2XOTA

Crystal structure of neuronal leucine rich repeat protein amigo-1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
335
structure length
331
Chain Sequence
b'RSVVSCPANCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amphoterin-induced protein 1
publication title Crystal Structure and Role of Glycans and Dimerisation in Folding of Neuronal Leucine-Rich Repeat Protein Amigo-1
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 74
structure length 331
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xotA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2xotA01
4RZCB 5I74C 4PJXB 4OF5A 2JQDA 1T4KA 4J4PD 4WO4C 1NFKA 4OKVB 3RI5F 2O6SA 1CT8A 2AP2A 3MRMA 2PKDA 1EPFA 4U6XB 3R8BB 4YBLB 1T7VA 1UM4L 3TJHC 1LO4H 4PJXE 3RJ0A 4AEEA 1DLHB 2DM2A 4WFHE 1R3JB 4M7KH 3RWJA 2E27L 3GSWA 2YK1H 1W8NA 4K7FB 4LVOC 3OKYA 1NBVH 4DGVH 1FH5H 1X3DA 2N7BA 4LFHD 4G9FE 4ZSOB 1RSFA 1FYHB 1EO8L 5F3BA 4LEOA 5GMFA 5FOBA 1VCAA 1H6UA 5D2NC 4OZHF 2R1XA 4X98A 3W3KA 3O3EB 4PRIA 2GKIA 5J6HA 1ZIWA 2AJVL 3BO8B 1QLFA 1KFAL 4X5WB 4N8VG 3K4DA 1OCWH 1QO3B 3BP6A 3PWNB 4X0KB 3MMEA 4ZSOE 4RGMB 4PB0L 4NCC2 1A6AA 4GKZB 2ESVD 3V6FA 2H2PD 2X1QA 3E6HB 2E7LA 2P24A 1NJ9A 1GRWA 4XMLH 1TENA 2F54B 3QZWG 4X7TB 1OTUC 1XGQA 3GMLA 2Q6WA 1HHIB 3E2HB 3D39E 2XG4A 3T77A 4KRPB 5E6IC 2YA1A 4CU7A 3DETD 1C08A 2GT9B 1FZMB 4S2SA 3DX8B 4MQTB 1EGJH 1Q9WA 1ZHLB 3EFFB 4GKSB 3TIDB 1GAFL 4OFKA 4Y8AA 2CK0H 4JKLA 3SKUD 2OK0L 1S7SB 2DIAA 3FFCA 4J6RL 4X6BA 4PJCA 5EOCJ 4IM8A 2VL5A 1F4XL 4H5SA 4IDJH 1S5IH 2OQJA 1FVDB 5EB9A 4ZQKB 1KIUA 1UB6A 5J12C 3W5MA 5D70L 5TF1H 1Q94A 3QJHA 4Q0XH 1BBJA 3KYMA 4N0YH 3WE6B 3KDMB 3UTSA 3RZWA 2A6DB 3GK8L 1ZWIB 1KOAA 5GRWA 4JM2B 3TH3T 2BMKA 1I9IL 4PG2C 2Q8BL 3VG0L 1RJLB 2G5RA 2R4RH 2YD5A 4JLRA 5D1XC 1XECA 3SE3A 3BWAA 1FRGL 2GYSA 3OKOB 3A6CL 5CGTA 3UYOD 4MNHB 4M7ZB 3A6BH 1ZLUH 4HJ0C 2BSRB 2H1PH 3W3MA 2RCSH 4DUWA 1IEHA 2QQKH 2XN9E 4MLIA 4HKXA 4I77L 4RIRA 4Z5RA 1PQZA 4M62L 4JPVH 1YMHA 2GUOA 4MCZB 4ZFFB 3S4SB 2D7QA 2NY4B 3CVHH 4HAFA 2YEZB 1N0LA 3O0RL 4QXTB 5I9QB 4UB0L 3VJ6B 2Y06L 4PJ7A 2X7LA 2J6EA 4XH2B 4CBPA 5FHAL 5CP7B 3RA7H 2CH8A 1HH6B 1ACZA 1JGVH 1SMAA 1C8PA 5DSCA 4C2BB 1N6UA 1NGYB 1RK1A 5CBEA 3TJHD 2HN7B 4J0MA 2W92A 4O58L 4HC1A 3BN9D 3QDMD 5E1HB 4QRRB 4D9LH 1YN7B 2IPKA 4E5XB 1J1XL 5D7LD 4ZFGH 5LBSL 5E94A 5CJOH 3KWWA 2VDQH 3BX7C 4S1DD 3UYPA 3UC0L 4WHDA 2ZNXA 3CFCL 3DRQB 3SGJC 3TYFA 1WV7T 5ANMB 3QCUL 2ZUYA 2A1WH 4CN1A 4HBCH 3MRRA 3OKDB 5F8QC 1FFOB 1RFDL 5IMOA 3ZE0F 3SO3C 4R0AA 5D72L 4XWGH 4S1RH 4XCCH 4NNPL 4NZTH 4PJAF 3QAZC 3O8XC 4Y5VA 4UINL 3KYNA 2IWGA 4AJ0A 2X4RB 1Z7XW 1CIUA 3OG6B 4YDVA 3M1BA 4JO3L 5B38B 1YN6B 1G7JB 2CUIA 4JY5L 5I1GL 3QCTH 3TO2A 1E27B 2DD8L 2ADFH 1MFBL 4CNIB 5EUOE 4EUPB 4PRDA 4XBEL 3CIQA 3PWLA 5J1SC 5J6GA 3V5DB 1FE8H 1DSFL 2F8OA 4AH2A 5ICZB 1INDL 1YYLH 5TFSH 2D7TH 3O4OC 5I1LA 4QF1A 1VADB 1WBXA 2BOBB 4HLZH 4D0CA 2E9WA 4WW1A 1MCPH 3IVKB 4L8SB 4LIQH 4LLWB 3ULSA 5BO1H 1EK3A 3C5JA 4F7TB 5I71C 1A7QL 2C3WA 3DGGB 3BKMH 1AD0B 4GG8B 4YLQT 5HVHB 4RWHA 4ZFOB 1FFRA 4JN2B 2AK1L 4M6NH 4E9LA 5IHUL 1UACH 4OGYL 4L29A 5EU4A 3R1GH 5C0EB 3Q1SH 4G5ZH 2DWEA 5C0RH 1P1ZB 4H20L 5CIPA 4LCWD 4WP6A 3MRPB 2KQMA 3QH3A 4P3DA 3LQAH 3U4BH 3TWCL 4M7JL 3LIZH 4ENED 1OGAA 2HAZA 2ZCHL 4YHKH 4I13B 4EQ2A 3T0BA 5DWUH 1KEGH 1U8OB 4QHLB 3U1SH 4BKLB 2R9HC 1V3MA 3DMMB 1A1MA 4OF7A 4P5TA 3HC4L 4PLNC 2IJ0C 4NQED 1TJHH 5SWZA 2CA6A 3F6IA 4M1DL 1NCUA 2R2CA 3HG1D 4R8WH 1JFQH 5DA0B 4OZIA 1OPGL 2R69L 3O9WD 4YBQC 2DI8A 3ARUA 4YHLL 2FWOB 3MCLH 4DEPB 5K9KB 1U8JA 1B0RA 3MFGB 3WJLC 3VGHA 5T3ZL 3N9GL 5DURD 1OSPL 4HFUH 3ULUL 5EC1B 4PJ9B 3NA9H 3RNKB 3TPKA 1DL7H 5KVEL 4PGDA 2IADA 1MFNA 1QYGL 4Y4FA 4Q74A 1UQSA 2V5MA 5JA9A 1JHTB 4P5MB 4ZDHB 3TO4A 5DK2B 2IC2A 1JZ2A 2DYPA 1XF4B 1AO7A 2VSDA 3LQZA 4OIIH 3SJVB 2APXA 3MV7B 5EBWA 2L4OA 4GRWB 1LO2L 4AW4A 4S1QL 1Z0MA 4FQXA 1U2CA 2H26B 3OL2A 4KY1H 2F5BH 4TUOB 1AH1A 2WIIA 1GYAA 4G6KL 1NCWL 5D7KE 4NKQB 2ZKHL 3SJVE 3TLRA 1XF5B 1J0YA 3MPCA 2BHYA 2FLBT 2CQVA 2MOVA 3NIGE 3G3AA 1MCWW 5JIKA 3VFSA 2J8UE 2HTLC 4QRQA 4QXGL 4LSXC 1LDSA 3U2SA 1J8KA 1JI2A 1RJCA 4G8IA 1CLOL 2Y7QA 2X6MA 2Z31C 3WYRA 5HHPA 1CK0L 1TJIH 5HPMA 1CZ8H 2YPKB 5DGQA 3PHSA 3RX8A 5I1KL 4HQQH 5C09E 5CINL 5E0QA 2GJ6A 1S7WA 3T3MF 3WIFA 1EUUA 4KTEL 1T2QL 4LPVA 4ONHB 2NY1B 2VLJB 5HVHC 1HHKA 4YUEH 4Z0BL 2ENSA 5IROA 3GUTA 4GOSA 1V5JA 4G8GD 1Q72H 1FVEA 3B2UD 2DTSA 2FX8L 2NY0B 3HI6H 2ATPB 2IPUG 2CKBB 3FQUA 3OKEA 3BP7B 3X14A 4WW2C 3HCVA 3CD4A 1N8ZA 1BZ9A 4QHMA 2J3SA 1GPOL 5DK0B 1M7DB 1DBBH 5GSVB 2ITDA 3UO1H 1KPUA 4CVWA 4O2EB 5IBLD 4BQ9A 2ZUQC 3WFZA 1F2QA 5JW4Q 1MCWM 3DMMC 4OSUH 4UAOB 5I1IL 1FNSL 2BVPB 1C1EH 3V0WL 4TPRH 4WTZA 1VHPA 4LSTL 1Y6MR 4L3EB 2JJSC 2JF1A 3VD7A 3B9KB 3KPLB 5I16A 3UZEA 3U48A 3DVGB 4KAQH 3M17A 1AY1H 1FL6A 4DEPC 1JK8A 4XNXL 3G5XB 5IOPB 2OSLB 2NY7L 3TP4A 5FYJU 4P2QD 5FK9B 3EYQD 3C08L 1LO3H 4Y8DC 2D03L 1R3KB 1U92A 2FSEB 4U1LA 4KKLD 3GJFA 1B9ZA 3HNTH 2E6PA 3D69B 1UKSA 2CO7B 4L3FA 1K5NA 3QA3B 1H3PL 3PQYB 1EERB 3BYTA 4Y2DA 3HS0A 2JE0A 5TH2B 4XCFH 1L9MA 3BAEL 5BVPL 3KPSB 3I6KB 2JIXA 5EOQH 1RHHB 3DYMA 4MAUL 3FO2B 1ZT1A 2G2RA 2X4NA 3LD8B 4UDUA 1IC7L 2XA3A 2PO6B 2R29L 1JGLH 1DBMH 1PG7W 5JOPD 1BFOB 3NTCH 4HK3N 1JUFB 2AQ3A 3V4UH 3KPSE 5IB3A 1AGCB 4ELMF 3WLWC 3P4NB 5K59E 5IF0A 4RFEB 2OCFD 3WS6C 1HKLL 2BY1A 3MA7B 5AWNH 3TSRE 1AQDB 1RZ7H 1KCKA 4F2MB 4WHYH 2AABL 2NY6C 2Q7NA 4YEBB 2W38A 3W9EA 1YQVH 4PRAB 2X4UA 4QOKD 1NUFA 4KK6C 5AYUH 3WN5B 4CUCA 1RUAL 2NY1C 1UXWA 1OF2A 3NFSH 1FGNH 1A7RH 2WAHA 2NY2C 1DVFA 2JB5L 2AAVA 1Y6KR 1W72B 2NY0C 1EFXA 3KPNA 5DEFB 2W65B 4X6CF 2YC1A 4DCQA 5DT1H 2V9SA 4AENB 5IM7A 4ONOA 3VA6A 4MD4B 2IPTL 2O5XL 3QXTA 4YHIB 3H2WA 1X5JA 5EZJA 1LNUA 3C6LB 3VI4F 1T03L 5AZ5A 2HVKA 3VDBA 3SGDI 1J8HD 1DEEA 2AV1B 4U1MB 4PRHD 4EDXB 4K23H 5JTWA 2QQLH 5JMOC 4Z7UF 4B7IA 4UAOC 1QRNB 4PUBL 1DBKH 2XIDA 5C1MB 2VLKD 5MEPB 1GZPA 5TDPB 4FP8L 1G0DA 2BHUA 2B4CL 4LL9A 3B9KC 5GGQH 3P9LB 1O7VA 3TNMA 1KC5L 4U1KA 4ONGH 2EH7H 5DMIL 5IMKB 1Q0YL 4KDTA 3P4LA 1FPTL 4JFOB 4P23A 1MUJB 4AZ8A 3HHRB 4ZXBB 2VTFA 4PJFA 4V1DA 2L7JA 3GMNA 1X7QB 1U0QA 2H2SD 4KKCC 1HYRC 4RWYL 1W8OA 3PHQA 5D1ZB 2EXYD 4Z7VB 2VYRE 1OQOA 4NZUH 2HRPH 1RAMA 3VG9B 4QLRA 4KK8C 4OI8A 4Q9QH 3PWUB 1MHHA 3BZFA 3CCHB 4X9GA 1EMTL 1ADQH 5HVWA 4AEHL 1X6LA 1VPOL 1WBZA 3KJ4B 3QDJD 1QNZL 3RZCD 1EFQA 5IVNA 2CDGA 3SDCB 2WQRA 5D1QD 3KYKH 4Z7VE 5CKGA 2WLYA 4EVNB 3LB6D 5DC4B 3GJEA 4JZOB 1P4LB 2BNRE 2P4AB 5DRZA 3REWB 5J4MA 2ZZUT 3ARDA 3JB9j 3NN8A 4P5KB 2PO6C 4WI6A 1F11B 1QQDB 3DURB 1RK0B 3GJFK 3X17A 1BAFH 3ULUA 4BSVA 1WT5C 4LQFL 4F9LA 5K33A 2HTKC 3LS5L 3AMKA 3CH1A 3QCVL 2IH1B 1G9UA 1T20A 1J11A 3UPRB 5E9DB 4JQVA 2DQTH 5E2UH 5FECB 4I3SH 4CDGC 3OKNA 1J0KA 5L2KB 1ZVHA 2R0ZH 4Y89A 3MOBH 3NPSC 4Z0XA 4MD5A 4RMWA 1K3IA 4XPAL 1BFSA 1A6ZB 1LGVA 3MLZH 4OFIA 3SDAB 1L4IA 3VWJD 1FNHA 1JL5A 5A3ID 1KF9B 4A6YB 5E9DE 3NH7H 2P45B 1XCTB 5FM5M 1CXLA 1AP2A 1Z0NA 1ACYH 4LRIA 4GRMA 4UT7H 2V9QA 4N8VA 4K7PX 3SDYH 1H5BC 5H37G 4PJEB 5FDYA 3RVWD 1D5IH 3A67H 4R6UA 4JY6B 3U7WL 4BFEA 5ADOL 3FT4A 5CEYA 4PRPD 1XFPA 3C6LC 3UROR 4C58B 2QR0A 2XTLA 2ARWA 3BP4A 3CXHJ 5I66B 2R56L 4I2XE 2A77L 1P7QD 5B8CC 3OPZH 4PJEE 5CP3H 1F13A 3EJYC 4HIXH 4OCRL 1IM3A 4M5YL 1FAKT 1CXHA 4ZPVA 1T04B 3IFOB 3S5LB 4F33A 5FO9A 5I76A 1VFBA 4F15B 1B3JA 2AJXH 2GI7A 5CMPA 2VZ3A 5ESQB 4JFFD 1G84A 1QRKA 4YC2C 3FN9A 4CGTA 5DJ6B 2QHRH 4MJ4A 4ZAKC 3IJSA 5DD6B 4JRWA 4ZXBC 4PJHA 2FJFB 1EVTC 1D6EA 1NLBH 1S9YB 5I15H 3W3GA 5D1ZC 2DJUA 5D7IB 4CVXB 5E08H 1MH5A 4B50A 1YRGA 4UT9H 4JM2F 3P3YA 1G7PA 4NN6B 5GS0L 2K7QA 2XWTA 5EPMB 1HZHH 3GRWH 4P2RA 1A0QH 1SY6H 3GIZL 4HGWB 1F4AA 5D71L 4C55A 4MSWB 4U7LA 3OX8B 4JHWL 5D7IE 4AQOA 1JPST 5DD5L 3HUJF 3MBEA 3BEWB 4LVNC 4MNQB 5L88L 5DC0A 5CMAB 1DFBH 4FS7A 2VISB 1IM9D 2H32A 2R15A 1FG2A 4G9DB 3BGFB 4MAYB 4NP4H 5INDA 3MJ9L 4QHKI 2BNUB 4HUXB 5EC2A 5I8KH 3S4SG 1YNKH 2RBLA 2XZQL 4MNQE 4Z8FL 1T2XA 3GSNL 1SYVB 4LAJH 4RAUB 1FO1A 4R09A 4QGTA 2Z82A 1A6VH 4PJ8C 3FRUA 4XRCB 3BDXA 1ES0B 3TIEB 4IRJD 3M07A 1GGYA 1A14L 1DFJI 1P4BL 3K4AA 3FQWA 1DBAL 3RBGA 1J5OL 1AD9B 3BH9A 2HWZH 4WCYH 4M4PA 4GG6A 4NWTL 3Q6FA 4UT6H 1ZLVK 1GOGA 3SE9L 4QBZA 2YRZA 3L6FB 3OKMA 4IRZH 2CJUL 2FEEL 1UT9A 4U1NB 3QI9B 2BVQA 3UP1A 5I2IA 4MA7L 3BEVA 2P5EA 4F7CA 4PGCA 2I07B 5B38G 1MCFA 1D6VH 4MQXC 2FT3A 4XBGB 2XYCA 2B8OT 1HIMH 2UWEF 1KT2A 3LKOA 5TE7H 4DZBB 4X6DA 3D3VB 1DQDH 2GSGA 4NO3B 3V6OE 4EUPG 1CR9H 1MQKL 3G5VB 4WWKC 1BIIB 3EYFB 2BVUA 1ZSDA 2B1AL 2W60B 3O4LA 3SKJH 3WO4B 4TULH 4NUGL 4LXRA 4U05A 1CD1B 4TZHA 2CMRH 1NCTA 2FR4B 1K3ZA 4J8RA 4FTVA 1ZT4B 4JFZH 4MZ3A 1S7UA 1CD8A 3D3VE 5DUMH 2Q8AH 3VW3L 3B2VL 4YHNB 1U8NA 1XIWD 2NXZB 1MRDL 2DQUL 4JDZB 1H8OA 1BF8A 3VU2A 2AGJH 3VXTB 3WHE0 1T7XA 1YQ2A 4L8BB 5HD8C 5J9PA 3DXAB 2I60H 5TE4H 2A74A 3CFDA 4X6FB 2H9GB 3IFNH 4G6FD 1ZA3B 2HKFL 4YHOL 3IDMB 3V52H 3KPOB 5I1EH 2IANA 1ED3A 4ZUWB 2Y23A 3RX7A 5CEZL 3BGAA 3S37L 4GMSL 2QJDA 3LOWA 1PYWB 5GS2D 5KVGH 1I1YA 4RCWA 4M03A 1DQML 1XGRA 3BGFC 2NX5B 3DXAE 5CZVH 4HKJA 3PNWA 3QIBA 4O2CA 1N3NB 4G6MH 4HS3A 5EWIL 3GMMA 2V17H 3WO3B 2J8OA 2NY5C 1A5FL 3ZTNH 3ROOA 5FF6B 2O5ZH 1U93B 3QUXD 1KLGB 5TPWL 1RUPL 2NX5E 5AZEH 4UBDD 1H0DA 5D7SH 4K8RD 2IAMA 3QUZD 5I1CH 3TN0B 5FOJA 2Q87A 4QRUA 4BZ2L 3F7YB 5IQ9A 3OAZK 4Y1AE 5LWYH 3JVGA 1OAYL 3BKCL 4DGIH 2Z8WC 1MWAL 2HT2C 1K4CB 3OR6B 3QPXL 4OGAD 5C0CD 1TFHA 3AS0A 1YEFL 5EZOL 2EYRB 5ELIA 3WJJC 3DGCR 1MCBA 3RTQB 1XF2A 3VMOA 4Y19B 3WKML 5BOPA 3QI9C 4JFEB 4F3FA 4OFVA 1X4ZA 4GRWF 3V6OC 1BOGA 3EFDL 5IIEB 4KTDL 2FD6H 3RFJA 1ZT7B 3O45A 4QY8B 4ODVL 1NFDB 4BV4R 3WS3A 4PGBA 1EEZB 4JN1L 1F3JB 5DJ0B 3PUCA 4TUJA 1NEUA 3MXWL 4X99A 2WQVA 3QO0A 1OHQA 1N0XH 1RU9L 3ZKXB 3RJQB 2AEQL 2UVFA 3KXFD 4JEGB 4PJ5E 4EBQL 2HA1A 4N8CH 3U0PA 4YPGB 5EZIL 3IU3B 4FQ1H 1ZVSA 3RIAK 5T5FL 4KJPC 4F57H 3ULVF 4B53A 3WO4C 5E1AA 3C2AH 4HC1H 3C5ZA 3T3PE 5DRXA 5KW9L 2X2YA 2K7PA 1M7IB 4WI8A 5FO7A 2J88H 1BQSA 1G7LA 3T2QA 3MXVH 1V7NL 1KXQE 4EOWL 5GZNC 4ZFZB 3VXOB 3HNVH 1TVDA 3VFVA 1BX2B 3SY0B 5IJKC 2C4FT 7FABH 5HXMA 3NPZB 1KJMA 1WZLA 3X13B 3DX7A 3MUHL 4YDLC 3FHAA 4X7FC 1VGEL 4JB9L 2RR3A 3GSRA 1VACB 4RGNE 5H2BA 3IGAB 1KV3A 3RPIA 4ZPTA 2E5EA 4TNVF 2WINA 5I18L 1K8IB 3DO7A 3VQ1A 2P5WE 2Z4QB 5IV2A 1WC7A 3VDCA 1KG0B 1A7NH 1VFOA 4Y5YA 3QWOB 2VDPL 4HIEB 5F7EH 8FABB 4UV4L 5GS0A 4QHNB 4DVBA 2R1WA 3MNZA 3VRJB 2IGFL 4ODUB 3GMQA 2VLME 3QEGL 1EDQA 1XGYL 5ISZA 1S9WA 5GZOC 1WZKA 5IB4A 3RIFK 2DM3A 4DVRH 5HD8D 5SWSD 3PWPA 1IAIH 3CLFL 3NGBC 5E7FA 4DW2L 3C6OB 5F7HA 2EC9U 1I9EA 4AIOA 1HXMB 1OAQL 2XKNB 4ORGA 2I27N 3IDJB 5CJXC 1EO7A 3NIDE 1DLFL 4XZUB 4LLQB 4PP2B 4FABH 1FL5B 1ZHBA 4H09A 1UM5L 1CU4H 5J1TC 3GNMH 2J5LC 4RRPG 2FLRT 4ZUTA 4M5ZH 1NL0L 4GAGL 5JORA 1U58B 5E2VH 5K9OB 3MJ9A 5EU3B 3GSQA 1T1ZA 4IS6A 3GSNA 1RULL 2CUHA 3TVMA 4QRPE 5F93C 4FQHB 4H0IA 4PB9L 1EBAA 4NRZA 5C0BD 3UZVB 4Z7WA 3IXTA 4EJ1C 1Q9KB 3Q5TA 4HJJL 1SM3L 4I0CC 3CXDL 3U0WL 2DBLH 3LKNA 3T1FA 4HH9B 1MY7A 2MCG1 4YXLH 5SV3A 5D2LA 4WO4A 5GRYA 2EDJA 2C3XA 5HHOB 1KCUH 4XPBL 3QQ3A 4OV5A 3FOMB 1D5BA 3NCMA 1AGFB 4YZFF 1EAJA 3ARFD 1XWDC 4MX7B 4X4ME 1T21B 5ITFA 1MVUA 4RGNC 4QT5B 4WU5A 4HUVA 5HHOE 3INUH 3KYAA 5FYJE 2EDBA 2OR9L 1S7XA 4PJDE 5E5RB 1A6PA 3OGKB 4URTB 2D31A 1EO8H 3LRGA 4FG6D 5CJBA 2B0SL 1IEAA 5JOEA 1WZMA 5D2NA 1T0MA 2B7DT 1S5HB 1QSFB 3BQUB 5F89B 1RUKL 5BS0E 2AJVH 3SDDD 1R5WB 1NMAL 2H8PB 1H15B 1M6OA 4DK3A 1BQLL 2BC4B 4RISL 4PB0H 2XQBL 3SDXF 5I8OH 3WHXB 4L8CB 2A0ZA 2XKUA 2ADIA 4Z9KB 2P1OB 1QSFE 3FAXA 4K55A 3L5WA 1JNLL 4ZYKA 1FFQA 5BV7C 1T66C 5IESL 1O6VA 5E6IA 4XCYA 1OP5K 1B6DA 3HI1B 1L0XA 5EU7E 4DKDC 1HHGA 5DJZA 4I3RL 2Q76A 2IPUK 5IR1B 4WFFD 2XXCB 1GAFH 1DEDA 4KJYA 1QSZA 3DTXA 4PJBB 2QSVA 1U8QB 3WL9A 4ODWA 2OK0H 5DHVA 3RWIB 2WBKA 3AFLA 1SMOA 3C87A 2PTVA 4J6RH 3RGVD 2VKWA 1F4XH 3CFIC 3JV0A 5TJWK 5K9QI 5D70H 4DZ8A 1RZJC 4R6FA 3VI3F 3NAAL 3IDIA 2AJZB 3DYPA 3GK8H 4ZUUA 1HKFA 3S34L 4O51A 4JFYB 5DJCB 4PG2A 4APQC 3WEXA 5L2JA 1I9IH 3QXWA 2Q8BH 3VG0H 4RZCA 5D1XA 5F44A 4PJXA 1NMBH 2GJZB 1RUML 1FRGH 4AL8L 3E6JA 4KVNH 2F58L 1MWAA 3OSKA 3BISA 1XZ0A 1G7HA 3SPVB 1J0ZA 4NQEA 3RFZC 3M8OL 4ELKB 1KPRA 3EYVA 2FO4A 1NC4B 5IHLB 1KIRA 4JFQB 4Y4HC 2GCYA 3JWDC 4U2YA 4XC3L 4W6YB 4G9FA 4NQVA 1U3HD 1F58L 4I77H 2ELLA 4WTXA 4KC3B 2BSTB 4M62H 1YJDC 2H45A 2HVJB 4JFDB 2VOTA 3RUGB 3EDFA 2D7MA 5HI4C 3GJFH 1S7QB 2D7OA 3O0RH 3LEXB 1OM3L 4ZSOA 5JW5B 5C9JA 4UB0H 1YUHA 5EO9B 4UU9B 1RD6A 1T22A 4QHKJ 2DM4A 4I1NB 2Y06H 3VWKB 1U8KB 2MQ0A 1MAKA 2XFXB 1PW3A 4RMVA 1U8HA 4NZRL 2DICA 5FHAH 5JDSA 3KS0H 4HWBL 1OVZA 3MYJA 3B8YA 4X5WA 4O58H 1JZ4A 4LMQI 4NO0D 3D39A 5H94A 3RWHB 4XAWL 2A0LC 3V6ZB 3VRLE 1XGUA 1NBYB 5DFVC 3UJJL 5LBSH 4Z7NF 1MI5B 5EU7C 3E6HA 5B22A 1N5YL 3UC0H 4ZNCD 3FQRB 3CFCH 3MGTB 3WNLA 3SGJA 3W0WB 3VFPA 3QCUH 1Q9OB 1HHIA 1LK2A 3BRDA 5D5MB 1RFDH 5D72H 2X9WA 4QYOA 4NNPH 3O8XA 2ZUXA 3PWVA 4F7PA 2BHZA 3DX8A 1I1AD 3EFFA 4GKSA 4LDOB 3TIDA 2F5AL 3MV9D 4JO3H 4W81A 2BERA 3W0WE 3LPFA 4U1JB 5JXED 4R2GC 4RBPK 4C59B 4MJ6A 4JY5H 3QFDA 4LSUL 2ICWI 5EULV 5FIEA 4EI6A 1S7SA 2DD8H 3IETB 3O6KL 2O93L 2O61B 4H26B 4XBEH 3MLXH 1CE1H 1KGCE 2ORBL 3FB6B 5ADPL 3NVQA 2YUVA 4L9LC 2F74A 3I6GA 3O2VL 4JHAL 4JFXB 2ATKB 3KPMA 1FVDA 3EDDA 1DSFH 4OV6F 4AMKH 4XCNB 1INDH 1QA9A 1TCMA 2I9LA 1RZKH 2CKBL 1C12B 3LEVH 1PKQB 5JHDE 3WE6A 4NJAH 2A6DA 1PGRB 1VEMA 1IGFL 2XN9A 3OJDB 3ARTA 1A7QH 2Y5TB 4R4BB 4MNHA 1PKQE 1JF6A 3E8UL 4ZO7A 2ICWB 2AK1H 1T6VN 1G6VK 2C7UB 1CGYA 2OMUA 3T04D 1FCGA 4H8WH 5E24E 5I0DA 1YECH 2VUOA 3BW9A 4H20H 3CFKA 3T8XA 1MLCB 1YY9C 3GMOB 4GW1B 3TWCH 4ZFFA 4M7JH 2AW2A 3L9RA 4P2QA 3S4SA 1UZ8B 1CFVL 2YEZA 4QXTA 3NIFE 3HPLA 4FFWC 3VJ6A 3VWKC 5C07B 4KUZL 3EYOA 3HC4H 1PZ5A 3NZ8A 4M1DH 3AMLA 5CP7A 1TXKA 3K1KC 2OL3L 3FQXB 1HH6A 4CW1B 1OPGH 2R69H 3QIUC 1F4WL 5I75B 4YHLH 3TBVA 2JCCB 4JPIA 5DZOA 1LVEA 2Z35B 4NYLA 2P7TA 3WJLA 1YN7A 3NZHL 2ZWLT 4V2CB 4JRXB 1SHMA 5GGRA 3CDFA 2FX9L 5T3ZH 3N9GH 3BUTA 1OSPH 5IBUB 2OZ4L 3U36A 3ULUH 1F6FB 4TTDD 1Y18A 2EO1A 4NQCE 5HBBA 5KVEH 2JCCE 3F12B 1QYGH 2ZOLA 1A6TB 3OKDA 4GUPB 5DQ9B 5EUOA 3ARXA 5AEAA 1FYTD 3VGBA 3VD4A 5IEHA 2VLLA 1TPXC 1HHHA 5B3JE 1ZLVH 1T1YB 1LO2H 2IH3B 3MC0A 4ZUSA 5B38A 4S1QH 1HE7A 4OT1L 1TITA 5DMKB 3MCKA 5D6CA 2GEEA 3ZKMD 4G6KH 3VXMD 4PV9B 1NCWH 4BK4A 1AR2A 1I1FB 3C5SB 3V5DA 4NM4H 1R5IA 1CS6A 1B88A 2CPCA 3MUGA 3FQTB 4UNUA 3TZVD 4CMHB 4LSXA 2DL9A 4QXGH 1JWMB 3K2MC 5IB1A 3G6AB 4Y4KB 1CLOH 1CICB 2Z31A 1QUNA 4ZODA 1Q9LB 3LPGA 5GGUA 4F7TA 4WI2A 4MVBC 4NQDD 1J8HA 1CD9B 4CKVX 4YXKH 5I1KH 1C5BL 4L4VB 5A2FA 4DWHA 1GC1H 1F6AB 1YNTB 4GG8A 5CINH 3C60C 1T2QH 4ODXB 5CCKL 3PMHG 1YEDB 3P4OA 4JRYD 4JN2A 2VLKA 5AG9A 5JPNA 4NT6B 5KZCB 5C0EA 3O6FC 2DM7A 2FX8H 3GB7A 2PW2A 3MV8B 2WUCH 3D2UB 3SE8L 1MCCA 2HJKB 1BGXH 4LI1A 3CDGB 4M43L 3I02B 4JJHA 4L4VE 4WW2A 3SKMA 2F54D 5CSBA 5KS9B 1CFBA 4NC0B 4OLVL 1GPOH 1AC6A 3ARZA 2R2EB 4FMKA 4BKLA 4OLZL 3MV8E 1A1OB 4WDIA 3DMMA 3CVIL 1U95B 1F8TL 5D7JB 5MERA 1W0WB 2NTFB 3BUYB 5L8KB 5I1IH 3S96A 4GLPA 3KPTA 5F1IB 3TJEL 4LSTH 3THML 5KS9E 2JJSA 1GHFL 4ETYA 4JKPH 4TOYL 5HHXL 5TQ2L 5T1DL 3UMTA 5I75C 2YXFA 1AFVL 2I26N 2Q20A 3F5WB 4XAKD 1JIBA 2R2BB 1F3RB 4XNXH 4IOFD 5DO2D 2NY7H 4LK4A 3VMPA 1J05B 2VQ1B 2YA2A 3MFFB 4N1CA 2PR4H 3C08H 4PEQB 5EC1A 1L7TL 3S88L 1MF2H 2H32H 4N0FB 3K80A 3O3AB 4HKZB 2PYFB 1NFDF 1G0YR 5CS7A 3OAZH 2ZG3A 4KV5E 1JHTA 2IF7A 2VIRB 4HWBA 5MEOA 1XF4A 5HHQB 3SJVA 4GQ9L 4LSQL 5FXCH 3MOAL 3FZUC 4L3CB 3BAEH 5BVPH 2H26A 4FXGB 4X7SL 4XVSH 2J8UA 3NFNA 3WPHA 3MRHB 5IVOA 4A6YL 5DQJA 5T5NG 1EZVY 4DK6A 4HWUA 4G6AC 1XF5A 1IQWL 4LGRB 2NY4D 4LCIL 5C09A 4I4WB 4CMHC 3WS6A 5BJTA 4U6TA 4EQ3A 2HT4D 2OP4L 1MHCA 1D9KC 1D5ZA 3MJ7B 4Y4KC 5CMNA 2UZXA 1CICC 4U1HB 2AABH 2YPKA 1B4JL 3B6SB 2UYLB 4JFPB 5C8JB 3H9SD 3IJHB 3N1PC 1RUAH 3UTTB 4Z61C 5HYQB 4QRRD 5I1AB 4QEGA 4BH8B 1F45A 4ECOA 5BRZB 3VFOA 2EIBA 2WBJD 4OAWB 5EBLA 3LSOA 2VDLL 2CKBA 4Z7QF 4LVEA 5SX4I 2DAVA 3D9AL 3OF6D 3JSSA 5F1OB 1IC4L 4I0PB 3F7RA 2IPTH 3EO0B 3UTTE 2XICA 1T03H 1JF5A 2IMMA 3TYGL 5GSVA 5LAXB 3VXQB 2VDNH 4JVPA 5FYKD 4TQEL 1I7UB 2GK0B 3IXAA 4L5FL 5C0DA 3VGDA 5D7JC 2V6HA 4PUBH 5BZWA 1IARB 3WXVH 1MFEL 4JJ5B 4FP8H 4R0LB 4OD3L 4U0RC 2Q86B 4WUKL 2B4CH 3B9KA 1CIDA 3IJYB 3NABL 2MTPA 4WTWA 2P42B 1GGBL 3QHZL 4LNVA 5EOCH 1T4KB 3G5XA 3SBWC 5IOPA 2OSLA 3D85A 4YXHL 3BFOA 2X4OA 1WEJL 2MWCA 1CT8B 5FK9A 4ZOBA 2Y4SA 1FV1A 5C0JA 1MFDL 4RWYH 4FNLH 1E4JA 5LCVL 4R08A 2WANA 2WNGA 4LDLB 3D69A 4G7VL 2LQRA 1UVQA 2HH0L 3P73B 5L7XL 3RWJB 2OL3A 1Z9OA 3GSWB 1HOCA 3QA3A 4AEHH 3RDTC 2NY5L 5HDBE 5TH2A 3UXFA 1VPOH 3UN9A 1FT8A 1EBPA 3O6LH 4RMUA 4K94C 5F3BB 1LTXA 3UAJC 4LEOB 2DKMA 3RAJH 1F4YL 1NGPL 2V5YA 2PO6A 43C9A 4PGZA 3BT2H 3QUML 4KPHH 3FMGL 5BCAA 1CN4A 2R1XB 4X98B 2OZ4A 3WPBA 1WT5A 4PRIB 3ALWA 3LKPB 5J6HB 4LQFH 1QLFB 5KJRL 3VFNA 3LS5H 5F6IB 4RNRB 1OTSD 3MMEB 4YWGL 3QCVH 1AGCA 3EOYG 1A6AB 4RFEA 4POUB 4K17A 1KB9K 3MA7A 1C5CH 3ZE1E 4JCLA 4QWWD 3TBYA 4NQSA 2A2QT 2BRRL 3SE4C 2P24B 2B20A 1FO0L 1LO0H 3QG6A 3OB0K 3WCYA 1XGQB 3GMLB 3MODL 3N1MC 4XVUD 2Q6WB 5GXBB 5MHSD 2Q1EA 4IDLA 1Q38A 3T77B 5DJAB 2VXVL 5I73B 4UIKL 3T4YB 4S2SB 3I6LE 1Q9WB 1H5BA 2W65A 2A38A 4PJ9D 1OAKH 4LLDA 3UYRH 1MJ8L 3P30L 2DQCL 4AENA 2IFFL 2OTWA 5ADOH 1D9KD 3ESUF 4I0PC 2LVEA 2VUYA 3C6LA 3FFCB 4X6BB 4F7EB 4PJCB 4XC1L 1OD7A 4BFIA 4YQXH 2VL5B 4H5SB 1M7XA 2A77H 4QXWA 5B8CA 1VENA 2MMXA 3MV7D 1Q94B 2QV2A 3QJHB 3PL6D 1BBJB 3KYMB 4PJBF 4OCRH 5TDPA 1A9NA 1CXFA 1MCKA 3BJ91 3EIFA 3FFCE 1I8KA 1XIWA 4PJCE 5T3XE 3U0TA 5EU6E 1QR1A 2BMKB 2P44B 3LH2L 4XHJD 3WFEL 5JPMA 3BZDA 2XZZA 3BWAB 2EDLA 3DROB 3S35H 2AK4D 1GGIL 4ZAKA 5BW7C 5HYEA 4N68A 4JFOA 3AVEA 1OTTD 1QHOA 3LCYA 4OZHA 4ZXBA 5C2BH 5E99L 5JA8B 2Z93A 3ULVD 5D1ZA 5I1DB 1WITA 2A9NL 2ICWJ 3E3ZA 1INEH 4Z7VA 5SWQA 4HKXB 4RIRB 2BNRA 4Z5RB 4YX2H 5GRJL 1PQZB 4EKXA 5GS0H 4Y16B 5FA4A 3UJTH 3GIZH 2ZUUA 4HXAH 2QADB 2VLJD 4OCXH 3ARGC 5KVDL 2OI9C 5D6DC 3HZVB 5D71H 5J11C 2HMID 3D25B 5LGHH 4EVNA 4M93C 3TFKD 4PJ7B 5DD5H 4JZOA 3GHBL 1P9MC 1HQ4B 5IW3A 3DURA 5L88H 5CBEB 2CLZA 4NO2A 3RUGF 5F6IC 3I2CL 5K9QG 5HZLB 2ARJB 2IH1A 4PJ7E 1W2KT 5E9DA 5FECA 1U36A 4KKBD 3MJ9H 5E94B 2XZQH 4F8TA 3GSNH 2VKXA 5C0NC 3RVUD 3KG5A 1OWRM 4L3ED 3TYFB 1EJOL 1UA6L 2DQGL 4PJ8A 3UAJD 1A8JH 3MRRB 5IEKB 4A6YA 4WU7A 5IMOB 4BH7B 5C2UB 4PJGF 4Y5VB 1A14H 2VO5A 3KYNB 4HDIA 4I2XA 2P1QB 5AWBA 1IRAY 4KROB 2ZG1A 4F58L 3M1BB 1DBAH 2ADGA 2C3GA 4PJEA 4ECNA 4RDQF 3HFML 1DZBA 3TO2B 1NEZA 5C08B 3KXFA 5D5MF 4NWTH 4PRDB 1YEKH 2CR3A 3SE9H 3U79A 5DJ8B 4EIGB 1D5XB 3PWLB 4D0DA 3PQYD 2CJUH 2CXKA 2YUWA 4OF0A 2CRIA 3FTGB 1KN2H 4LOUD 4AH2B 1UGNA 4HWNA 2D9CA 4MA7H 1X6NA 4QF1B 5AAWA 4PLJC 2V7HA 4YDIH 1WBXB 1CLCA 1RZFL 5C08E 5C0GA 3LV3B 1T04A 4D0CB 1PZUB 4WW1B 4LCCC 1WVZA 4XXDA 3ES6A 3ULSB 3C5JB 4DKFL 1KXTB 2OMXA 1JPGB 2OMZA 4DFIA 1IKFL 2OJZH 5CSZB 2M2DA 5DJ6A 1MQKH 4JE4B 4WWKA 5MENB 3S3SA 4L29B 1XR8A 5EU4B 4PR5B 1RZGA 1OP3K 4NUGH 5D7IA 4WI7A 5D4QA 5CIPB 1S9VA 3QH3B 2UV3A 4P3DB 1ERNA 1OT1A 3K1DA 3VW3H 4NJ9L 5IW1A 4Y16C 5KN5B 3WIHH 4HGWA 5MENE 2RAMA 2NMSA 2QADC 1MRDH 4AYFA 2DQUH 3K8KA 4XCEA 3DX9A 4MSWA 5BV7L 5CZKA 3OX8A 4WI3A 3VFUA 5C0AE 1LK3H 4TVPD 3SGKC 3RKPA 5TE6L 3BEWA 2AJYL 5FKPB 4PJAA 2HKFH 4YHOH 3NCYP 1NC2A 2BP3A 4HIHA 4EIZC 4R6GA 5CEZH 4JFHE 5CMAA 4PYHA 4OLWL 4JPKH 4LP4A 3GMRB 3X3GL 3KPRE 1U8JB 5DHVH 1MIEL 8CGTA 4O02L 4HEME 4GLRH 3ARRA 4ISVA 1MELA 1QRND 1X4YA 2AXJA 4ZUVB 3QYCA 3CFBB 4N8PA 4U6YB 4RAUA 5HVGB 2NYYD 3VA2C 2IALA 2NZ9C 4YAQA 1RZJL 3NACL 4PGDB 5BXFA 2IADB 5DYOB 4Y4FB 4UTBL 5C0BA 1UQSB 4XRCA 1V7ML 2EECA 4XPTL 3QUMA 1ZAGA 4WWID 3TIEA 1FQVA 3TO4B 3M45A 1FS2A 1AO7B 3LQZB 4G43A 3EBAA 1ZTXH 1DANT 4BZ2H 5EBWB 4D0BB 4KROC 1OAYH 3BKCH 4FS0A 2GAZA 1CDYA 1MWAH 3G6DH 3HC3L 1JHKL 2WIIB 2P47B 3QPXH 2R0KL 5FYJL 1YEFH 3P0GB 5IBUG 3JWDL 5EZOH 1AXTL 5I8EB 3WJJA 1X5ZA 2BRQA 1FO0A 4TNWF 5FV1L 4Y5XC 4CL7A 1E4WL 4U1NA 1MNUL 3WKMH 4NPYB 4AG4H 1YJDL 4U3XA 4UMGA 3V6OA 3SDCD 1OAXL 2LVCA 3EFDH 4EN3B 3VFSB 3QFJE 4QRQB 2AJSL 4ODVH 1LE9B 4EDWL 1Z5LA 3ULAA 1HYSC 5BVJB 4JN1H 5HHPB 3EZJB 3WMSA 5HPMB 3FCTA 3SEPA 4DZBA 2VLRE 5EOTA 1RU9H 2GJ6B 1S7WB 4NO3A 4X5LA 3WIFB 4LLVB 3G5VA 1HHKB 1BIIA 2VDOL 3HMXL 5EZIH 3GUTB 1FVEB 4YHML 1RVFL 4KJQC 5L2KD 2R8SL 4L4TE 5KW9H 2FR4A 1GGCL 3QDGD 3X14B 5A43C 2L7UA 4Z7OE 2GJ6E 1V7NH 4EOWH 3SDAD 1BZ9B 2LU4A 2C26A 5IJKA 1AHWC 1BFVL 5I19L 1DUYA 2ITDB 5T1KA 2F19L 1KPUB 4JDZA 4TSAL 2PETA 4NKOA 3VXTA 2XWBA 1VGEH 2YPLE 3DXAA 4DKEL 3BPNB 5E56A 3RGZA 2IQ9L 1VFAA 1ZA3A 3IDMA 4MNGE 3KPOA 3SCMB 3MNVA 4OB5L 5JIPA 2MKLC 5I16B 1O7SA 4MDIA 1PYWA 1OSZA 3M17B 5IG7A 4M4RA 2VDPH 4R5DA 1UC6A 2F9BT 1JK8B 4UIMB 4PP1D 4JANB 4S0TD 1U91A 1XGYH 1X5YA 4U1LB 2VXTL 4Y1AA 3GJFB 3P11L 5FF6A 2V9RA 4PLKC 2GY5A 2D0HA 2D4DA 1U93A 3GO1H 4DW2H 1UZ6F 1EV2E 1OAQH 5CJXA 5DRNA 4B41A 4W6WB 1DLFH 2HLFC 1YPZE 3CMGA 1K5NB 1N26A 4Z95L 4AEFA 2PW1A 4Y2DB 3PF2A 1UM5H 3O6NA 3QWQB 4XTRC 5CLTA 4I0KA 5ERWA 4G3YL 1NL0H 4GAGH 1ZT1B 3OR6A 3AY4A 4UDUB 5EIIA 2EYRA 1RULH 1B2WL 5IJBA 1NANI 3DVFA 5E8DL 2YD2A 4WFGE 2MNUA 4PB9H 3ZTJH 4PJ5A 1EH9A 1QBLL 3HE6B 4EN3C 4HJJH 3BDBA 1SM3H 3B8SA 4YFLF 1WZ1L 4QY8A 3DJ9A 1G7IA 4KH2A 2X4UB 5CUSH 3K81A 5JMRA 2A6KB 2Z92B 3ARBD 4XPBH 2QSQA 2WIMA 1UXWB 1OF2B 4N0UA 4YPGA 3T0WA 4KMTL 4PJIF 3EZ8A 3W11C 4JGUA 1DVFB 4OCWL 3KYOA 5M95B 3KPNB 4KGLA 4NO0A 4FMFA 2BNQD 4DCQB 4I9WD 1L6XA 5JQ6L 5J8OA 1B90A 5KSAD 5I1HL 4HBQA 3W9DA 5FO8B 1KUMA 1LNUB 2P5WA 5EZJB 2OR9H 4ZTOL 3WNKA 1U3ZA 3RJDA 5GGTL 4HAGA 1MIML 5HHMB 2B0SH 1CFTA 4W6XB 3BPNC 1TVBA 1YYMH 2OYPA 4KHXL 3IGAA 3KVQA 1GZPB 2QKIA 3RY6C 3DX6A 1RUKH 3S7GA 1NMAH 3SCMC 1KG0A 5DDHA 1VERA 3HZKB 2EZ0C 3ABZA 4NOBA 3TNMB 4FFVC 3UTOA 4MXVF 3TT1L 4CNMA 2XQBH 3QWOA 4QHNA 3BESR 3T1WA 4BFBD 3EYSL 2GFBA 3ZDZE 4P23B 1I1RA 4J1UA 3SN6N 4U1GB 4PJFB 4V1DB 3GMNB 3U4AA 1JNLH 1G1YA 3PHQB 4GBXD 5JZ7D 3MLYL 1LEIA 3HAEA 4MA3A 1KXVC 1FFPA 1HXMA 2XKNA 1MHHB 1NBZA 3IDJA 3V0VB 4KGJA 5KSBE 3O3UN 4I3RH 4QRPA 3OJAA 5EA0L 1YMMB 4PJFE 5KG9B 2CDGB 4IJ3B 4XI5D 4TRPL 4HX1B 1BD2D 1DTUA 4KZDL 4K3EL 4IMLB 3IDXL 3WDIA 4LIQE 4ZD3L 3CVRA 5DRZB 1WIOA 3ARDB 4RCAB 3NN8B 4JPWL 3UL9A 4M1CD 4YDKL 5HHVL 4BSVB 2Q3AA 1YMME 1INQA 4N0CD 4OM0L 1MCQA 3CH1B 2NXZD 5F72S 3NAAH 1T20B 3VXUE 2HLFD 3PGFL 1GL4B 2O26U 4NQXA 3HE6C 1FN4A 1RJZA 3OKNB 5TDOA 3S34H 4APQA 4XTRD 4Z0XB 3FQNA 3S98A 4X4MA 1RUMH 3QO1A 4IRSC 5DZLA 2F58H 4O9HH 3M8OH 2YD8A 5HHOA 3HMWL 5E6YA 4HWEL 4Y4HA 1IGCL 1EZVX 4JR9L 4XC3H 4PJDA 1AP2B 3O11B 4GRMB 3QEQB 1F58H 4GAFB 4N8VB 1T21A 1NFIA 4YPJA 4HXBL 5E2WH 5HI3D 5ENWB 2NXYB 2EEBA 5BS0A 3FT4B 5CEYB 3JUZA 2QR0B 5DK3A 1FBIL 1I4FB 4LARH 1OM3H 5A40E 4WFED 1S9XA 4KJWD 3QEQE 2P1PB 1L0QA 3TN0D 1QYYA 3QUYD 4XB7A 1PKOA 4D9QE 5JNYA 1QSFA 5F89A 1J1OL 1FYTA 2VSCA 1IM3B 3HMXA 1JZ8A 1ONQB 2IMNA 1R5WA 1A7OH 1H15A 4JY4B 5CEXB 4F33B 4GRWH 4RMQA 5FO9B 1VFBB 5F9OL 1J1PL 4XAWH 5HYJE 3LN9A 4L8CA 3WHXA 4QCIA 3OB0H 4NOFA 3RTQD 4CJ1A 3UJJH 4Y19D 5LGJB 4XPHL 4CN4A 3FL7A 1N5YH 4P23C 2VR4A 4M3KB 2CGRL 4PJHB 4U1GC 1D6EB 3H8NA 4DOHB 2HKHL 1E28A 1MH5B 3GSXB 1I7ZB 4H1LG 4RX4D 1G7PB 3AS1A 4RFNB 3NFPA 5I0ZA 3BMWA 1RMFH 4P2RB 3TC9A 4JG0H 1CDBA 2EIZB 2X70B 1WAAE 2EDWA 1LEKA 1U8MA 1Y0LB 4PJHE 4NQDA 4BELD 3H3PH 4JQIH 4IJ3C 5J3HC 4OZ4B 4DOHE 2B2XL 4LSUH 4P2YA 3RWIA 1GZQA 1SJVA 3O6KH 3RFEA 1FNFA 1E0OB 2ORBH 1T83C 4GRLC 4L9LA 5ICXA 3QNYA 3O2VH 4JHAH 5A5CA 2WWKT 2ZPKH 2PTTA 1IC1A 2CKBH 4UTAL 4R5CA 1NPUA 5H35B 2V70A 2BVOA 1FG2B 3ARWA 1EHNA 2XKSA 4FQ2L 1K4DB 1UCBL 3S3JA 5EO1A 1IGFH 5DJCA 4FZEL 1FG9C 3CK0L 2X44D 1NCDL 3AREB 4XVJL 4WEBL 5BMFL 4GS7C 5GISL 3E8UH 3FRUB 4JFQA 5F7KC 4P91A 1G9MH 1WTGT 2HJLA 4PRNB 3T2NL 3HZYA 2Z63A 4RAVB 2F53B 5HJ3B 1A7PL 5IB5A 4ETQA 1Z9SA 2Z62A 1P6FA 4M3JA 3BIBX 3PP4H 3MLRL 3BH9B 2NXYC 3P2TA 1N7ML 3IKCB 4LGSB 1JE6A 1CFVH 1M05A 4GG6B 3ZE2E 3Q6FB 3K2UL 4NNXB 3QG7L 3LEXA 4E41D 3OKMB 5EO9A 3VWKA 2VH5L 1U8KA 3IDGA 2XFXA 4KUZH 2F53E 2BVQB 1RURH 2A73A 4NDMB 2OL3H 2P5EB 3MGAA 3QIUA 3MV11 5EFIA 4P49A 1F4WH 5AD0B 4PGCB 4MB3A 4XB8A 1JZ7A 4K94L 5IKCB 1HH9A 3LPWA 1KT2B 3LKOB 3NZHH 4X6DB 1NBYA 3I85A 4QTHA 2FX9H 1NGXB 2D0FA 2OZ4H 3MACH 3MGTA 4NO5A 3QQ4A 1ZSDB 5GGTA 3O4LB 4R4NC 1OAZL 4FQCH 5FHBL 4J3OC 3MTRA 4WHCA 1IEBA 4FTVB 4X6DE 1ETZA 4QO1A 2GITA 2PYEB 1U8NB 4X9IA 5EH1A 5J7CC 1CLZL 1HK6A 5FUZL 5F7UA 1JPSL 5JHDA 5J9PB 4I8DA 3H9SA 2O61A 4C56B 3DUHA 4QHUA 1U6AL 1L9NA 2A74B 3CFDB 1N64L 2EDOA 2PYEE 2ATKA 2WBJA 4ZS7L 5GIRA 3N50A 3EHBD 4AK1A 1C12A 1PKQA 4G8FA 1I1YB 4PTTB 3G5YB 1AI1L 3E3QE 4C56E 4HKJB 2D7NA 3QIBB 4O2CB 3BYYA 1FZOB 2C3VA 3GMMB 3BQUD 1YNLL 2EDYA 2NW3A 3ROOB 5J3HD 4P46B 1AR1C 4R7DB 5IHBA 1C5BH 3AREC 3C60A 3VXRE 4OZIF 5CCKH 3AB0C 2ICWA 3UJIL 3UTPE 3F65A 1OOKG 2BY0A 3O6FA 4OLEA 1H0DB 2QL1A 4MA1C 2IAMB 2VZOA 3SE8H 5CJQL 2PUQT 5GS1C 2FJHA 4DN3H 5IQ9B 3KS0J 4M43H 1CGSL 5IWLC 3QIWC 2DBJA 3GMOA 3ZL4L 2VE6B 1KCVL 4U6HB 3L1OL 4MQ7B 3MUJA 5IYXC 4J23A 3L7EA 5ETUA 3WXWL 3H3BC 4OLZH 2E7HA 4HGMA 3DV6A 3SGDH 1F8TH 3QHFL 1XF2B 1MAML 4F3FB 1XH3B 4JZNA 3TJEH 1BOGB 3KPQA 3Q3GA 2EDEA 1II4E 3FQXA 4W68A 4CW1A 1GHFH 3OJMB 3O45B 2YN5A 4TOYH 4NQCA 5TQ2H 5HHXH 3WS3B 3R0NA 3MX0A 1AFVH 2JCCA 4XGZA 5JO5B 2Z35A 3LKRA 1Z3GL 3QWRA 4TUJB 3RVTC 1QTYT 1QD0A 3V8CA 1ROWA 2YR3A 5CZXD 4LKCB 4OUUA 3TT3L 2ZUVA 1LP9E 4XP1L 1WISA 3WNOA 1L7TH 3VGAB 2CIIB 3CC5A 2DI9A 5GGVL 3F12A 5E1AB 4JQXC 5DRXB 4CADA 5FO7B 5C0FB 1A7BA 2PXYD 2WM0A 3MUZ1 4LQ1A 5IVZA 1JGUH 1JYWA 4GQ9H 3MBXL 3MOAH 1T1YA 1CQYA 1GIGL 1NC4D 5LGKA 3AC0A 4X7SH 3QUKB 1KJMB 4S1SH 4A6YH 3GSRB 1MJJB 5H2BB 3E3QC 2ESVE 3DHJA 2ZUTA 2JB6A 1I1FA 3RPIB 4ZPTB 2I9TA 4R4ND 4JFDD 3U46A 1IQWH 4NC1C 1WC7B 2EE2A 4LCIH 3WLBA 4F8QA 2JJTC 2HJFA 1UADC 4D94A 4Y5YB 4GW5A 1N6QL 4DVBB 1D9KA 3G6AA 2OP4H 2ERJC 2K3TA 4Y4KA 3GMQB 1CICA 5T3XL 1Q9LA 2LE9A 2ED8A 5ISZB 2DIJA 1S9WB 4WNQB 5IB4B 4P46C 1D7FA 1B4JH 1ZKAA 4L4VA 4BQBA 1QEWA 4KKAD 1KCSH 3PWPB 3L7FA 2XI9A 4QNPE 2HT3C 2R0LL 3MGOA 5MI0B 1KENL 4ORGB 4WTZG 2YRPA 3LMJL 4HT1L 4MJID 3VFWA 5IFHL 1MI5D 1ZHBB 4FFZL 2HJKA 2VDLH 3W39B 3B5GA 3FN0L 4XWOC 5E5MB 3MJ6A 3OZ9H 3TESA 3D9AH 4NM8L 2FBOJ 4ZOCA 4J4PC 1IC4H 4FQIL 5JORB 5KS9A 1TZIB 5ALCL 3TYGH 3GSQB 2DJ4A 2R2EA 4IS6B 3L95B 4I5BA 3E1F1 4TQEH 5DMGD 3TVMB 4OLUH 5D7JA 4L5FH 4J4LA 1VEPA 4HMDA 1KJ2B 4XBPA 4Z7WB 1MFEH 3D5OF 2AKRB 5DUBA 2OM5A 4G7YH 1KN4H 1DUZA 4WUKH 2DJSA 3LKNB 2YN3A 3NABH 1AJ7L 3MZGB 3T1FB 4P9ML 5JW3L 4Q2ZA 5I74B 1GGBH 2VB5A 1QBML 3SBWA 2UVEA 5GRZA 4YXHH 3A0OA 4X4YA 1J05A 1WEJH 2VQ1A 5DF0A 3OKKB 4OQ1A 4Z7WE 3DVIA 5DR5H 3QQ3B 3FJTA 5A16B 1D5BB 1MFDH 4EZMA 1FZJA 2B5IC 5LCVH 4ONFL 1JZ3A 4D2NA 4I3GA 1T0NA 4G7VH 5ITFB 3PDOA 5LVEA 2HH0H 4LSPH 1JCKA 2YUXA 3RDTA 4OGXH 4U3HA 2CDFA 2N7AA 2NY5H 4LVOB 2H2PC 1S7XB 3P0YL 5I6XB 1DQTA 4WRLA 4FXGA 5INCA 1FZKA 5JLZB 2NZIA 3QDME 2X1PA 2R0WH 1F4YH 1NGPH 1IEAB 4HWZB 6CGTA 5D2NB 1T0MB 4HPYL 4S0SD 3FMGH 4KHTL 5D7LE 1M0ZA 3LKSA 1TVHA 3DETC 5KJRH 5FGRA 1JNJA 3T2OA 5FYLD 1HEZB 2DI7A 4PFEA 4YWGH 4H88L 1KBGL 4DQOL 3NCYS 1FL3A 2ADIB 5D2NE 3I9GL 5C07D 3T0ED 3VXSD 3SE4A 1MEXL 2BRRH 4U1HA 1FO0H 2ZUSA 3L3HA 3L5WB 4UOW0 1BREA 3MODH 1P8VA 3B6SA 1NAMB 2B39A 3S36L 5E6IB 2Y9RT 3UTTA 4XCYB 1KACB 1X5GA 4HUNB 5KSVA 2VXVH 4XNMB 1EO5A 1HHGB 5DJZB 4JRXD 2Q76B 4P0DA 5KAQG 3DTXB 1S78D 1M71A 3P30H 2DQCH 3WL9B 1OW0C 2IFFH 4I0PA 3U82B 3H9HA 3GKWL 2W59A 2X40A 3EO0A 2P46B 4KKNA 4XC1H 2COQA 3V9FA 3IS0X 4R58A 3OGCA 3QQ9D 4Q3GA 2FCBA 2GK0A 2WUBL 3MRGB 5J12B 4DZ8B 4PRBA 1MHEA 1NLDL 1A47A 1ZEAL 3IDIB 4LSSH 4XPFL 2Q86A 2UUDH 4U31A 4ZUUB 1KTLB 1FGVL 3IJYA 3OAUL 2DLEA 3LH2H 5L2JB 1MJ7L 2PTUA 3LRSA 4KI5F 5D1XB 3IDNA 3JV5A 4ODTL 3ULUF 4LCWE 5BW7A 1GGIH 1MWAB 5DRWB 1XZ0B 1G7HB 3TCLB 4NQEB 1KPRB 3EYVB 2FO4B 1KIRB 5E99H 5EU5B 2GCYB 1I7RA 2A9NH 4G9FB 4NQVB 3VQ2A 3BN9C 5GRJH 3LN4A 3P73A 1CDUA 3OG4B 3CUPB 4NQEE 4M1GL 2D0GA 3HG1E 1ZGLB 1Q1JH 3ARGA 4S1DC 5D6DA 1M10B 5KVDH 1UXSB 3X12A 4DJMA 1WJ3A 4GH7B 2ZCLL 5I6XC 5C9JB 1AC0A 1YUHB 1QOKA 1T22B 5EG6C 3D2UD 3ROLA 1P9MA 4LVHC 1U8HB 3U7AA 4AIZA 5JDSB 1MRCL 3DSNA 3LKPA 3MYJB 4CVZA 5J89A 2Z91A 3N85L 1OTMA 2ED9A 4N9GB 4BUHA 4U08A 1G1CA 4RNRA 3BDYL 3D39B 3I2CH 5H94B 4ODSL 1MSPA 1YY8A 1XGUB 1QSED 4P59L 2DQHL 3ELAT 3MA9L 4HSQA 1KULA 3R06A 5EORL 4LEXL 4M7KL 3VFPB 3IDYC 2YK1L 1EJOH 1UA6H 2DQGH 5FGBC 1LK2B 1WUNT 5ESAB 1NBVL 2FATL 3SO3B 1LD9B 1FH5L 1HWHB 3D18A 5DJAA 5LQBL 3DVNB 4QYOB 3WSQL 1KNOA 2J12B 3O8XB 3QAZB 3PWVB 4F7PB 3T4YA 1WIUA 4J3WA 3ZT5A 3V4VL 2UZIL 3ET9F 2Z9TA 4MJ6B 3STZA 4CRPA 3QFDB 4EI6B 1QR4A 1OCWL 2E8ZA 4X7EC 1UYWL 2UZYA 4RFOL 4F7EA 3VFTB 2AJUL 2YWYA 4GAJH 5EU6A 2F74B 3I6GB 1ZK9A 3OXSA 2DN7A 5FM8A 4FQPA 3CSYA 3KPMB 3S37X 2I9LB 1QA9B 3O4OB 4H1LA 2EICA 4ARNA 4XMLL 3QDGA 1CTNA 3V6BR 1GGUA 5GHWL 2AEPH 3OMZA 1RZFH 3VH8G 2NTSP 4ODHH 3HE7D 4N1HB 4K3GA 4LCCA 4Y0GA 1GH7A 4ENEC 4UQ3B 4G8GE 3G08A 4DKFH 5I71B 2XN9B 3QEHB 5A2LH 1IKFH 3QPQD 2YD4A 3C9NA 5C6TL 2IG2L 3DROA 1EGJL 1FNAA 3RU8L 4YHZH 1KPVA 5I1DA 5HYSA 2AXFB 3BW9B 4C54A 1JTPA 1IMHC 3O9WC 3CFKB 3NMEA 1EHLL 5I30L 3T8XB 5E95B 1ZMYA 3C8DA 9CGTA 3EO1B 3G6JE 1MHPH 4NJ9H 4Y16A 2FX7H 3D48R 1FFNA 4X7CC 1A2YB 4P2QB 3L9RB 2VAAA 4R90L 1DBJL 5HGGS 3PDGA 3HZVA 4LPXA 3VE0B 2CRMA 3D25A 3HPLB 4V2EA 5BRZD 3SGKA 2BXZA 2HFGL 5TE6H 3EYOB 1BF2A 1HQ4A 2AJYH 3NZ8B 1PZ5B 3RWGA 2R4RL 3L3GB 4KXZI 1M9SA 2EKSA 6FABH 3B9AA 3WNMA 4P2QE 5AAMA 1RV6X 4OLWH 1TZHB 4HW6A 3TBVB 4GG6F 3X3GH 1IGYB 4JPIB 4NYLB 1U3YA 2ARJA 2P7TB 2VDKL 4FQJL 1ZHKA 4O02H 5GGRB 1JGDB 4NKMB 3RIAF 2CO6B 4JAMA 3U36B 5JW4R 1Y18B 1MREL 1RZJH 3NACH 3ZT7A 3CVHL 3BIAX 1BOYA 2ZOLB 3TBWA 5IEKA 5EUOB 1V7MH 5HGAB 4BH7A 4XPTH 4NWUH 4U6VH 5IEHB 2VLLB 1UCTA 1HHHB 4ZUSB 1CVSC 5ACZB 1UWGL 1SEBA 5LXGL 5JOPE 2YD6A 1OLLA 5IBTL 2NNAB 1JGVL 3MCKB 5D6CB 2MFNA 1H3WM 5M7QA 2IBGA 4QOKB 2CLVB 2NLJB 2ZSWB 5C08A 3ARSA 4HLJA 5FYJH 3O3DA 5B4MC 5DJ8A 1BECA 3PGDA 1D5XA 4Y5XA 3B2UC 1R5IB 2Z8SA 4UQ2A 1MNUH 3FTGA 2F8XC 3OHXA 5T1LA 3MUGB 1YJDH 1OAXH 4QOKE 3QNZB 3CFJA 2AJSH 5CD3A 5E00B 3LV3A 5IB1B 4HBCL 1A22B 2Z31B 1NDMA 3ZDXE 5GGUB 3RNQB 3UPAA 5J57B 4S1RL 1J8HB 2Q4GW 3IAGC 5FAAA 4PRID 5IBLC 1JPGA 4XNUL 1T1WB 3B9VA 5CSZA 2BVTA 2YS4A 4WY7L 5EN2B 1LEGA 1TQCC 1N59B 4MB4A 3P4OB 2ID5A 2VLKB 5MENA 1SEQL 2VDOH 3HMXH 5JPNB 4X4XA 4BSWA 4PR5A 3GSOA 4YHMH 3GB7B 1CFNA 2ADFL 2PW2B 2R8SH 1A64A 4R9HA 5C0AA 1J8HE 3F7VB 3KLSA 2D2OA 4WW2B 4PRHE 3SKMB 1FE8L 2C1PA 4H25A 3DWTA 1PFCA 1YYLL 2VLKE 3HC0B 5KN5A 1AHWA 5I19H 1BFVH 3EYQC 3K74B 5IGXL 2F19H 2ZUQB 1YEEL 4TSAH 4KKLC 5DHXB 3KPRA 4WDIB 5AYQA 3JTSB 5MERB 3VD9A 3V0AC 4MXWH 1MCPL 5IVXE 4LIQL 4DKEH 3FO1B 3S96B 2GJJA 5FKPA 4HJGA 2IQ9H 1UJ3C 4L4JA 3KPPA 1T80A 3ZDYE 4RGOL 3VD5A 4YR6A 4OB5H 3WKNA 1F2XK 1PGVA 2A6IA 4M7EC 3QDJB 4M6NL 3GMRA 3H0TA 5D1QB 3DV4A 4PGEA 2EYSA 3Q1SL 3MO1A 3QRGL 15C8L 4P4KD 1P5VA 3Q2CA 3RVVD 3NCBB 4ZUVA 3CFBA 4U6YA 2VXTH 3UTSD 3P11H 5JW4N 1AQKL 3E4GA 4OJFL 5FUOL 3QDJE 2VNCA 1X5IA 3U83A 5DYOA 1EAPA 4PBVC 3U1SL 4J3VA 5MEOB 5TF0A 4RA3A 5GGSA 4NHUA 4D0BA 4KK9D 5DMYA 5IJDA 3RKDD 4LFHG 43CAA 1JFQL 4JDVB 2GSIA 4G3YH 1TDQA 4UNTA 1RY7B 1UWXK 1JV5A 2J8UB 4QXUH 3NFNB 3QFJA 1ZHNA 2DKSA 3QDHA 3VWJB 1EX0A 5DQJB 2P8LB 3MCLL 3CX5K 1AGDA 3R0MA 5I8EA 1B2WH 2F15A 4HUWA 5E8DH 2AJ3B 3NCCB 2VLRA 3RIZA 4NSKB 4NPYA 5C09B 1XF3A 3UPCA 2Q7YB 2P48B 5BJTB 1QBLH 1NQBA 4EN3A 4HK0B 2W07A 2UY7A 1DL7L 1WZ1H 1LE9A 1MHCB 4PRPB 1D5ZB 1AKJD 2UZXB 3EJJX 4L4TA 3C09B 3REVA 5BVJA 4TSCL 2NY6B 5HGHB 4X5XA 1A1NA 1P7QB 4NNYA 1WK0A 4LLVA 1A3LL 1OWWA 5B4MD 1LQSR 3HTLX 4KY1L 1G9NH 2NY2B 4KMTH 3IF1A 4LDEB 4PRPE 3VFOB 1BBDL 2HFFB 4OCWH 3O2DL 5EBLB 5DZNA 3K0WA 2YPLA 3LSOB 4WGVB 1QFUH 4OCYL 4JFFB 5JQ6H 1H8SA 1O5DT 4MNGA 5I1HH 1G6RL 1UJTA 2CIKA 4ZTOH 2FGWL 4AY0A 5GGTH 3BPCA 2H2SC 1MIMH 2EXYC 25C8L 2K1MA 3KLAA 3IXAB 3V7AE 5C0DB 3GBML 4OFYA 1EGJA 5BZWB 4JFFE 4X8JA 4KHXH 3RY6A 1CDJA 4RSVA 3TA3C 3SCMA 4BSSA 3AU1A 4UV7L 2AQ1A 32C2A 3L5IA 4XNYL 4M7LL 4YUEL 3RZCC 1BVLA 3TT1H 4M6AA 3UEZA 5D1QC 1W0VA 3LB6C 4UIMA 3D85B 2GQHA 2X4OB 1YPZA 4JANA 2W0FB 2EDXA 3MV01 1FV1B 5C0JB 4KQ4L 1QSVA 1NCAL 1IM9B 3MLYH 1IC5L 1D3CA 1LWRA 4K3DL 4MXQD 1UVQB 1YEJH 2NW2A 4OCMC 5D2LF 1QFHA 2OL3B 5DHYB 1HOCB 1RIUH 5EA0H 3E6FA 4GAYA 4TPRL 4HV8B 1MJUH 4TRPH 4KZDH 1JYXA 5JDJA 4K3EH 3D87B 4PLOB 3TH2T 3VWJC 4CVUA 3MR9B 4HCRL 2X4PA 5A3IC 2XZCL 4JPWH 43C9B 1AY1L 1G9EA 1QFWH 5DJDA 1BEYH 4BQ6A 1KLUA 2Y07L 5HHVH 2DIBA 4LHUA 2V9TA 1BP3B 2X1XR 1OGAD 3VFNB 1LO3L 3CVHA 1B0GB 5T1MB 5MEQA 5DI8B 3RVWC 3PGFH 5IFAL 3RVXD 1AXIB 3HE6A 3Q48A 2ENYA 4OZGB 5FYLH 1RIHL 3HNTL 3L3DA 4P5TD 1WFTA 3NPSB 3JZ7A 3TBYB 5SWZD 4NQSB 5F9WC 4HK3J 1HILA 3C09C 2AI0L 3QG6B 4WIQA 3GSVA 4IRSA 4EXKA 1KELL 4Z94G 2A6KA 2Z92A 1JNHA 3UCRA 4ODBD 3LKQB 1FNLA 2I5YL 4HWEH 1ORQB 1IGCH 4OZGE 4BQCA 4HS8L 4JR9H 4O5LH 4M8QB 4DTGH 2JKXA 3QP3A 1H5BB 1J9CT 4HXBH 3AS2A 4LLDB 1DBML 2ZJSH 3NTCL 2OTWB 1CGVA 5FO8A 1D5MB 4S11A 3PG2A 4BFIB 1FBIH 4E0RB 5DGRA 4MWFB 5JQHC 3TO4D 1MOEA 5AWNL 4X9FA 2DYPD 1RZ7L 3HR5A 1HI6A 5A1AA 1AO7D 3CLEL 5B8CB 3IKKA 1A4KB 3D0VB 4FQXD 2DLGA 5IJVA 3FRPA 2DQJL 5M94B 4YJZL 4DN4L 1I8KB 3BXNB 1XIWB 3CFEA 3MRDB 3HZKA 3U0TB 1UM6L 2X89D 1QR1B 35C8H 5JPMB 5F9OH 2PCPB 4OIAA 4YC2B 4ZAKB 5KSBA 3CZJA 2OJEB 4XPHH 1F00I 4OZHB 1RZKC 2CGRH 1BZ7A 2Z93B 5TDNB 1DQLL 1IAOA 1JPFA 2HKHH 5SWQB 2BNRB 2SEBB 4PJXF 2JK5A 1CBVH 3V0VA 4K23L 3TA3D 3BOVA 5IW6A 5CILH 1AIFA 5FA4B 2X05A 4RA0C 4OZHE 4XP4L 1YMMA 2BZDA 5KG9A 4AQ1B 1QKZL 1PSKL 5GQRK 2X4TB 4HX1A 2XRAL 3IDUA 2Z64A 4H8WC 4IMLA 3VXUA 4LVNB 1T83A 4GRLA 4RCAA 3MYZA 2A9ML 2YMXL 4IRJC 1I3UA 3QUZB 5MP6H 2VXUL 3I84A 2XG5A 2CLZB 4NO2B 3V79C 2BJMH 2ARJQ 4NFBA 4UZGA 3SKNA 1UCBH 3EKCA 3HZMA 3LY6A 4FZEH 3CK0H 4PV8A 1CYGA 1KTKE 1TTFA 1ADQL 1HWGB 1NCDH 4XVJH 2FGZA 4WEBH 5BMFH 4M00A 5CBAA 5GISH 2DDQL 4PJ8B 4K9EH 3QXVA 3DBXB 3T0VA 4WU7B 3GI9L 3Q5YA 1S9KC 5C0CE 4K3JL 1CDGA 3L3IB 4HDIB 3O11A 4LCYA 4I2XB 5ID0B 3QEQA 3KJ6H 3ILQD 4MQSB 5HI5D 3T2NH 1YZZA 4GXVL 2X09A 4MYWB 2ADGB 1A7PH 5ENWA 2BSED 3B3IB 5CWSA 1NEZB 1N7MH 2J4WH 4X80H 3KXFB 4KMQA 5ICYA 5ECJE 3K2UH 4HULB 3N06B 4OQTL 1DN2A 1I4FA 2HLAB 3QG7H 3UL7A 5DVOA 4I3SL 4D0DB 5HYJA 3MLTB 1QBBA 4Y2DD 1PBYA 4XT1C 4PQ8A 1KJ3L 3F6LA 4N5UA 4LU5L 2V7HB 2JIXD 3DIFA 1ONQA 5DC9B 1WWCA 5C0GB 3KXFE 4NKHA 1EJ6A 2KL6A 4JY4A 4NBXB 5CEXA 5IMLB 1R3HA 5ITBL 1XIWC 2OMBA 2YZ8A 3O2DA 4XXDB 3ES6B 1YC8A 4OCLC 1I3RB 4NKDA 1MRFL 3U6RB 1P4IL 1A3RH 4Q62A 4UNVA 5LGJA 1G6RA 3T0AA 1WAAA 4WWKB 3HB3D 1FNGB 3CPLA 1XR8B 2KUTA 5DFWH 1RZGB 1RPQA 3TEUA 1UB5B 1REIA 4LSVH 1KYOK 3VFRB 3GSXA 1I7ZA 4BQ8A 1QLEL 3MLPA 2X41A 1S9VB 1EEUA 3T65B 3ZO0A 4Z64C 5F21B 3VH8A 2E7BA 3GHEL 2EIZA 2X70A 5IW1B 1GC1C 1VFUA 4JREC 1CLZH 1OB1A 1Y0LA 4HIXL 4XCEB 3DX9B 4OZ4A 3VFUB 3QNXA 1DVFD 2IQAB 4M02A 4S10A 4LHJB 3QUXC 1VFMA 2Z8RA 1EFXD 4JO2L 1U6AH 2YSSA 3MLSH 4K71C 4PJAB 1N64H 1NC2B 4HIHB 4UBDC 4LI2A 4K8RC 4P4RB 2QHRL 4ZS7H 3QUZC 5F70A 5H35A 5SWSE 2RQ8A 3ZTJG 1NLBL 1R3IH 5HHMD 1K4DA 1AI1H 5ALBH 3ZE0E 4OUOA 4ISVB 4BA8A 3JV4A 4PJAE 4OGAC 1YNLH 5KVFL 3FO9A 1A0QL 3AREA 4XNZC 3GBLA 2IALB 4YAQB 4DAGL 5J13C 5BXFB 1KJ2L 1YEGL 2QSCL 5C0BB 4HCRA 3ZYIA 3UJIH 3HKFA 3QUMB 3U9PL 4MJ5B 3X3FL 4DUXA 2DB8A 4PRNA 3CSPA 4G43B 2VXQL 5GS1A 5HGBA 4OCNC 1FNEA 4RMSA 3FB8B 5E8NA 4RAVA 5IWLA 1CGSH 3QIWA 4V1DD 1RUQL 2F53A 1KB9J 3CU1A 5HJ3A 5I8CB 4M48L 2GAZB 5SX4H 3C8KB 1JN6A 2APBA 1KCVH 2RJMA 3CDYA 4B7LA 3L1OH 5C0BE 3IKCA 4HF5H 1A6UL 4YE4L 3LAFA 1OAUL 1XGTB 4KUCF 4NNXA 3WXWH 5JIIA 5EUOF 3RHWF 3EOAA 4I18C 5E8EB 1FO0B 4NP4L 3RWCA 3QHFH 1YNKL 3KR3H 2EDHA 4UILL 4JVWA 3LDBC 3ZYJA 5E5UB 4NDMA 4HS6A 5DEGA 1FAIH 2YPVL 2E7MA 2KH2B 1GOHA 1Z5LB 4X9HA 5AD0A 4B8CD 3ARDD 5T3ZD 4KI5D 2FECL 4C4KT 4HIJB 2EE9A 1CWVA 5IKCA 3FCTB 3ULUD 1Z3GH 5EOTB 2XV6B 4PTUA 1NGXA 2V7NB 4XP1H 4PERA 5C86A 1TZGL 3SDDB 2X4QA 5IK3A 5JHLH 5L8LB 3UTQB 1KB5B 2ZSVA 3BH8B 4JQXA 5GRXG 5DJYA 5IQ7L 1E4XI 3EUUA 1WQVT 3HNSL 4P2OC 2PYEA 2WWMD 5D9SB 3MBXH 2VAJA 2OS7A 1GIGH 2KQNA 1DUYB 5T1KB 1WF5A 4P3CL 4UUJA 2VXSH 4NKOB 1NAML 4YDLB 2XWBB 3PJSB 5FA3A 4LSAA 4C56A 1OQXA 3IFLL 1D6VL 1VFAB 2BDNH 3MUY1 4LGPB 4WW2F 5CGYD 4QRTB 2VZSA 3SGEI 1DQDL 3MNVB 3AROA 2JJTA 4MDIB 2CLRB 2OMTA 1F42A 1P84K 3VXRA 1ZGLM 5IG7B 1OSZB 1VGKA 3VXNB 4PTTA 3G5YA 1BQHB 4E42A 4LPYA 1N6QH 5F71A 4P9HC 4TULL 5FFLA 3WN4A 4CU8A 5T3XH 1FZOA 3SOBL 3WD5H 4LNRA 1U91B 1I8MA 1NGZA 3I50L 4P46A 2E8YA 4Y1AB 2APFA 1EEQA 4R7DA 4WFFE 1FSKB 4NN5B 2VZUA 3NGBB 5KANI 1KCLA 4H1LH 3QISA 4V2DA 2R0LH 2J7LA 1KENH 5DRNB 3LMJH 4HT1H 3OGOE 3TNNA 1K6QL 1SVCP 5F3HA 2PW1B 4FFZH 1K2DB 2XTJD 5ERWB 1IGIL 3IFNL 2J5LB 3FN0H 5I1EL 4LRNH 1A9BB 2HYMA 4NM8H 4J4PA 4FQIH 2VE6A 5HGDA 2BX5A 5E4EC 2VITA 4U6HA 1CFSA 4MQ7A 5ALCH 5EIIB 1EXUA 5J0BA 3EDKA 2V2TB 4P2RD 1I9JL 1U3HB 1ADQA 1BWMA 3ARFC 3S8WA 2EDFA 4TYUA 3VRIB 1XH3A 1LP9A 4PJ5B 3T3ME 2BY2A 4OLYL 2DWDA 3EAKA 1NMCC 1AGEA 3NIGF 2J8UF 2V5TA 3MBED 3G39A 5JW3H 1AJ7H 2EIDA 4P9MH 1IJ9A 5HDLA 5JO5A 1G7IB 5AZEL 1QBMH 1XCQA 1JRHI 2FL5B 3RWFA 4LKCA 2J6EH 4FG6C 5LWYL 2Y25A 4DGIL 4N0UB 4OQTA 2E9BA 2CIIA 3SDDC 1T7WA 3KYOB 2I25N 1QLRB 1OARH 1QPPA 4NO0B 3JXAA 4RGNB 3LN5B 2ESVA 5C0FA 3W9DB 4TSBL 2P5WB 4N0UE 1R0AH 3P0YH 4YFDB 2DF3A 2E9JA 3QUKA 2W91A 3BHBB 1DQJA 2HFEB 1DE4A 1CFTB 1MJJA 3JWOC 1TVBB 3OQ3B 1NCCL 2D4FA 2QKIB 4KHTH 3DX6B 1AXSA 4R4FL 1N0XL 4WJ5B 4HD9A 1I1AB 1TQBC 4N5EC 5DDHB 3MV9B 4IMKC 2P1YA 4YEEA 1CDIA 3V7AG 3O3BA 4H88H 4P2OD 1KBGH 4DQOH 2P8PA 4FQ1L 4ZOAA 3C2AL 2QTEA 3I9GH 1DQQA 2GFBB 1A9EA 3RGVC 4J1UB 1SBSL 4WNQA 4UDTB 2WBWB 2P5ED 3MXVL 5BV7B 3LEYL 3MV9E 1FSKC 4NN5C 4F37F 1CGTA 1LEIB 4MD0B 3HAEB 3S36H 4MA3B 3EO9H 1FFPB 4LBEA 1NBZB 4HPOL 1TIUA 4QRPB 3OJAB 2ICCA 3AS3A 3W39A 2N4IA 5JOFB 4WGWB 1FHGA 5E5MA 3UBXA 1OW0A 3O4LD 4K7PY 4KK5D 3GKWH 4ELME 1TZIA 1A7NL 1JVKA 4MA8L 1JNNL 3AY4C 5F7EL 4FTVD 3L95A 3GGWA 2VDRH 4F7MA 2BOCA 2NY3D 3GRWA 1CGUA 1WBYB 5T33L 2WUBH 2YWZA 1INQB 1U3HC 5CIPH 4X6CB 1XR9B 1KJ2A 5BQ7A 4G8EB 1I3GH 1NLDH 1ZEAH 2AKRA 4YGAB 4NQXB 4XPFH 5K59F 1FN4B 1RJZB 5TDOB 4APQB 5B0NA 1MJ7H 3FQNB 4WV1C 2Q3ZA 2IAND 1FC2D 3QXDA 3QO1B 1XCDA 1K5GC 4X6CE 4Z7UB 1CD0A 5EDXA 3OKKA 3GNML 2FJGA 5DTFA 3T0XA 5C3TA 4Y4HB 1OT2A 1CDCA 5A16A 2W1NA 4LLUA 4PJDB 3VI4E 3ZHKA 5E2VL 1UM4H 3QIBD 1ZA6B 3QDMA 1NDGA 1NFIB 4YEFA 3U9UA 3HA0A 1L0YA 4Z7UE 4LKXA 2E27H 4KQ3L 3DOSA 5D7LA 4M1GH 5BS0B 4CAGA 4EI5D 1E4KC 1C16A 1U41A 2ZCLH 1S9XB 5GGVY 4Z8GA 1AGBA 2IAMD 2DBLL 4NN7C 5JLZA 3W5NA 4PS4L 4M6OL 4HWZA 4YXLL 3OXRA 5JNYB 1FYTB 1MRCH 2QHLA 4FZ8L 4D9RD 2RR6A 1QHPA 5B39A 4F80A 1HEZA 1KFAH 3N85H 1KCUL 1I1AC 1VESA 4DKAA 4ZS6D 4YGVA 3BDYH 2EDRA 4HUKB 4ODSH 5HSFA 5JXEC 4QCIB 4HKBB 4P59H 2A83A 2DQHH 3VXMB 4MQWX 3MA9H 4CNCA 1BLNB 1FYTE 1HXYA 2DMKA 5EORH 4LEXH 5TGBB 5IP4A 1BVKA 3INUL 5FGBA 1NAMA 1WSST 1E28B 2J8HA 3BD4A 3BD5A 2FATH 3TZVB 3P9WB 3NFPB 5LQBH 4POZD 3WSQH 3ZKNC 2AS5M 4XNMA 3G5ZA 3VXME 3OGMB 3G04C 4N5ED 3DNKA 1NBQA 4YK4B 5DA4A 3V4VH 1LEKB 3W2DL 1U8MB 2UZIH 4NHCL 4QTIL 4NQDB 4R2GB 4PY8I 4FQQA 1GZQB 4Z7VF 5ESVB 1UYWH 3C5ZD 5EUKB 5JIHA 3O53A 4JRYB 2BCKB 3EJZD 4RFOH 1TLKA 5AUMA 3DO3A 2AJUH 2ASSB 5I8OL 4L9LB 5ICXB 4OIBA 1ZV5A 3QNYB 3V2AR 2OMVA 3GI8L 3MRGA 3ARYA 2X5PA 4NQDE 2PTTB 4LCWA 3CU7A 5CJ8A 2Y6SC 2BVOB 3D0LA 3UTZB 1PX4A 5GHWH 1XKUA 4LLAA 3N1QC 2C4FU 4JRYE 3LS4L 1KTLA 1U8LA 5EO1B 3QXUA 3AUVA 2X10A 3MRNB 5C6TH 1PEWA 2IG2H 3A6CH 3RW7A 4PD4K 1GXEA 5DRWA 3TCLA 3RU8H 2F54E 5DJXA 3ILPB 3HG1A 5EU5A 5GS0D 1VKXA 4OLXL 5J56B 2HJLB 3O9WA 5CD5D 1EHLH 5I30H 3A6OA 3FB5B 1G7MA 3HZYB 5ISZD 5ID1A 3DHMA 5IB5B 4U1IB 4ETQB 4P4KA 3CUPA 3PWPD 2H6PA 2C3HA 1M05B 1DBJH 4R90H 1ZGLA 1LDPL 1MY5A 2FB4L 1UXSA 5EIQA 4TTDC 4U7KA 1GCFA 2HFGH 3IDGB 1K85A 4XAKE 4KZEL 2OR7A 3TF7C 4KRNA 1NMBL 2A73B 4PJEF 3QIUB 4KVNL 5EFIB 4N9GA 1QACA 1E6JL 1ORSB 3TVMD 1HH9B 2VDKH 4FQJH 4YBLC 4UI2A 2YD9A 3HUJB 1J1XH 1O6TA 4QTHB 1NEZG 4YHPA 4YFEA 3ZKMC 4OI7A 4M61B 1ZLSL 5HDQL 5HHNA 3BRGC 1SJXA 4NO5B 1OY3B 3QQ4B 1MREH 1P2CB 5ESAA 1LD9A 5FTTB 3TZVC 1J0IA 5K9JL 3DVNA 1IEBB 3AXLB 3HUJE 4WO4D 3W3LA 1ETZB 4UINH 2GITB 5E2TL 1TPXB 5F97E 1AKJA 4YK4C 2XOTA 1UWGH 5LXGH 2EIEA 3IB4A 3F7PC 4JDTL 5IBTH 5JHDB 4J3UA 5I1GH 3H9SB 1MFBH 5D7IF 1IGJA 4GSDL 4QHUB 3VFTA 3WDJA 1J7VR 4RGMC 4G8GA 3WIIL 5F1KC 5CFHA 1NANH 3MSPA 2WBJB 1AE6L 5GIRB 4O2FA 3C2SA 4G8FB 4WUUD 3LRHA 3ZKND 3H9SE 3BI9X 3AM8C 1V3LA 2EXWC 1KEML 3PDDA 3E2HC 1NSNL 4QRRE 4U3CA 4UQ3A 4KRPC 2C3VB 4W70A 4Q6IB 2NW3B 3QEHA 1LE5B 4GMTL 3NOIA 4XNUH 3C60B 3FHQA 4WY7H 2ZOKA 3G6JA 1GVIA 3QQNA 3QEUA 3QULB 5IHUH 1ZGLP 3G9VA 1SEQH 1CGXA 4OGYH 5ANME 3O6FB 2AXFA 1IGML 3NA4A 3IU4L 5F7WC 3MLXL 1CE1L 5FYKE 2FJHB 5HPOA 2P49B 2Y6SD 3P0VL 2UWEB 3O81A 1OGTA 1OTUD 2X4SB 1GJIA 3EO1A 3R4DA 5HTSA 4IOFC 5DO2C 4AMKL 4GKNA 1F3DH 2MQCA 4W4NA 1A2YA 5BOZG 1RZKL 2EC8A 2ZCHH 3LEVL 4HZLA 5E6ID 4U7MA 3L7EB 4NJAL 2OLDA 1KTDB 5ETUB 4PGJA 5IGXH 1M1SA 1YEEH 1N2RB 3VE0A 5L6YL 2R23A 3FB7A 1CL7I 3DV6B 4OZFB 5CEZD 3SQOL 1UH4A 1ODAA 4JM2C 3UL8A 3U30B 2UWEE 1UJ3A 4JZNB 2P8MA 3L3GA 2VR5A 3KPQB 3Q3GB 4I48A 3LHPL 4RGOH 4M7EA 1TZHA 2FH6A 5HY9B 2AEWA 4NQCB 4JVUA 4M7ZC 3V5HA 1IGYA 4XGZB 4OM1L 4H8WL 1RQ5A 4WHTB 3LKRB 3QRGH 15C8H 3WV0A 1YECL 4R96B 4A2LA 1JGDA 4OUUB 4U2ZA 4NKMA 5CKAA 4PG9B 1X5AA 1MPAL 1HSBB 2MCPL 5GGSY 1AQKH 5IJCA 4OJFH 5FUOH 3CC5B 4KXFB 1I1CA 2NY4C 2V2XB 5D1XD 4M6ML 5HGAA 4CADB 5I9QC 2AERT 4NQUA 1NUGA 4N90E 4WFHD 4NBZB 2HT4C 5IVZB 4PREA