VQ1 A;  2OMY A;  3OJA A;  4HQ1 A;  5B4P A;  4BSU A;  3G3B A;  4H09 A;  3WPD A;  1XEC A;  4LI1 A;  3WPH A;  3UL9 A;  4Z8G A;  4LXS A;  2WQU A;  3O6N A;  4B8C D;  4XOS A;  3C6P B;  1P8T A;  2V9S A;  4PEQ B;  4Q62 A;  3RFE A;  4LXR A;  2Z82 A;  4PER A;  4EZG A;  2O6S A;  5HDH A;  5AWB A;  3UL8 A;  2RA8 A;  1OTO A;  3UN9 A;  1OOK G;  3RW6 A;  4U08 A;  3OJA B;  1P9A G;  3W3G A;  4R58 A;  4TZH A;  4QXE A;  4PKI G;  2ASS B;  3C6O B;  3RW7 A;  3WN4 A;  1WWL A;  3TSR E;  4RWT C;  4J0M A;  2JE1 A;  3G39 A;  2OMZ A;  5GS0 A;  4CIL A;  2Z7X A;  4Q3I A;  5B0N A;  1FT8 A;  4KNG A;  4P91 A;  2A0Z A;  5AZ5 A;  3RFS A;  4M7E C;  4M7E A;  3WPC A;  4C2B B;  2OMW A;  2Q4G W;  4R09 A;  5GS2 B;  3WPG A;  1M0Z A;  1SQ0 B;  4ARR A;  2UZY A;  4K17 A;  2OMT A;  5GMH A;  5IJC A;  2O6Q A;  1W8A A;  2JQD A;  3GOZ A;  1FS2 A;  1KOH A;  2Z66 A;  4BSR A;  4V2D A;  2FT3 A;  4YEB B;  2Z63 A;  3REZ A;  4Z94 G;  4P8S A;  2Y5Q A;  2Z7X B;  3ZYO A;  2OMX A;  2XWT C;  4LSA A;  2JE0 A;  1M9L A;  1OTM A;  4AY9 X;  2UZX A;  4LI2 A;  3ZYJ A;  1M9S A;  2ELL A;  1A9N A;  5AWD A;  2OMU A;  2P1Q B;  2OMV A;  3WPF A;  5LFN A;  4MQW X;  4CC4 C;  1P8V A;  1G9U A;  4R07 A;  4CNM A;  4U7L A;  1XKU A;  1DS9 A;  1XCD A;  3A79 B;  4J4L A;  1H6T A;  3W3M A;  2BEX A;  1U0N D;  2P1N B;  4FD0 A;  1OTN A;  2P1M B;  2P1P B;  5GQR K;  4WP6 A;  4ECN A;  3BZ5 A;  3OGK B;  3OGL B;  5AWC A;  3RFJ A;  3G04 C;  4LSX C;  4LSX A;  4L3F A;  3UL7 A;  3CVR A;  1Z7X W;  3RJ0 A;  3C6N B;  1K5G C;  1DCE A;  3SB4 A;  3CIG A;  1O6S A;  1FQV A;  2WFH A;  4R6F A;  2CA6 A;  1XEU A;  3W3L A;  4GLP A;  4V2C A;  1JL5 A;  3ULV A;  4R0A A;  2P1O B;  4MN8 B;  1GWB A;  4IM6 A;  4R6J A;  1KOO A;  1D0B A;  4OQT A;  1QYY A;  4BSS A;  4PQ8 A;  1YRG A;  1O6V A;  2RR6 A;  4Z64 C;  4FS7 A;  1FO1 A;  4LSC A; 
#chains in the Genus database with same CATH topology
 4QBZ A;  4RCA B;  4V2E A;  4U09 A;  2Z81 A;  4I6J B;  5CMP A;  4L3A A;  2V9T B;  3DZE A;  4R5D A;  4NKG A;  4CC4 A;  4R6G A;  4FCG A;  5D3I A;  4FDW A;  5IJB A;  3WPI A;  4PSJ A;  3E6J A;  3WPB A;  1LTX A;  4R5C A;  4ARN A;  4ECO A;  3ULA A;  2BNH A;  3M18 A;  5CMN A;  4Z61 C;  2Z65 A;  5GMG A;  5B0T A;  1O6T A;  2AST B;  3OGM B;  5HZL B;  4Y61 B;  3G06 A;  1XWD C;  1ZIW A;  4R6A A;  4AW4 A;  3E3Z A;  5AWA A;  2IFG A;  2WQV A;  4GT6 A;  1M10 B;  3W3K A;  1OZN A;  2XOT A;  3PMH G;  3O53 A;  4UFR A;  3RGX A;  2Z64 A;  4XGO A;  1H6U A;  3VQ2 A;  3W3N A;  5FTT B;  1K5D C;  4U06 A;  4C2A B;  3E2J A;  1A4Y A;  4G8A A;  5A5C A;  3G3A A;  4FMZ A;  3JB9 j;  4RCW A;  4R08 A;  3ZYI A;  4NZR M;  3KJ4 A;  2O6R A;  3W3J A;  5IJD A;  4KT1 A;  2ID5 A;  4Q3G A;  3RGZ A;  2R9U A;  1OGQ A;  1PGV A;  4NKH A;  4KXF B;  2V70 A;  4FHO A;  3FXI A;  3CIY A;  4QC0 A;  3E4G A;  2WQW A;  3WPE A;  5IYX C;  3ULU A;  4BV4 R;  4CP6 A;  4Z79 A;  5GMF A;  1IO0 A;  2WQX A;  1DFJ I;  4WYK A;  4CNC A;  2Z62 A;  3M19 A;  3P72 A;  3ZYN A;  4XSQ A;  3RIZ A;  3VQ1 A;  2OMY A;  3OJA A;  4HQ1 A;  5B4P A;  4BSU A;  3G3B A;  4H09 A;  3WPD A;  1XEC A;  4LI1 A;  3WPH A;  3UL9 A;  4Z8G A;  4LXS A;  2WQU A;  3O6N A;  4B8C D;  4XOS A;  3C6P B;  1P8T A;  2V9S A;  4PEQ B;  4Q62 A;  3RFE A;  4LXR A;  2Z82 A;  4PER A;  4EZG A;  2O6S A;  5HDH A;  5AWB A;  3UL8 A;  2RA8 A;  1OTO A;  3UN9 A;  1OOK G;  3RW6 A;  4U08 A;  3OJA B;  1P9A G;  3W3G A;  4R58 A;  4TZH A;  4QXE A;  4PKI G;  2ASS B;  3C6O B;  3RW7 A;  3WN4 A;  1WWL A;  3TSR E;  4RWT C;  4J0M A;  2JE1 A;  3G39 A;  2OMZ A;  5GS0 A;  4CIL A;  2Z7X A;  4Q3I A;  5B0N A;  1FT8 A;  4KNG A;  4P91 A;  2A0Z A;  5AZ5 A;  3RFS A;  4M7E C;  4M7E A;  3WPC A;  4C2B B;  2OMW A;  2Q4G W;  4R09 A;  5GS2 B;  3WPG A;  1M0Z A;  1SQ0 B;  4ARR A;  2UZY A;  4K17 A;  2OMT A;  5GMH A;  5IJC A;  2O6Q A;  1W8A A;  2JQD A;  3GOZ A;  1FS2 A;  1KOH A;  2Z66 A;  4BSR A;  4V2D A;  2FT3 A;  4NZT M;  4YEB B;  2Z63 A;  3REZ A;  4Z94 G;  4P8S A;  2Y5Q A;  2Z7X B;  3ZYO A;  2OMX A;  2XWT C;  4LSA A;  2JE0 A;  1M9L A;  1OTM A;  4AY9 X;  2UZX A;  4LI2 A;  3ZYJ A;  1M9S A;  2ELL A;  1A9N A;  5AWD A;  2OMU A;  2P1Q B;  2OMV A;  3WPF A;  5LFN A;  4MQW X;  4CC4 C;  1P8V A;  1G9U A;  4R07 A;  4CNM A;  4U7L A;  1XKU A;  1DS9 A;  1XCD A;  3A79 B;  4J4L A;  1H6T A;  3W3M A;  2BEX A;  1U0N D;  2P1N B;  4FD0 A;  1OTN A;  2P1M B;  2P1P B;  5GQR K;  4WP6 A;  4ECN A;  3BZ5 A;  3OGK B;  3OGL B;  5AWC A;  3RFJ A;  3G04 C;  4LSX C;  4LSX A;  4L3F A;  3UL7 A;  3CVR A;  1Z7X W;  3RJ0 A;  3C6N B;  1K5G C;  1DCE A;  3SB4 A;  3CIG A;  1O6S A;  1FQV A;  2WFH A;  4R6F A;  2CA6 A;  1XEU A;  3W3L A;  4GLP A;  4V2C A;  1JL5 A;  3ULV A;  4R0A A;  2P1O B;  4MN8 B;  1GWB A;  4IM6 A;  4R6J A;  1KOO A;  1D0B A;  4OQT A;  1QYY A;  4BSS A;  4PQ8 A;  1YRG A;  1O6V A;  2RR6 A;  4Z64 C;  4FS7 A;  1FO1 A;  4LSC A; 
#chains in the Genus database with same CATH homology
 4QBZ A;  4RCA B;  4V2E A;  4U09 A;  2Z81 A;  4I6J B;  5CMP A;  4L3A A;  2V9T B;  3DZE A;  4R5D A;  4NKG A;  4CC4 A;  4R6G A;  4FCG A;  5D3I A;  4FDW A;  5IJB A;  3WPI A;  4PSJ A;  3E6J A;  3WPB A;  1LTX A;  4R5C A;  4ARN A;  4ECO A;  3ULA A;  2BNH A;  3M18 A;  5CMN A;  4Z61 C;  2Z65 A;  5GMG A;  5B0T A;  1O6T A;  2AST B;  3OGM B;  5HZL B;  4Y61 B;  3G06 A;  1XWD C;  1ZIW A;  4R6A A;  4AW4 A;  3E3Z A;  5AWA A;  2IFG A;  2WQV A;  4GT6 A;  1M10 B;  3W3K A;  1OZN A;  2XOT A;  3PMH G;  3O53 A;  4UFR A;  3RGX A;  2Z64 A;  4XGO A;  1H6U A;  3VQ2 A;  3W3N A;  5FTT B;  1K5D C;  4U06 A;  4C2A B;  3E2J A;  1A4Y A;  4G8A A;  5A5C A;  3G3A A;  4FMZ A;  3JB9 j;  4RCW A;  4R08 A;  3ZYI A;  3KJ4 A;  2O6R A;  3W3J A;  5IJD A;  4KT1 A;  2ID5 A;  4Q3G A;  3RGZ A;  2R9U A;  1OGQ A;  1PGV A;  4NKH A;  4KXF B;  2V70 A;  4FHO A;  3FXI A;  3CIY A;  4QC0 A;  3E4G A;  2WQW A;  3WPE A;  5IYX C;  3ULU A;  4BV4 R;  4CP6 A;  4Z79 A;  5GMF A;  1IO0 A;  2WQX A;  1DFJ I;  4WYK A;  4CNC A;  2Z62 A;  3M19 A;  3P72 A;  3ZYN A;  4XSQ A;  3RIZ A;  3VQ1 A;  2OMY A;  3OJA A;  4HQ1 A;  5B4P A;  4BSU A;  3G3B A;  4H09 A;  3WPD A;  1XEC A;  4LI1 A;  3WPH A;  3UL9 A;  4Z8G A;  4LXS A;  2WQU A;  3O6N A;  4B8C D;  4XOS A;  3C6P B;  1P8T A;  2V9S A;  4PEQ B;  4Q62 A;  3RFE A;  4LXR A;  2Z82 A;  4PER A;  4EZG A;  2O6S A;  5HDH A;  5AWB A;  3UL8 A;  2RA8 A;  1OTO A;  3UN9 A;  1OOK G;  3RW6 A;  4U08 A;  3OJA B;  1P9A G;  3W3G A;  4R58 A;  4TZH A;  4QXE A;  4PKI G;  2ASS B;  3C6O B;  3RW7 A;  3WN4 A;  1WWL A;  3TSR E;  4RWT C;  4J0M A;  2JE1 A;  3G39 A;  2OMZ A;  5GS0 A;  4CIL A;  2Z7X A;  4Q3I A;  5B0N A;  1FT8 A;  4KNG A;  4P91 A;  2A0Z A;  5AZ5 A;  3RFS A;  4M7E C;  4M7E A;  3WPC A;  4C2B B;  2OMW A;  2Q4G W;  4R09 A;  5GS2 B;  3WPG A;  1M0Z A;  1SQ0 B;  4ARR A;  2UZY A;  4K17 A;  2OMT A;  5GMH A;  5IJC A;  2O6Q A;  1W8A A;  2JQD A;  3GOZ A;  1FS2 A;  1KOH A;  2Z66 A;  4BSR A;  4V2D A;  2FT3 A;  4YEB B;  2Z63 A;  3REZ A;  4Z94 G;  4P8S A;  2Y5Q A;  2Z7X B;  3ZYO A;  2OMX A;  2XWT C;  4LSA A;  2JE0 A;  1M9L A;  1OTM A;  4AY9 X;  2UZX A;  4LI2 A;  3ZYJ A;  1M9S A;  2ELL A;  1A9N A;  5AWD A;  2OMU A;  2P1Q B;  2OMV A;  3WPF A;  5LFN A;  4MQW X;  4CC4 C;  1P8V A;  1G9U A;  4R07 A;  4CNM A;  4U7L A;  1XKU A;  1DS9 A;  1XCD A;  3A79 B;  4J4L A;  1H6T A;  3W3M A;  2BEX A;  1U0N D;  2P1N B;  4FD0 A;  1OTN A;  2P1M B;  2P1P B;  5GQR K;  4WP6 A;  4ECN A;  3BZ5 A;  3OGK B;  3OGL B;  5AWC A;  3RFJ A;  3G04 C;  4LSX C;  4LSX A;  4L3F A;  3UL7 A;  3CVR A;  1Z7X W;  3RJ0 A;  3C6N B;  1K5G C;  1DCE A;  3SB4 A;  3CIG A;  1O6S A;  1FQV A;  2WFH A;  4R6F A;  2CA6 A;  1XEU A;  3W3L A;  4GLP A;  4V2C A;  1JL5 A;  3ULV A;  4R0A A;  2P1O B;  4MN8 B;  1GWB A;  4IM6 A;  4R6J A;  1KOO A;  1D0B A;  4OQT A;  1QYY A;  4BSS A;  4PQ8 A;  1YRG A;  1O6V A;  2RR6 A;  4Z64 C;  4FS7 A;  1FO1 A;  4LSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...