2XOTA

Crystal structure of neuronal leucine rich repeat protein amigo-1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
335
structure length
331
Chain Sequence
RSVVSCPANCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amphoterin-induced protein 1
publication title Crystal Structure and Role of Glycans and Dimerisation in Folding of Neuronal Leucine-Rich Repeat Protein Amigo-1
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 74
structure length 331
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xotA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2xotA01
5IB3B 1BJ1J 1NAKH 2J12B 5D96B 3OAYK 3KJ6L 4M1CC 3RIFF 1MFDL 1KTLA 1NBVH 4B8CD 5FUZL 1MIEL 1N6VA 4Z95H 1FGVH 1FNHA 2JIXA 3HMXA 5GGRY 1VCAA 3RKDD 1G9NH 4JZOB 2Y06L 1MCOH 1RY7B 1HOCB 3JV6A 2LTQC 3FZUD 2VR4A 2NY2D 3BQUB 4IM6A 5DFVD 2EEDA 4HULB 3CC5A 4I9WE 1A9BB 1MAML 3LS5H 4PJBA 5DLML 5LAXA 5FYJE 1T1ZA 1OPGH 3FMGL 3GMRA 5F9WB 3IVKB 2VLMD 3CNKA 5IOPB 1P7KA 3AXLB 3GUTB 1P53A 5EC1B 3S97C 5JTWA 4H5SB 4KRNA 4LNVA 5CSZA 5D1XD 4UOW0 1MCWW 2BCKB 4OM0L 4XNZB 2XWTA 3SJVA 1UH2A 5KJRL 2GJ6D 3C08H 3AREB 3W3NA 4RGOL 4MD0A 3QXAA 3TBYA 1QFOA 2DQHH 4P4KD 3WNMA 4PRPD 1N59A 4NGHH 3ZKQD 4PS4L 1B90A 3O6LH 3IAPA 3VFPA 3JTSA 5EDXA 4G7YL 4PKIG 2C3WA 4KI5F 3R0MA 4R6UA 4L9DA 2ILLA 4CVZB 5F6HI 2FX8L 4PV8A 3NIFE 4QRSA 1LDPH 3BXNB 3UN9A 5DJXB 3ZHDA 3ULVD 4NQXA 3MRHA 2V2WB 4OD2A 3QCVL 4I77L 4OQTH 4MJ5B 2GYSA 4IRZH 1JNLH 3WN4A 4Y5VA 5ADPL 5CSGA 4J1UA 5F6HJ 4ZMAT 2PYFA 4QXUL 1EEYA 4JM2A 1JRHH 2EDLA 4JM2F 3G39A 1E6OL 2DICA 2GTZB 4JFOB 4JFZL 4G6ML 4OI8A 5KOVC 4ZTPL 3SO3C 1KLGA 5CGTA 2W9EL 4MGXA 1UB5A 2QHRL 4WTXA 1NCCH 4JDVB 1KOHA 4U1HA 3PWUB 3BO8B 1DLFL 3ARBC 1SY6A 5MERB 1GWBA 5H94B 1A5FL 3MPCA 4ZOBA 5DMJB 3VGFA 1ORQB 5CEZL 1FNSH 2R4SH 3IFOB 3GKWL 2IJ0C 4X6CA 2Y07H 2ICWJ 1WZMA 2J8HA 1GRWA 4XC1L 3B5HA 2IH3B 1XCTB 4X6CF 5TE6H 4D3CH 1N0LA 4JQXC 4L3CB 3QI9D 1KCRL 4XCYB 1DDHB 3C5ZD 4X7FC 1Z3GL 4RFEA 2X2YA 3UBXI 4KVNH 5E95B 4JGJA 4TSCL 1Q1JL 1N2RB 4LIQE 5JXEC 2DBLH 3DURB 1A7PH 2FO4A 1NQBA 4LI2A 1FLRL 1S3KL 4GKNB 4MHHG 1HZHL 4NQSA 5KVGL 2ELLA 3RTQB 1IAKA 2APBA 5DS8B 2YXMA 1FT8A 3LSOB 4WV1A 3QDHA 2P48B 3EYUL 4NN5C 3RGVD 2MFNA 4ARNA 3LQAH 4M9PA 5I1JH 2YD5A 4Z18A 1J9CT 4GXUM 1CLYL 1YDPA 3O3EA 2D31A 2JJTC 5JR1H 3CUPB 4WI5A 2YD1A 5T3XE 3FFDA 4HEPG 3IDXL 3QIBC 3OKDB 4NN6B 4EI5C 4ZPVA 4XNYL 4WW2B 5T5FH 1BQHA 3LCYA 4OUUB 3J8F7 1D6EB 4P2RB 5IB3A 4TTGA 3QBTB 1FQVA 4Y5YB 1BD2E 5MHSE 1Y18A 1A9EB 4PJFA 1V3KA 1C7SA 2A6IA 1I3GL 3AY4A 3JTTB 1SEQH 1BP3B 1N5YH 4PJFF 3ARRA 5HYJB 2EIDA 4EZGA 1DN2A 1B88A 3LD8B 3RW7A 4PGCB 1UXWA 3QDMB 1HOCA 3VJ6A 1OTUC 3ARXA 1CWVA 2DIAA 4FOMA 2H41A 4C54A 4RMVA 4Z0XB 3M07A 1A9BA 4A2LA 5D2NA 4P23C 5HI5D 2IAMD 3MLWL 1CZ8H 1X4YA 5LGJB 4HLZG 3RI5F 2V5YA 1MFBL 3NCJH 4R26H 2P1OB 1JZ3A 1HXMA 1FDLL 3QUXB 4FZEH 3AXLA 1CICA 4LDOB 5EC1A 4N1EA 4KQ4L 4PREA 4FQXA 1JGUL 4XB8A 2Y72A 1CL7I 3O6KL 4P4RB 3CVIL 3AREA 1JHTA 3R1GH 5C08D 3WLWD 2BNRD 4YXLH 2YXFA 4EOWH 1DBKH 4RWYL 3W3LA 4HWZA 2H2SD 3NN8B 2XFXA 4F80A 3D3VE 1UH3A 1NCBL 4GLRH 2O93L 3WUWA 4WDIB 4OLXL 4L8CA 4WW1B 4XPAL 2O5ZH 5FYKD 4JO3L 5IWLA 4CVZA 3PJSB 4HH9B 5B38G 3EYFB 1PQZB 4HJJL 4D0CB 1IAOB 3BXNA 1L9MA 4JPKL 4HCRA 5T3ZE 4OIBA 2V2WA 3QIWB 5TE7H 2DQGH 1OAQH 4MJ5A 3L1OH 2EC9T 3PHSA 1NC2A 2YBRA 2ENSA 2X44D 1TJIH 1X5YA 4OFPA 2X42A 3MLYL 5F6IB 5JDSB 1BVLB 5A3ID 1YN7B 3IJHA 5KVEL 1EFQA 1H6TA 4KXFB 2GTZA 3WPIA 3U4BH 1NEZG 1MCCA 3SDCD 3H9SB 3X13B 4JDVA 1OARH 5B8CB 1BGXH 3PWUA 4Y4FB 2ATPA 3NMEA 4XP9H 2J4WL 3BO8A 2Q8AH 1CDGA 5FAAA 3UDWC 3G04B 2C1OB 5TPWH 5MERA 3MLUH 1JPFA 2V9RA 3V7AG 2Y1VA 3VFRA 3T4YB 4S1SL 2KQNA 1CFSB 4JCMA 3TT3L 6FABH 3S88H 2MCPH 1K5NB 4Z7NE 2BHYA 4LPUA 3EJYC 2IH3A 1XCTA 3O45B 5HGGS 3WJJC 2PN5A 4FQQA 2NXZD 3E6HB 4L3CA 3FFCB 2WQWA 1DDHA 1S7UA 1J10A 3MRLB 4IBLT 4PRAB 1NCWH 2V2XA 1UM4H 3P77B 1N2RA 2E3VA 2N4IA 4P2OC 3DURA 3BDXA 2C3XA 4PGDB 4J4LA 4GKNA 4GO6B 5GGRA 5T1MB 5DMYA 4KZDL 3HRZB 3RTQA 3QHZH 5HZLB 4LK4A 5DS8A 1DE4A 3E6FA 1G1YA 4HG4J 4NRZA 3LSOA 1IQDB 2R1XA 4YBQC 5CHNB 1KFAL 5F96H 2J7LA 5FKPB 2X10A 5E1AA 5AWCA 1CGSL 4N0FB 4I9WD 4F33B 1P84J 4I3RH 3SDXA 4H8WH 3TCXA 5FYJD 4WEUD 4I0PA 4JZNB 3SDXF 4KI1A 4QBZA 5ILTL 1E4KA 3OKDA 3UTTA 1CIDA 2RR6A 2R23A 3MRQA 4WW2A 3KLAB 1YPZB 2NR6D 4OFIA 2RHEA 3QG6B 4OUUA 4WI3A 4P2RA 4LSQH 4R4BB 2P7TB 3D85B 4HG4K 4Y5YA 5M7QA 1WWLA 2Q4GW 1W8NA 1SHMA 1FYTB 1A9EA 2G60H 1MNUL 4G8GE 1IC4L 1ACYL 4OCXL 3JTTA 4MNGE 4XHQA 3P72A 5IR1B 2Y4SA 1FPTL 5HYJA 2FX7H 4X0KB 3O2DL 5K9QI 2HFGL 3MA7B 4LSSH 2Q3ZA 4BELD 3TEUA 2A1WH 3MV9A 4YUEH 1T0NB 3T1FA 2X70A 1IKNC 4F9LA 4POZC 1CU4H 2ZG1A 5LGJA 4ELME 3PWPE 2PNDA 1KN2H 2XQBH 4MA7H 1IJ9A 3UJTL 4XMPH 3PHQB 3JZ7A 4TULH 3LHPH 3QUXA 5IEKB 5HHOD 3VFSB 3HAEG 1K3IA 4QC0A 4XB7A 3VWKB 2C1PB 2Y25A 1IAIH 2Z31B 2D7MA 3X11B 1S7RB 3LMJH 4KRPC 4PQ8A 3ULUE 1O6TA 2EDEA 1A6VL 4LBEB 4WP6A 3FQTB 5HGDB 5HYSB 1MY7A 3RWFB 3DBXB 1NLDL 2X4TB 2ICEA 4P49A 1DQLL 4PRIB 2FH8A 3NN8A 4KKAC 4YK4B 3SEPA 2APFA 3PQYE 1MHEB 1OAUH 2FIRT 2AK4D 2IMMA 1K5DC 3MLTB 5HDBE 2PXYC 1KIPB 1QACA 5DVOA 3PJSA 4GKZB 3Q0HA 3EYFA 4Y4KC 2VLKD 1MRDH 5KSAB 1IAOA 5JO5B 2G2RA 2HRPH 4CC4C 1GGIL 3QIWA 4UB0H 3RUGE 4X6FB 4K17A 1JGVH 1Y0LB 5C9KA 4AL8H 3O9WB 1CS6A 2F53B 1HN1A 2VXQL 2UWEB 3S34L 1VEOA 1BHGA 3DYPA 4LCCC 4S1DD 5JDSA 1XIWC 1BVLA 4IRJB 1H8SA 4X6DB 1YN7A 3WKMH 2NZIA 2BHUA 4AG4H 3I3BA 1RUMH 3QEGL 3P3YA 4MCZB 4QTHB 1UJ3A 2BRRL 3HMWL 3H9SA 4PJXE 3UYRH 3W0WB 4UAOC 4BV4R 2VUOA 3ZYNA 5B8CA 4ZS7L 3GMMA 4IMKC 4UDUA 2EH8L 1RIVL 1MUJA 2D7OA 2XY2A 2YN5A 3VXSE 3O53A 2I9LA 1WZKA 2C1OA 4UNVA 1NMBL 1T5WA 4QGYA 1F00I 2H3NA 3PGDB 1WBYB 1G7PB 4M7EC 3TT1L 3U0TA 1JZ5A 1EPFA 1JHKH 3IXAB 3O4LE 4L4TD 3BZ5A 3O45A 1EGJA 2KH2B 4KGJA 4GMSH 3QDJD 2APVA 3E6HA 3HI5L 4DUXA 2OMZA 4YHOL 2DIBA 3V5HB 3WO3B 4UT6L 4Z7WE 2DD8L 4PRAA 4H26A 5MHSD 2W0PA 3DX6B 4X7CC 1BMGA 1IM9D 4PG2C 1OCWL 2BDNL 2XN9E 3MODH 4UFRA 3HRZA 1T1XA 4GBXD 2F8XC 3GSNA 4AEEA 4Z7UE 5I8KH 3IFNH 5GS3A 1KJ2L 2D7TL 5D70L 5I1IH 4KT1A 4DN4H 3BWAB 2HKHL 1U8QB 3ZDXF 5CHNA 1CCZA 5I71C 1G7JB 2VIRB 1TZGH 4N0FA 2R29H 1L6XA 3VWJA 2OR7A 1QP1A 4LVOC 1FNLA 3F7RA 4OI9A 5C0EB 2XT1B 1FAIH 1RUKL 3BGMA 1IT9H 1FNFA 5DJAB 4I8DA 3SKJH 1YPZA 5T33H 1F4XL 4K94H 1PGRB 3LRSA 4APQC 3QG6A 2AK1H 4KRMB 1OB1A 2P7TA 3D85A 4R4BA 1IGML 1BAFH 4JFEA 2EZ0C 5HHXH 1FYTA 1FE8L 1AI1L 2YKLL 1A22B 2BVQB 5BRZB 5IR1A 2XKUA 3RFZC 4GLPA 5MEOB 3MBXH 4HQ1A 1ZHLA 4OTXL 2V5SA 3RDTA 5GS2D 1CDBA 1INEH 1X44A 2OMBA 1JTTA 3CLEL 1T0NA 4PJ5D 5I8CA 3ARBB 3O41B 1GH7A 1L0XA 2NLJB 5GZND 1C1EH 3PHQA 2D9CA 3MXWL 1BFVH 5J1AB 1JIBA 2VWEE 3RWEB 5TFSH 5DJ0B 3SDAA 3VFSA 4TULL 4D0DA 1UT9A 1Q0XH 1W72L 4XGOA 1OP5K 3HB3C 1FN4A 4MDIA 1FAKT 2A9NL 4K8RD 3KS0J 3WDJA 1GYAA 1R24B 4LBEA 2HLAB 3C8KB 5SWZD 5HGDA 5HYSA 5F72S 5I1AA 1K6QL 2HT3C 3W3JA 4EN3A 1TPXC 2Q6WA 1WAAE 2WBWB 3STZA 2ZCKL 1MFCL 3ARFD 1MHEA 1QTYT 3LH2L 3F6IA 2HT2D 3DIFB 1GJIA 1KIPA 1RZIA 5EUOE 1A6AA 1NBQA 3QJFA 5A2KH 3L3HB 4NN5B 1WWAX 5EIIA 3RVXD 2XWBB 4WEBH 3WD5H 4UTAL 2MJWA 2CK0H 4LHUB 5L88H 1R3IH 3I9GH 5L8KB 1FQ9C 3O9WA 4FFWD 2F53A 1YNTB 1KOOA 5C71A 4ALAH 4IHOB 5F7WC 5HYQA 4UU9A 2R1YB 4EI5B 4S11A 1UACL 3SKMB 4LSTH 4KK8D 5CJQH 1ERNA 1D5MA 2IANB 5SWSD 3RY4A 1KC5H 3O4OC 3S5LB 1B6UA 2X89A 1LWRA 4MCZA 4PJEF 4YLQT 4QCIB 2ZUVA 2BOBA 2Z92A 4YPJA 1R3KA 1MJ8L 4F3FB 2VLRD 5E8NB 2WV3A 5EBWA 1OTSD 4X9HA 5FM8A 1FZKB 1YECL 3PGDA 1WBYA 1G7PA 4PJCB 4XWGL 4CVWA 4KKBD 5JOFB 1VDGA 2Q8BL 3C2SA 1W0WA 3IXAA 5D4QA 1M71B 2JTDA 2CKBL 3IS0X 3S4SG 5E5RB 3BX7C 5KOMC 2PYEA 5LWYL 3JWDL 3RWIB 3MRJB 4ZXBA 5DD3L 4DW2L 3MR9B 4OBSA 3BEVB 4V1DB 2GIYA 4QNPF 4TYUA 1MLBA 4HC1A 4PG9B 3DX6A 3QNYB 1KYOJ 4J3SA 4G8GD 1WICA 2VDPH 4HPOL 2JJSA 4H25B 4PTTB 5F7HA 5GRXG 1AY1H 5IB2B 4XBEH 3LKNB 1JHLH 2DB8A 1LO4H 3HZKA 5IK3A 4DN4L 3GBMH 3C6SB 1LO0L 4RIRB 5EU3B 4PR5B 2PF6A 3MRFA 4GG8A 3TYFA 3PWPD 3O6MH 5CD5C 3MYZA 4YHIA 5I1HL 4GRWE 1KYOK 2AJZB 3EHBD 1R3JB 4XP5H 4F58L 4LAQL 5DJAA 1OLZA 3VXRD 3P0YL 2D03H 3BPLB 5CWSA 5CEYA 1IT9L 3S36L 2MKWA 3VGGA 1F11A 3SKJL 1YNLL 4X7EC 3T04D 3KJ4B 4ZTOH 3ULUD 4OD1H 3WNPA 3C60C 4LNRB 1BZ7B 2BVQA 5J56B 5BRZA 3JWDC 3N06B 2AQ3A 3VGHA 1NFKA 5GS0L 4O2EA 5DD5L 2EC8A 5MEOA 2QQKL 3OQ3B 2BNQB 5IG7A 5EOCL 2P24B 1AH1A 5I74C 4BZ1H 2PTTB 5JOPE 3ME0A 5C9JA 1J1OL 1T0PB 3FTGB 4KK6D 2EDQA 3D0VA 4NHUB 1TETL 3CCHB 1UWGH 5IVOA 1AD0B 5F7UA 5J1AA 3S96A 2QLVB 4G5ZL 2FJFA 3EYQD 3BKYH 4CJ1A 3UX9B 2AEPL 4DKEL 4PB0H 2Q86B 2NXYD 1HILB 4NWUL 1MJUH 2OCFD 3DVIA 3VXPB 5IMLA 4JQXA 8CGTA 3V4UL 1HKLH 2HLAA 3C8KA 3SJVD 1DQTA 2EKSA 4NO0B 5JXEA 4P2OB 3TV3L 5IVNA 4K94C 2I9TB 4M00A 1NCAL 1IC5L 3OKMB 4U1KB 2WBJA 5KBNC 3MRRB 4XAWH 5IVXF 5HYJE 2R56H 3UZEA 4HWBH 2AJVL 1ED3B 4NKQB 4YHKH 3WFCL 3QDME 1T04B 4BFEA 1VFBA 3L3HA 4XNUH 3DWTA 1PJ9A 1MCKA 5GS0C 4LHUA 3DOSA 2FEEL 2EDYA 2P5EB 3HR5B 2FX9L 2E7LC 5DUBA 5L88L 5EIQA 1A6ZA 5SWQB 3RZCA 3O6NA 2N56A 4HMEA 4GUPB 2LFGA 2ASTB 2IWGA 4OZGB 2C3VA 5CEXB 1NAMH 4LSUH 4E41A 4RA0C 4JM2D 4HEME 1QLEH 2XN9D 1EH9A 2X4QB 3S5LA 2ZSVB 3L5WB 5ACMA 3ROLB 4EBQL 5D7LB 5BVJB 1T80A 2VLJE 4NZUL 4QTIH 4WI4A 4M43H 2J6EA 1UENA 1ZWIA 1D6VH 2Q6WB 5JXAH 1DQJB 4KV5E 4NHCH 3L3KB 1NGWB 4HBCL 5JW4Q 4R4FL 2P8MA 4M6OH 3JUZA 4PSJA 5IKCB 1FZKA 2FB4L 2HVKB 4PRBB 1MIML 4L4VB 3PL6D 1PSKH 1UGNA 1SMOA 4R4NC 1JF6A 4W6XB 1G7MB 1H5BC 4FFYL 2YMXH 1M71A 1I8IB 4MWFA 5JUEL 4M6ML 3D39B 3ETBF 1KCSL 3MRJA 5IROC 2MNUA 3IFLL 3X3GH 4WHYG 5EU7C 3QNYA 3BKJL 2VQTA 1CF8L 3OZ9H 1I9JL 3DVFA 4KRPB 1I7ZB 1NCTA 4IOSD 5I8EB 3TFKD 1JPST 1UJTA 4H25A 4EKXA 2CO6B 5ESAB 5A16A 5IB2A 4BZYA 2R8SL 3H9SE 4LHQB 2EXYC 4D9QD 2V9SA 4WWKC 4XBEL 2HKFH 5FCUH 5JW4N 3CZFB 2ESVE 1XF3B 5EU3A 3H3PH 3K80A 4PR5A 3KPSA 1YEEH 5IFHH 2CUMA 1T2JA 3OBAA 2PXYB 5CJXC 5DURB 4RMRA 5J9PB 4ODVH 4Y4KB 2R15A 2AJZA 2NY0C 4XNMA 2CJUH 3GDBA 5K93A 3OSKA 1R3JA 4U1IA 3SGDH 4RDQF 4AEFA 4KPHH 1T03H 4HZAA 5FGRA 1J0IA 3NBNA 2A6JA 4NUJA 3KJ4A 1I8KB 3FFCE 3I75B 4JKMA 3BIKB 5FDYA 1AR2A 3P30L 4LCCB 3CU7A 1EERB 1XIWB 1IC1A 1FH5H 2O5XH 5BVPH 3RFJA 4ZUUA 4G8IA 3WMSA 2O6QA 4K7PX 3OV6A 4UAOB 1L9NA 2P24A 1I85C 1J0ZA 1ZA3B 3Q1SL 3N50A 5GJTL 2PTTA 2OL3H 1MVUB 3U6RB 4HV8B 3FTGA 5LQBH 2VO5A 2A6KA 4AW4A 3IXTA 4BFGA 5ACZB 1AD0A 2DJUA 4MNQA 4NBZB 1ZHNA 2YN3A 3D25B 1HYSD 3ARDC 3T77A 4LDLB 5FB8A 4DOHB 1MFAH 1C16B 3OB0H 3TH3T 2VDRL 1WQVT 2Q86A 3VXPA 4FQXD 2EH7H 1NH6A 3GIZH 3RVWD 2EXWC 3O3AA 1D5BB 3HUJE 1W8OA 1A6WH 3ARED 4HWUA 3OKMA 2R69L 4S1RL 4HKBA 4IOIB 4P0DA 4ZODA 1ZXQA 3WPHA 1OSPL 2WWKO 5AZEL 5FK9B 1WLHA 2X1QA 1ED3A 3TWCL 1T04A 3RWJB 5I71B 3ILQC 1U8MB 1CBVH 5C0BB 5JIHA 2FT3A 2P5EA 3HR5A 4POYA 2DOCA 4LVOB 4D9LL 4O00A 3VXOB 5SWQA 1NC2D 3ZKNC 5I1EL 3OJDB 4O02H 4U2ZA 1FCGA 4PFEA 3TNNB 4OZGA 5JIIA 1FZOB 3GNML 3VDAA 1NMCB 4NQCB 4APQB 1JWUA 4F7TB 2X4QA 4Y16A 1KV3A 5K59F 3L5WA 5HDQH 3IDJA 2PO6A 3HNSH 4GAYA 5FV2A 1D5XB 1WGOA 3DUHA 5BVJA 5ISZB 1F90H 3MOAL 4L3EA 3NPZB 3MO1B 2NNAB 3CDFA 3QHTC 4LFHD 4M62H 4QTIL 2X4RB 3L3KA 5E56A 5AUMB 4PRIE 5JXAL 3Q5OA 1EK3A 2VH5H 5ANMB 2QR0B 2NY4C 3QISA 3KLHC 4N0RA 3FO2A 4F2MA 1BOYA 4PRBA 5L2JB 1JL8A 1TZIB 3UC0H 3B9AA 1ZVSB 4CRPA 5TE4H 1IKNA 1G7MA 1PX4A 2Z82A 3B9DA 5GXBB 3I02B 3HC0B 2VXSH 1I8IA 4YFLF 4ZQKA 2P49B 4L3FA 3UBXG 1ZGLA 2XZCL 3AMLA 4UUJB 1NGYB 4XPTH 3UPAA 4MYWB 2B0SH 5FUOH 3VXQB 2UWEE 2F74A 4XAKE 1F58L 3OHXA 4X6DE 3WPBA 4X98A 1I7ZA 3RBGA 5KSBB 2LABA 2GUOA 4WYKA 3V5DB 1RU9H 2R0ZL 4DZBB 1VACA 5ESAA 4NRXB 2CGRH 3WHE0 3W0WE 5HSFA 1HNFA 3RTQD 2FIKB 5GMFA 1KENL 2QEJA 1TPXB 2F54B 3CFCL 3CZFA 3TJEH 3FO1B 5J3HD 5L2KB 1XF3A 1HWHB 1UVQB 1X5JA 4JGUA 1P6FA 3VW3L 2PXYA 1YQVH 5EIVA 2NX5A 4JY5H 2I60L 5CLTA 1IVLA 1QHPA 4Y4KA 4KH2A 3HS0B 1FFRA 2P1YA 3O2DA 4CC4A 3MJ9L 3NOIA 4PRHE 5DRXA 1HH9B 1LO5A 3N1GC 3QNXB 4BFIA 5HD8D 3CXDH 3UTTD 4XRCA 4P3DB 4JDZB 2FDBP 2R9HC 1I8KA 1MVFA 2EEBA 3KPPB 3BZDA 3NIGF 2FGWH 4ONGH 4P2RD 2VDOL 8FABB 5SV3A 4Z8GA 3L3GB 4LCCA 2IGFH 4Z7OF 3QNZB 5FF6B 5BS0E 4GAFB 1M10B 5BXFB 3QO0B 5D7IB 3FN0L 3VD7A 1U9KA 5GSVB 3WUZA 5KVFL 3HA0A 3CSYB 4PBWD 5HYJD 3ET9F 3LN4A 4IMKA 4N8CH 1ZA3A 3RY5A 4OGAD 3QXVA 4K3GA 1U8OA 3QDMD 2VZ3A 1RD6A 3TO4A 2F9BT 4HV8A 3W9EB 3LS4H 1B4JH 4TPRH 3SE9L 7CGTA 5DQJB 5ACZA 4GKSB 4OCYH 4M7EA 4NQDB 2HFTA 4OUOA 4KMTL 4KK5C 2K1MA 4EIGB 2HJFB 3R8BB 5DI8B 1C16A 3DX7B 3QUXD 3MLVL 3B83A 3CLFH 1F3JB 2YD7A 5ALBH 4GFTB 4XXCA 1ZT7B 1T0MB 1UXSA 3DECA 4PP1D 4G6KH 2YUZA 2DJ4A 5DUPL 3UJIL 3WPGA 1CXLA 1WBZB 5CFHA 5BMFL 4Q62A 3MACH 4OCSL 3ZYJA 3C6LA 5EORL 1U8PB 3ILPA 4PG2A 5F88B 1S7QB 3RNKB 4CADB 4KFZC 1EXUA 3ZT6A 5IHBA 3HNVH 1RFDL 4IOIA 3WN5A 2P8PB 3BT2L 4JY4B 5C0FB 5CS7A 4JFHE 1U3ZA 5FK9A 3S37H 3IU4L 5E8PB 2HJKB 4DN3L 1FIEA 2Y36L 3ZKMD 2I24N 3V0AC 1SM3L 2WIIB 1XGPB 3BHBA 4HUWB 4OSUL 5CMAB 3QIWD 5EO9B 3IAQA 2Z62A 1HHHA 4JZJA 4FQ1L 4ENED 2YD6A 5D1QC 1A4JB 3E3QC 2XZQH 1FZOA 3P9LB 1MCJA 3GJFH 4F7TA 4LARL 1QSEE 5A2IH 5K9OA 1T2XA 3C2AH 5D8JL 2CKBB 3RGHA 5LBSH 1KCUH 2YD4A 3C60B 3Q5YA 5ISZA 5T1DL 4N8VA 3SE8H 3H9SD 2ED8A 1II4E 4OV5B 5C09B 2NNAA 5AUMA 5C0AA 2X4RA 4G9DB 1G6RH 2CR6A 3DV4B 1T7XA 2OZ4H 5DO2C 3SOBH 4XVUD 5ANMA 5LKNA 4RFOL 2X4OA 1L7IL 1W2KT 4WUKL 2KPNA 3NCCB 2AI0H 5DHYA 3LEVL 2CXGA 5I74B 2IADB 4NUGH 3I02A 3MZGB 4K9EL 4Z94G 1QYGH 3P4MA 4LKCB 5D6CA 3WS6C 4X5WA 1QA9B 2XTJB 2RJMA 3NA4A 3O0RH 4UUJA 4Z0BL 1TCMA 3H7BB 5C0NC 3FFCD 2R0WL 3VXQA 2C9AA 1HIML 2NTFA 4H1LB 3ARGA 1AGEB 5KSBA 2IANE 2J2ZA 4F7MA 5CEZE 1VFAB 3HN3A 4DZBA 4NT6A 4NRXA 2ARJQ 2Q87A 4WI2A 4G9FB 5IEHA 3O11A 2HJLB 4EUPB 3F5WB 2F54A 3FO1A 5L2KA 4HJ0C 4KHXH 3MUGA 1UVQA 3RWGB 4QO1A 2DLIA 5FYKH 1N8ZB 2ZJSL 4RBPH 3G08B 3VWJD 3DSFL 1U2HA 4M7KL 1X3DA 3EW3B 3HS0A 4PJCE 3RKPA 3DUSA 5I1LB 2VKXA 1EAPA 1HH9A 3QNXA 5JA9A 4P3DA 4EVNB 2Q7YA 5HDHA 1AJ7L 4JDZA 2IALA 5I1GH 3KPPA 3EOTL 4V1DE 3D85D 1GGYA 5FF6A 4JFED 1FYTD 2FGZA 5D7IA 3C9NB 4L5FH 3KYKH 1KOAA 1K5GC 1QO3A 3QZWA 3OJ2C 2JKXA 5IJCA 3CSYA 4MJIB 2OMXA 2X4UB 5DZOA 1RZJL 4W70A 1MSPA 3G5ZB 4GAJL 3RDTD 2DI9A 5LXGL 4NKOB 1PDKA 5F71A 3WUWG 3L7EB 5DWUH 4PJIF 3S9DB 2I5YL 5DC4B 5DQJA 3VMPA 5FYLD 4ZFOL 1YQ2A 4U3XA 1FGNH 4Q2ZB 4NQDA 4DJMA 4Q9QH 5FHBH 3A0OA 2O5YH 4E5XB 3DX8A 1OAKL 3DLQR 1CR9H 1H5BB 1F8TL 2Z4QB 3G3BA 3FT2B 4ODBD 5GGTL 4PRNB 1IMHC 1UADC 1ZT7A 1EJOL 1T0MA 4MQSB 1WBZA 5IJDA 3PGFL 2NW2A 2BSRB 1UZ6E 5IW1B 1DVFB 1U8PA 5GRJL 3DRTB 5F88A 5EBMB 5C2BH 4CADA 4EN3D 2HLFC 4PRID 5F7FA 3MOQA 2P8PA 4FFZL 4HJGA 4JY4A 5C0FA 3T09A 2BNQE 3CU1A 2HJKA 4WWKB 4LFHG 2NW3A 4C56A 2OSLB 5CJOH 1RIUL 1NFDA 4WHDA 3HTLX 2ITCB 4PLNC 1ZHBA 3RWDB 3TVMC 3VG0L 1NFDF 3P9MB 4LCWB 2WIIA 5KTEL 1G7IA 1RZJC 3NH7L 3MRMB 2DQUH 1SBSL 5FYJH 3MA9H 5EO9A 1F3DJ 4Z7VB 2G9HB 4BJLA 2NY0B 4JPVH 1OSZA 1DTUA 1MCHA 1HSAA 4NZTH 5DTFA 3O9WD 2F53D 3PXJA 5FA4B 3P9LA 3SQOH 1AIFB 1KLUB 5AWNH 4HUVA 4IRJD 3WNLA 1ZTXH 1FFPA 4OZHE 1FG2A 4PUBL 3UZQA 3N9GL 5BO1L 5TDPA 5D93C 4M7LH 3QCUH 3C2AL 4M1CD 5DRNB 4YHNB 5I8OL 4OV5A 4IIQC 3L3IB 4G9DA 3SE8L 1IZKA 3A6BL 3DV4A 4NQEB 5CBEB 1P2CA 1K2DB 4OLEA 3T4AA 2R2HA 2VITB 2IFFL 1BVZA 3ELAT 4DFIA 3BIAX 5SX4H 1J5OL 1XGRB 3PE9A 1DBAH 3QDGB 1YEFL 2VDLH 2OMNA 4LKCA 3G5XA 5DEFB 1MHHA 4NNPH 1DFBL 3PF2A 2DN7A 4XPFL 4HDIB 1QA9A 3RWHA 3ARDB 1MCPH 2PYED 4IMLA 4JRXB 1CIUA 1K9TA 4Y1AB 2CDGB 2WUCH 4N0YL 2HTKC 3RPKA 1HE7A 4OZGE 3RX7A 5E2VH 4MQWX 3P11H 2OTUB 2CUIA 1J1XL 5TF1L 1ZLSL 4AQ1B 3U2SB 4HKJA 1J7VR 3DVNB 3BFOA 4G9FA 3K1DA 4CP6A 5D7LE 4PP2A 3F5WA 3K2UL 5C0CB 4X8JA 2DLFL 3DV6A 5EZLB 4AY0A 1NUGA 1WTLA 3OGLB 4XC3L 3WEXB 3MOBL 3RWGA 1VFMA 3SY0A 5FDWA 4MXWL 1T22B 1Q0YL 1HHGB 1N8ZA 4L4VE 3TBTB 5HPMB 1ZS8B 3G5VB 2KBGA 3PP4H 1S8DB 4KVCL 3RI5K 5F7KC 3MRNA 2XRAH 4YHZH 1V8HA 2DLHA 3U4AA 3D39E 4AIZB 4ZUTB 4M1DH 5ID0B 3PWLB 2H9GB 2E7LA 4ZFGL 2GJZA 4ERSH 2C4FU 5F7EL 5IBLC 2ZWLT 3U9PH 4NFCA 2XOTA 1QLRB 3RL1A 1ZA6B 4BSWB 5I66B 4LIQH 1EFXA 1XGQA 4JEGB 5BRZD 5IT2L 4KTDL 2DTML 2NCMA 4DKFL 1MFNA 2AV7B 3BWUC 2FZ3B 3QEHA 1P7QB 4JKPH 3FQXB 4JFPB 2XA3A 4EJ1C 1YUHA 2NY4B 2XPGB 4MB4A 3ARBD 1KCLA 3GO1L 4M5YL 1DQDH 1WT5C 4JFFE 4Q2ZA 4XPGL 1AQKH 4E5XA 4NJ9H 1ORSB 1KT2B 2Z4QA 4QT5B 3FT2A 3ZL4L 1BM3L 5T3XH 4XVSH 3BMWA 1YYLL 4PRNA 1YEJH 1Z0NA 1CK0H 5E9DB 4ODHH 4PJ8A 5DK2B 1I3VA 2BSRA 1JYWA 1I4FB 2B4CH 1DVFA 1WFNA 4KI5E 5DYOA 5E4EC 3NA9H 4CJ0A 5EBMA 2VN7A 5JXED 3EUUA 1GPOL 1J0HA 4QRPB 2WBJD 5EOTB 3ULSB 3O2WL 4KUZL 5ADOL 3KYMB 4HKZA 4U3CA 3GI9L 4AZ8A 3A6CH 3F7VB 4YZFF 4NN7C 1O6SA 1NAMB 1RZKL 1LO2L 4KK9D 1IGCH 1AP2B 3MRMA 5D7KE 2QQLH 5CAYB 4LHUD 5ETUB 4DOHE 4FQCL 4JO2H 4G3YL 4TSBH 5FA4A 1KLUA 5LGHL 1AGCA 1JK8B 2VQ1B 5BV7H 1KELH 4LPXA 3NCBB 3WNNA 1BECA 4E41D 3RX8A 5ECJE 4ZUWA 3A67H 2AW2A 1IAMA 3P0VL 3MUJA 1A0QH 4YHNA 3QUZA 1BJ1H 4NQEA 1J8HE 3R0NA 4XWOC 5CINH 4PPTA 1K2DA 1ZLUK 4B5EA 4OT1L 3VMOA 3PWJB 4OGXH 5C6TH 4HW6A 1AQDB 5DC0A 2VDNH 4BK5A 4MS8D 2A73A 4XI5C 5GS2H 1YZZA 2EE3A 2YPVH 1OTUD 1XGRA 4RNRA 3QDGA 1ZLWK 5C0BE 1RUQH 5T3ZH 2YPKB 1JPTH 2DKSA 3HRPA 2OX5A 4WY7L 4BQ6A 2EECA 3BDYL 4HDIA 3CVHL 4CU8A 1RZKC 2EE2A 3T0WA 4TUOA 1ZANL 4V1DD 4PY8I 1EEQA 1KB9K 1VHPA 5CKAA 4LU5L 3EO9L 1CLZH 4NQCE 1U8KB 4K8RH 3D5OF 4X4XB 4W4NA 1MH5A 4QYOB 5I9QB 2AJXH 3C5SB 2A9MH 1JTOA 5IGXH 5LFNA 3S35L 5C0CA 4NKDB 2UY7A 4I5BA 4M1GL 4R09A 1W0VB 4QOKA 4H20H 1OTMA 1HHGA 1Q38A 4JFDE 1L4IA 5IW6B 4P9MH 4UINL 4XTRC 4XCCL 3G5VA 5EOCJ 5F89B 4U6VH 5DD0L 4RGMC 4IOFC 4WHCA 5EPMB 4R6AA 3KPRA 1U8LB 3SCMC 4B41A 4DQOL 5F9JA 4AIOA 5CILH 4AIZA 3B9KC 3KPNB 3PWLA 3QB7C 4GJTB 4B7LA 1C5CH 5D1QB 4F15C 2OL3B 4AIXA 2R2BA 2B2XH 3NCEB 4GAGL 4X4YB 1PY4A 4MXVE 2CSPA 4BSWA 5I66A 3QG7H 1ZEAL 4Q6YA 4XVTL 1P1ZB 1X7QA 1VGEH 3UTSE 4NSKA 4RQQB 4HS3B 1D9KC 2AV7A 3DROB 5JPMB 3IDIB 1DBBH 1F4YL 2BNQD 1QFHA 1Z9SA 1P7QA 4Q6IC 3FQXA 1RMFH 4Z8FH 2FBOJ 2NY1C 4GSDL 4QHLB 4KAQL 2DQFB 2FEEI 3GIVA 2ZSWA 4EZMA 3BZEB 2FBJL 4TVSa 1AE6L 1U58A 1ORSA 1KT2A 1MQKL 3HC4H 4R9HA 2OM5A 5T3XL 1JZ4A 4XVSL 3EJYD 2OP4L 4HWBA 4BZ2L 4S1QL 4RX4A 3F8UB 5E9DA 5DK2A 4ZSOB 1KXVC 1MELA 4ISVB 5EZJB 1I4FA 2DYPB 5KVMC 4QHUA 1JPGA 3NIDF 3QWOA 4K3EL 4OLWL 2PR4H 1V7ML 4NO0D 1OAZL 5JDJA 4OCWH 4CVXB 1JN6B 4TVPL 4JKLA 4WHTB 1RK1B 2FHCA 1BOGA 3FRUB 1XCQB 4P3CL 3DUUB 4LQ1A 3F7VA 4V2EA 4PBXA 2D2OA 1T1YB 1F4HA 1NAMA 2XY1A 3WL9A 5K33A 6CGTA 3OPZH 4YBQD 4OF7A 1MI5B 3P4OB 3SGJA 2FH6A 1H3WM 5KW9L 3FO9B 3B4NA 4KWUA 4UI2A 4OCLC 2P5ED 4QRTB 3ARZA 1R3LB 5EZOH 2B1AL 5ALCL 2P5WE 1ZVHA 3W39B 3JVGC 4M6AA 4G6JH 4Q0XL 1NGPL 4MX7A 4TSBL 2VQ1A 1R5WB 1P69B 1OZNA 4BQBA 1ZLVH 2H45A 3GBNL 4Y16D 3ULUH 4LLUB 2X09A 4JJHA 1QFWM 4NZJA 2KZWA 4P2YA 3BJLA 5LGKA 3GI8L 4HFUH 3F12B 4YDKH 1PYWB 2GAZB 2ARJB 4HIEB 5B0TA 3VFNB 1J1PH 4I2XA 2YD3A 4WNQB 1REIA 4J6RH 4U1MB 4ODTL 5FGSA 1KB5L 3BKML 4L4VD 3VXUB 3MV8B 3QA3B 2K3TA 4J3TA 1N5AB 1CGVA 4POZD 5T3ZL 4ONHB 4DVRH 2C26A 1GC1L 4JDTH 5AYUL 3QJHA 3X3FH 3BAEL 5IMMB 4C83A 1Q9LB 3L7FB 4DGIH 3WFBL 3SDDC 5L6YL 5IM7B 3DXAE 3KWWB 3ESVF 3MJ9A 1H3PL 2YUXA 4KRPD 4QYOA 4ZAKC 2MSPA 1O7SA 1LILA 3U7YL 2WUBL 3P40A 4JN1H 1OD7A 4NKDA 4JO4L 5C09E 1OGAA 1HXYB 1EO8L 4JVUA 2WQVA 2AV1B 2IPKA 4M5ZH 4QXGL 5GGVL 3QAZC 4WO4C 5HYIA 4E0RB 4ELKB 5IW6A 4GQ9L 4YDVB 2PXYD 2DQIL 2NX5D 3TVMB 2EDOA 4Y4KD 5AZ2L 4P5TC 12E8L 4GRMA 5EPMA 3V0VB 1AXTL 4YQXL 3WBDA 1CL7H 4PIRF 5TGBB 3L3DB 3KPNA 3VH8A 4LEXH 5T1KB 4RWTC 2OL3A 2YOCA 3R4DA 3UJJH 1RJCA 3NAAL 1NCNA 5AZ5A 2IG2L 4B53A 4ZFOB 3EYVA 5JW5A 5D9SB 2VZOA 1IFHL 1GC1C 1P1ZA 3HZVA 4JO1L 4FS0A 2VR9A 1RURL 2R2CA 4CN1A 2H26B 5D93B 4G9FE 4MLIA 2PW1A 5INCB 4FABH 5TDOB 3O6FC 3TBWB 3NCYP 3RFSA 2DQFA 4U7KA 4DGYH 5DSCA 3BZEA 1K8IB 1T2QL 1KPVA 3EJZC 5D7KD 5HVFB 1OAXH 4TQEH 3K8LA 5C0IA 3AM8C 1TJHL 1A3QA 4LSRL 4M3KB 3S36X 1OM3H 1FYHB 4Q9RL 5GS1C 2OMYA 4X6BB 2MPAH 4N90D 4WI6A 3WS6A 2P1MB 3IF1A 3D9AL 4C4KT 4P59H 1FP5A 4ZSOA 3BW9A 2AEWA 2Z35A 5GQRK 1RZ8B 3KLSA 1X5LA 1GZQB 4HPYL 4R8WL 1NEUA 1KPUB 3VCLB 4BSVB 3C6LD 3QIUA 3EZJB 3EGSB 4S10A 5L0QC 4CVXA 3AMKA 1JN6A 3ZDZF 2RCSH 1FRGH 3MRKB 4ETQB 4OJFL 3FRUA 1XCQA 1D5IH 1PLGH 4MJIE 3GSOA 3RPIA 2DDQH 2P8LA 4R7DB 1T1YA 3BD3A 2Z66A 3GJFB 5KANG 1IKFH 4X80L 1MHPH 1FVCB 1MI5A 3B2VH 3P4OA 2XICA 1JPSH 3OPZL 5E00B 4LCYA 5C0BD 1KCVH 1I3UA 3PDGA 5K9KB 1FNEA 4QRTA 1R3LA 1ADQH 4PRDA 4V2CB 3JV5A 4GW5B 3W39A 3FT3B 4DKAA 5A1AA 5HHPB 3UPRB 1QUNA 1P4IL 4NO2B 5GGQH 1R5WA 3CIQA 1NGZB 1MAJA 3GHBH 1DSFL 4MA3A 1LK2B 3HZYB 4CBPA 4FHOA 2CO7B 1WF5A 4O58L 4JR9L 3HE6C 4YXKH 4Z61C 2AEIT 4JE4B 1QSZA 5ISZD 3PWVA 1FHGA 4JRWA 5HDLA 3X14B 3BP5B 4XNQB 3F12A 4WFFE 5FA3A 5C0AD 1PYWA 4C2AB 2E9WA 4KJQC 4HIEA 3VFNA 1NUDA 3NGBC 4Z78A 2F58H 4WNQA 1DL7H 3REWA 1PVHA 2E6PA 4U1MA 4UIMB 3IDUA 1U3HC 5EWIL 4YHLL 1KACB 4GRLC 2E9JA 4O5LH 3UYPA 5HYEA 2FSEB 5JORB 3QA3A 5C0DB 5IMKB 4LCWE 1JE6A 5ELIA 1WCBB 2C3GA 3OKLB 3DPBA 4Z5RB 4Z7VE 4N0CC 4P4KA 2V7HB 3H9HB 1FO1A 5T1LA 3ZTNH 4Y88A 2VZ1A 3CIGA 15C8H 4DGVL 2YPLE 1DBML 1OL0A 4WCYH 3ARGD 5CCKH 3KWWA 4TSAH 3MCLH 5J6GB 4YDJA 1QNZL 4ZNEA 5E4EB 1JNNH 4QWWC 5JHDB 4LASL 2HT3D 3ULVF 2F5BH 4LGSB 1GOFA 1CDUA 4OLYL 2F54D 1NANI 5L2KD 2AV1A 1RUAH 3BH9A 2BVPA 3PXHA 4KHTH 3W9DB 5JW3H 3V52H 2VDQH 1EV2E 4OB5L 4YDVA 2HFFB 1XH3B 3TVMA 1BQUA 1UKTA 2NZ9C 3V0VA 4GXVL 4HX1A 4ZPTA 1URLA 3DYMA 5TGBA 3L3DA 3KXFE 5A5CA 3BPCA 2VAAB 1A8JH 3PABB 5T1KA 1AHWA 4XXDB 3OJMB 4JRXE 5IJVB 2ZKHL 2JELL 4Y1AE 1HNGA 3LN9A 4KJPC 4RGNC 3RIAF 1NGQL 2N7AA 2JB6B 1BBDH 3OKNB 4X9BA 2GITA 5FUCE 2WWMC 5CJ5A 3SE3C 5GGTA 3P2TA 4YIQA 3BEWB 5IB4B 4OLZL 5TDOA 4LGRB 1GZPA 3TBWA 3O3BB 1ETZB 5HGHB 3MRPB 2EDDA 3BKCH 3QI9A 1MCFA 1XAUA 1G7LB 3FQRB 5L8JB 2X7LB 5DJZB 4G8FA 4P9HH 1QKZL 4OZFB 3NFPB 4X83A 1AXSB 2BJML 3R06A 4KNGA 5GRZA 4GRWH 4NQDD 3T0EE 5C07B 1D5ZA 4XPBL 5DJ2B 4OIIH 3RNQB 1DJSA 1EBPA 3QWRD 4L9LC 1ONQB 1OAYL 1YNKL 5D2LE 2HH0H 4HIXH 1JMXA 3QH3B 5EU6A 1GZQA 3SHSA 3OGCA 5KS9A 1KPUA 3VCLA 1A2YA 4YE4H 3MLXL 3RVVC 4CN6A 2XXCB 4R90L 3EGSA 1X6NA 2DL2A 5KS9F 1G1CA 3KPOA 4ETQA 1NL0L 1ZHKB 4NKMB 4R7DA 1LQSR 2AJYH 2Y7QB 3GJFA 2C7UA 1KJVA 1R5IB 1J11A 3RJDA 1SVCP 3QQ3B 5B39B 2A0ZA 1I8MB 1MPAL 3VFGL 5E00A 3AFLA 5K9KA 5C3LD 2X4PA 3X12B 1J05B 1BJMA 1CFVH 1QRNB 5FTTB 1G6RA 1NGXB 5CD5D 1OOAA 4LLVA 4RGMB 2PW2A 1NFIB 4GW5A 3FT3A 4PJEE 2BC4B 3SCMB 3T3MF 3UPRA 4Z76B 4NO2A 5HJ3B 3KPLA 1PG7L 5HHVL 4PB9L 3QUML 4L4JA 5FO8B 1C5DB 4F15B 1LK2A 4X4ME 3NPSC 4WEMB 5DMIH 3C60D 4HFWB 3CVHB 3OXSA 4HQQL 2FWOA 3UTOA 2IPTH 1S7VB 2EIEA 2ZPKH 3H8NA 4QRPE 1CD1B 5HHME 2XKNA 5JPNB 5I1CL 1D9KB 4XP4L 1MRCL 4K7FA 4YFDB 1P4BH 4YXHL 4UIMA 1IGJB 3NZ8A 1CXEA 1GOHA 1OT2A 4Q6IB 2QJDA 1IEHA 2FSEA 4Z64C 1IGIL 2NY1B 4QNPE 3D69B 5C0DA 4HXAL 3IRPX 5ENWB 5EUKA 3DVGA 1A1NB 3TYGL 3OKLA 5IB5B 5TQ0H 4CDHA 4J7RA 4Z5RA 2Y5TA 4X99B 2V7HA 3H9HA 1JGEB 43CAB 2XTJD 3T08A 3WFDH 1KXTB 1YMHA 3LV3B 5F1KC 4M8VA 2XNAB 1UWXH 4KTEL 3ZTNL 3C6NB 1GAFL 4LLQB 3EDKA 1JGDA 4EQ3A 1TTFA 3OKOB 4CMHC 5D7SL 2Z91B 2DQJL 3H3KA 2CLRB 4DAGH 1A7OH 5IV2B 3EO0B 3QHFL 3AU1A 2OLDA 2OJEA 4G9FD 3KS0H 4BH7B 3JXAA 1F6LL 5F44A 3CXHK 5E2UH 5CGYC 4WU7A 4R0AA 5EN2B 4I4WA 2GK2A 4IRSC 2ZUTA 3W9DA 3MX0A 5IFJA 1HDMA 3C5JA 2H8PB 3K46A 4MXQC 4RRPA 5GZOC 3EDFA 3EFDH 4AEHH 4UTBL 4DZ8B 2YK1L 3FRPA 1G7QA 4ZO8A 4P2QE 1X9QA 2VAAA 1WITA 5DDHA 5E7FA 3OGKB 1QHOA 1TZHB 5IJVA 3MLPA 1IZJA 2W0KA 3W2DH 5FKAA 1A64A 4HIJB 3G9VA 3VI3F 1QLFA 1MCDA 2DQDH 3OAUL 5DUMH 1H3TA 2FEDC 2E6QA 2AXGB 1S7SB 2V2TB 5DQDL 4ODSL 1EFXD 1JI2A 5HVWA 3HE7C 1N3NB 5FO9A 1JF1A 1VB9A 2HG5A 4NKIL 1ES0B 1HINL 3GHEL 1EAJA 3DRQB 4Y19A 1ETZA 5E8EB 5HGHA 2ADFL 1G7LA 4TZHA 2X7LA 1BD2B 2HWZL 5DJZA 3NFPA 3LKPB 4I18C 3QFJB 3QQ4B 1JWMB 1A7NH 4R4ND 5DJ2A 2AERT 2FLRT 4FN0A 3LEXB 4MVBC 3FCTB 2BFVH 1A7BA 1UYWH 4K7PH 1TQCC 4M6NH 4JB9L 3CSPA 5J0BA 3UYOD 4LOUC 5E5MB 3MLRH 5IVXE 3I6GA 1KTDB 3GRWH 4Y2DC 3SDDB 1DVFD 1QBLL 4G8EA 2UVEA 5F7DB 1MWAL 5MEPA 4U6XA 4WFFD 5BQ7B 4ZAKB 3WXWH 1O5DT 4Z77B 2OS7A 4L8BB 2OQJB 2ADIB 4NKMA 4OZ4A 4N8VG 2Y7QA 3INUH 1F4WH 1R5IA 1K4CA 2EXYD 4WWKD 5CP3H 3QQ3A 5B39A 4TUKH 4HWEL 1E6JL 3IGAB 3M18A 4HMDA 1ZVYA 1WC7B 5EA0H 4WO4B 4RAVB 4LCWD 4PJDB 2OMWA 3H6JA 5E2WH 1J05A 4A6YL 1WIOA 1QRNA 3AB0C 4OD3H 4R2GC 3ZSTA 4ECNA 4P5TB 1T7ZA 1NFIA 2NY0D 2H1PL 1D7FA 4HIHA 4MDJA 2BC4A 3SCMA 4Z76A 4HT1L 5HJ3A 3QDAA 1KB5B 3LIZL 4U05A 1R5VB 1FNGA 1HH6B 1OTTD 4U1LB 1HCFX 2UZIL 3EO1B 2W9DL 3NIFF 4JRYE 1PY9A 4HUUA 3QUZD 5IBUG 4PGBA 2CA6A 1RHHA 1S7VA 4NQED 2VLLA 3WFEL 2ZOKB 1D9KA 1MCIA 1KN4L 3W82A 3ULVL 3DGGB 1JVKA 1E4WH 1KIUA 5HYFA 3O6FB 5CP7B 3GSQB 5KAQF 2NY2C 4DFHA 1AKJB 5ENWA 4NJAL 3QDGD 4MB3A 4DTGH 5I30L 1A1NA 1FO0H 4PYGA 5IB5A 4V2BA 4XCFL 5EO1A 4X99A 3VA6A 4J0MA 1JGEA 5DHXB 43CAA 1MCRA 3BYTA 4Z7QE 3NCFB 3Q6GH 3LV3A 4JAMB 1I9IH 4DCQA 4YDIH 5GS1B 3WFDL 4LLQA 1RUPH 4PJGB 2ZOLB 2QHLA 3CMOL 2DQTH 4R7NB 3LB6C 3QUYC 3MCKB 3U36A 3OXRB 4PJAF 1T6WA 4OFYA 2VC2H 3LPWA 2EXWD 4YX2H 1FZJB 5IBTH 3EO0A 3GMQB 5EBLB 4O51B 4NRYB 2E8YA 4Y61B 1N4XL 3AAZB 4BH7A 3H3BC 3WSQL 3ZDYF 5L0QB 1LE5B 4KY1H 5C0CD 3QZWG 5EN2A 2C4FT 3FOMA 3LOWA 5E2UL 4LI1A 2XA8H 3LPFA 3HI6H 3RL2A 3FO0L 3WS3B 1U8IA 2CD0A 2H8PA 3VFUA 2EDTA 2OJZL 4HF5H 5C0GA 1NLBH 4NOBA 5E6IA 5EU5A 3VXUE 1FORL 2IQ9H 3MV8E 2YSSA 1IQWH 4FNLL 4JHAH 4M4PA 1DEEA 4JFYB 1TZHA 1MCWM 3MJ7A 3SDYL 3KYAA 1FL6B 4NNXB 1JFQH 3JVGA 3V6ZB 4HIJA 3ZKND 5KZCB 3GK8H 3PUCA 1BVKB 2AXGA 3MV7E 1OP9A 2JK5A 4LVHC 3QXTA 3B2UD 4KROD 1N3NA 5TDNB 1XF2A 3K81A 3O8XC 3HE6B 3EBAA 1INDH 1M1SA 4AM0B 2ITDB 3DRQA 4HS8H 4MQ7B 4EDXB 3MSPA 1P7QD 2ICWB 1FBIH 1BIIB 1YN6A 1BD2A 3NGBB 1AD9A 3FQNB 1S5IH 4PV9A 1PBYA 1IM9A 1U3HB 4I1NB 4WVRA 4GRLB 4MNGB 1CD9B 3QQ4A 3DMMC 4I3SH 1JWMA 5GHWH 3IDGB 5I18L 3WXVH 5I16B 4H0HB 35C8L 3EDDA 4EXPX 2GQHA 3T2NH 2JB5H 3TF7C 1BQLL 4PY7A 5E5MA 4RX4D 5E9DD 3CFBA 4JPWL 3LZFH 1KTDA 2E6JA 5GRUH 1A14H 4IS6A 5IMOB 4FXKA 3U0PA 1KSRA 5E08H 1KBGL 2GK0A 5F7DA 1UCBL 2YD9A 5BQ7A 1A6UH 4ZAKA 3TIEA 3DHJA 3ALXA 4Z77A 1TJGH 4UDTB 4L8BA 1QD0A 2ADIA 2AXHA 4EI6A 4P46C 2XV6B 4OBRA 4ZO7A 2ZG2A 3D2UB 1P4LB 3INUL 3RGZA 1IBGL 1RQ5A 4JREC 4Y4HC 3VFMB 1JL5A 4FQLL 3KJ6H 5HGAB 1FLTX 3VG9C 1MFDH 1E4XL 2W9LA 1PD6A 2YD8A 3W3MA 1WBXA 5FUZH 4O4YL 1MIEH 3JWOL 5I17A 4P5TA 2B1HL 3D3VA 3G6JF 4F7EA 1LE9B 5JMRA 4BH8B 2Y06H 3ZE0F 1RZFL 2L7JA 4Z9KB 3QPQC 1IGYB 1HH6A 2R9HD 4FQIL 1S9XB 4DVBB 1MAMH 4RMWA 5ITFB 1MFEL 4LGPB 3T8XA 5DLMH 3BESR 3GGWB 4RGNB 2VXVL 3RUGB 3FMGH 1IC7L 2P4AB 3KDMB 1RZGB 2V6HA 4JKKA 1A7RL 3G5YA 3BPNC 3UTPD 4OM0H 1NJ9B 3U4EA 3AC0A 4QF1B 5CP7A 2UZYB 4RISL 5GISL 2CDEB 1QSFE 4Y5XC 1KUMA 5DA4A 1GIGL 3QEQB 1C12A 3MRGA 3ESUF 3U46A 5KJRH 5BOPA 3IJSA 1X6LA 4PJXB 4WUUB 4YJZL 4RGOH 5FM5O 3MNVB 5DD1L 1U95A 5D71L 4O2CB 4PS4H 3VXSB 3GSUB 3ARFA 1AGBB 3BUYB 5GS1A 3L5JA 4G7YH 4PJGA 5M94B 1T20B 2ZOLA 4L9LB 1Z9LA 1YC7A 1RUPL 1OOKG 2FX8H 3JWOC 4MSWB 5IVZA 1CLOL 2LU3A 1FV1A 3V0WL 1FZJA 3KVQA 4P57A 5D5MF 3O4LB 5EBLA 1T21B 3QCVH 3I6LE 4I77H 1XF5B 5IBTL 3GMPB 2LU7A 3N85L 1T5XB 1LE5A 5E70A 5ADPH 4KZEL 5JW4M 1MCQA 4TNWF 4QXUH 3CH8A 4HWNA 4LRNL 1ACZA 4I6JB 3FB8B 1E6OH 3NIGE 3TIDA 4JFZH 1KTKE 4G6MH 2NY7L 1M0ZA 3VXNA 4ZTPH 1OF2B 4UT7L 2W9EH 2QHRH 1WEJL 1HHKB 4ODUB 4YGVB 4F7PA 1QFUL 5SV4A 3BZ4B 4RZCB 4XCNB 1U8JB 3AUVA 2WINB 4NNXA 1DLFH 3BE1L 4NO3B 4CU6A 1Q94A 1BVKA 4ORGB 3VRJA 4HKXB 1A5FH 1ITBB 2VZVA 2DI8A 5DFTA 5CEZH 3NPSB 4JJ5B 3GKWH 3HE6A 4HZLB 4XC1H 3P0GB 3MNWA 1CDCA 2J88L 2ITDA 4AM0A 1A4KA 5JHDE 4EDXA 5DK3A 4Q9CA 2AP2A 4RA3A 1KCRH 2ICWA 2RB8A 5DO2D 4U33A 2AEQL 4PJHF 3IFPA 3JSSA 2D4FA 4TSCH 1Q1JH 4G8GA 3GZKA 2YHGA 2DRUA 1J18A 4MNGA 4JFQA 2BX5A 2FO1A 4Z79A 1FLRH 1S3KH 4UQ3B 5C8JB 2OXGA 1HZHH 1JI1A 1FL5B 4JHWL 4I3SL 5KVGH 3ARSA 5GPRA 3KPMA 3SKNA 1WWWX 3H0TB 1Q9OA 4QHKI 4D9RD 3EYSL 3EYUH 3DHMA 3MNZA 2XZAL 2DYPD 2ZP0T 4ZUSA 5IMOA 1CXFA 4ELMA 3PWPA 1CLYH 1PKOA 5B3NA 2YC1B 4CMHB 5GQBA 4ELMF 4AK1A 3D87B 4ZOAA 3PV6A 1LD9B 3GJEB 3JBG7 5JW4R 1A6TB 1EBAA 3IDXH 2UZXB 3MREA 4FZ8L 3H7LA 3X17A 3QUMB 1P4LA 3QXWA 1RAMA 1MREH 1U36A 4HJ0D 3QFDB 4BKLB 5HGAA 5AD0B 4IRSB 4OM1L 1MI5D 3ULUA 1A3LL 4BUHA 3MV11 2BY1A 1T66C 1I3GH 3ULUF 4JY6B 3WIIL 3M17B 2UYLB 1LE9A 5C07E 3PQYA 5D6DC 1P6AB 4CW1B 4BH8A 3DETD 1OTOA 4XBPB 5BW7A 5EUOB 1H15B 3QQNA 5HDBF 4HXBL 3HG1B 5KG9A 1VKXB 3Q3GB 4LRIA 3UO1L 5ITFA 1LEIA 3MLWH 3GGWA 5DRWB 3OKKB 3RUGA 1MFBH 1KPRB 1FDLH 1NCUA 4PJBF 1I1AA 5DEGB 3HE7B 3HPJB 5I0DA 3CFEA 3B6SB 2FL5B 4U6HA 2RA8A 4KQ4H 2YRLA 4NZDA 1QVOA 1BWWA 1QFWL 1JGUH 2Y9RT 2UZYA 2Y5EA 5FOBB 3VXUD 2QQNL 2EDNA 3O6KH 5B38B 1UQSB 3CVIH 3MV8D 2A6DB 4PJXA 2Z64A 3T3PE 3QUKB 3MNVA 4RWYH 1BF2A 2ADJB 2HN7B 5E94B 4U49A 2Q20A 1QRNE 1HYRC 4I18B 3RU8L 3VXSA 1NCBH 4OLXH 1XF4A 5T1LD 4XPAH 3RGXA 2AQ1A 1T20A 4JO3H 1Q72L 1TQCB 3CH1B 1SYSA 4MSWA 4HSQA 4HJJH 4UV4L 2XI9A 3T0DA 3OX8B 3S7GA 4JPKH 3RWCB 4Y2DB 4GH7B 3O4LA 3S3PA 1IEBB 3AROA 3GMPA 1T5XA 2ZCLL 1DR9A 3TESA 1I7TB 5MI0C 2HLFD 3MLYH 4Z7WA 2CUHA 4NWTL 3BMVA 2Z7XB 5KVEH 4Z7WF 2IH1B 3IJYA 1LEGB 5CBAA 2XN9A 3TVMD 1ZSDB 3FQWB 2W0FB 3U0WL 2BNUB 4Z7UA 1HHKA 4OAWA 4OKDA 2BY2A 1AGDB 3AB0B 5I19L 4R2GB 4Z7UF 2J4WH 2ICWI 4X7SL 5T1KD 4NO3A 1UZ8B 3HLAA 4ORGA 1MEXL 3UTZA 3GSXB 3PL6A 1GGCL 1VFUA 4S1SH 5J4MA 5E2TL 4NOFA 4GRWB 4JJ5A 3TT3H 4OCRL 3W11C 3S35X 1VGKB 4PJIE 5GGUA 5CMPA 3HNTL 4HZLA 4EIZC 1X5HA 4LLYB 3REZA 5E8DL 5HGBB 3OL2A 2GY7B 4LQFL 1TQBC 5JLZB 4OKVB 4YR6B 5I1KH 2WQRA 3ARVA 4N9OB 4UQ3A 5C8JA 2CPCA 4KZDH 2DQEL 2Y23A 2NY2B 2V70A 7FABL 1Q9WB 4EDWH 3VXTB 4PEQB 1MAKA 1OY3B 1DUYB 5C92A 2SEBB 1M7IB 4NM8L 1KFAH 4Y8DC 1EMTL 5HBBA 1N0XL 1M7DA 5EOQL 1CGSH 1PKQB 5EU6D 3KLDA 3LKSA 5F9AC 3ROOA 1JNHB 4NC1E 3OG4B 1KG0B 4CMMA 2HTKD 4LSPL 3D0LB 2R2EA 5FO7A 3MLSL 2BVOA 3QUYB 1ADQA 4CILA 3GJEA 5ILTH 1A6TA 4GBXC 5E6ZA 3I3EA 2GJ6B 1JZ6A 5H35B 4ZS6D 3ZE2E 5JNYA 3VDBA 1FSKC 4K7PY 3QFDA 4BKLA 4IRSA 3RY6C 1MREL 4W6WB 4IM8A 4XP1L 1MNUH 3NVQA 1IC4H 1ACYH 1TXKA 1UB6B 1V7NL 4OCXH 4JY6A 9CGTA 2G75B 4TVPE 2UYLA 1WAAA 3QFJE 2CLVB 1FPTH 1CXKA 3O2DH 1IILE 2HFGH 4K3JL 1CQYA 4FQJL 5E4IA 1SMAA 4OZIB 3HAEB 4JZOA 4J3VA 3LRHA 3MFFB 4XMLL 4UV7L 5EUOA 4GW1B 1H15A 2CRIA 1GHFL 3BQUA 1LP9B 1DQQB 5IBLD 1H6UA 1NMAL 3UJTH 5DRWA 2A2QT 3SB4A 3I6LD 2V17L 1KPRA 4XP6L 4JFXB 4LVHB 3IVKA 5DEGA 5IOPA 3HE7A 5ICXB 4K23L 1M4KA 3B6SA 1R3HB 3WNKA 3BH8B 3O8XB 5J1SC 3GUTA 3NZHL 4K55A 5ID1B 5DJCB 2NYYD 4H5SA 3IU3B 4CN4A 2BCKA 4YHPB 3WKNA 2JJWA 2BK8A 1UQSA 1A6VH 2V7NB 1KEML 5GZNC 2E27L 3QUKA 4PJDE 1YEKL 4GKOA 1NLDH 2VLJB 2HN7A 3IETB 3VXMB 1DQLH 3DMMB 3CZJA 2XTLA 3RA7L 3N1FC 1U8NB 1C7TA 4M7JL 4XVJL 5JHLL 3CH1A 4NCC1 1FIGL 3VH8G 1BFOB 5CGMA 3OX8A 4Y2DA 1GGIH 3Q6FB 2QL1A 5C7XL 5DJXA 1G7HB 1I7TA 3ABZA 3PDDA 5JHDD 1LNUB 2M26A 2VXQH 3EYOB 3S34H 3I50L 3QRFM 1AGFB 4P46B 1EHXA 3NABL 1NBYB 3BSZL 4JREB 4Y4HB 2O6RA 3QEGH 4JFOA 3FQWA 2BRRH 3HMWH 4MHHI 3VG9B 4RAHA 3BRDA 5CZXD 1TNNA 2BNUA 3RVXC 4R5CA 4O9HL 3GB7B 5IB1B 1AGDA 4ZS7H 5KVDL 4U06A 2EH8H 1RIVH 2W65B 4KU1A 2ESVB 5D1ZC 1BQSA 2HP4A 4FFWC 1EO7A 1F3DH 2KL6A 4W4OA 1NMBH 1UZ8A 4M9OA 5IQ9B 4PJGE 1XGYL 3GSXA 3FOLB 3WIHL 3TT1H 3BDBA 2APXA 4TOYL 1KEGL 5H94A 5F1IB 3LKQB 1VGKA 1WIUA 1WSST 5J7CC 1ORQA 3IFOA 1T7WA 3FN3A 4GRWF 4LLYA 5H37H 4PERA 4HUMB 4ARRA 4PJ9C 5GMGA 4D0BB 4B0MM 3HI5H 4YHOH 5DVKA 4Y19D 4UT6H 3NACL 1MRFL 4XCYA 2DD8H 3BPNB 4YR6A 5JQ6L 1YMME 1OCWH 2BDNH 5I1KL 1DCLA 4XI5D 1QPXA 3TO2B 2C3HA 5I1DB 4Y5XB 2ASSB 1Q9WA 5H2BB 2OR9L 1KJ2H 2D7TH 5D70H 1DUYA 1WISA 2SEBA 4EDWL 1M7IA 1WWCA 2HKHH 3GSRB 1I8LC 2X1PA 3THML 2CMRL 5CD3B 5IJKC 2MWCA 1MHCB 3PV7A 4N1HB 3HMXL 2FLBT 4X9IA 1U0ND 4JANB 3FB7B 4LLMB 1HCVA 1RUKH 3CUPA 3WPFA 3KG5A 2BVUA 3BUTA 4M7LT 3G3AA 1F4XH 2BNRB 4WW2F 1IGMH 1D6EA 1EHLL 2QV2A 2N7BA 1FE8H 1AI1H 3HUJB 2YKLH 1S7TB 1UB6A 4HUNB 4Q9BA 3STLB 1HKFA 1HI6B 1QRND 4XTRD 2CLVA 5I2IB 3RIZA 4IOFD 3MV01 5IFAL 3SCMD 3VRIB 4OTXH 2J8OA 3C6PB 4PGCA 3QDMA 4GW1A 3CLEH 3S8WA 1DQQA 4X7TB 5L9DL 4YNYB 4Z0XA 1MF2L 3CK0L 1FO0B 1CT8B 2KQMA 3MXWH 4ODWB 3K0WA 4JFXA 1U2CA 1AFVL 3TJHC 43C9B 1PZUB 4XT1C 1FNAA 3BH8A 4YWGL 3PP3H 1QBML 4XPHL 3OAZH 1W72H 5DJCA 5ID1A 1D9KD 2VSCA 1PW3A 2MQ3A 3MGOB 2A9NH 1XCDA 1T1WB 2XYCA 1JWSB 1QOKA 2V7NA 2NY1D 2Q3AA 3V6FB 4V2DA 5DVNA 4P4RA 1YJDL 2BVTA 1K6QH 2VLJA 3IETA 3VXMA 3F7QA 4IDJL 4XX1G 1I1CA 2ZCKH 4FTVB 1MFCH 4W81A 4RAUB 4LPVA 5B22A 3LH2H 1WV7T 3LEYL 4WDIA 2FHFA 1IRAY 3EYQC 4WW1A 1CFBA 1E28B 3TN0C 1U3YA 2A74B 4HH9A 2JE0A 1BEYL 3GMOB 1PQZA 5DD6B 5GJSL 4D0CA 3Q6FA 4UTAH 1FZMB 1G0XA 4OFYD 4OGYL 3EJJX 5AYQA 2XWTC 3C6OB 4RGNE 1G7HA 3V8OA 3HKFA 4QRRE 1LNUA 4JG1L 1ZGLM 3EYOA 4Y0GA 3OB0K 3D1MC 4P46A 1C08B 1UACH 1LDSA 4KI5C 5TQ2L 3VI4E 1B2WL 1NBYA 1UH4A 4TNVK 5K9JL 2CKNA 5E6ID 1JGLL 2VISB 3QEQE 5C0JB 1BF8A 3FONB 3IDNB 3WHXB 1YRGA 4FG6D 3GB7A 4WUUE 2K7PA 2W65A 4PLKC 3X13A 3S4SB 2W59A 4NDMB 4MAUL 4Y4FA 2ESVA 3G04A 1MJ8H 1YJDC 3LQMA 3VGAC 2VDKL 3SQBA 1YECH 4XWGH 4JLRB 3FOLA 3WNOA 3T4YA 2Q8BH 2LTQB 4JM2C 4GG6B 1CFSA 3QXDB 5DT1L 4MJ2A 2CKBH 2PETA 4PRHB 4I0KA 1K5NA 4LSXC 4KJWC 5T3XD 2IFGA 4MA8L 1FG9C 5LWYH 3JWDH 5F8QC 5DD3H 4DW2H 2EYRB 2IBZX 4U3HA 3FFCA 5HTSA 3V4VL 5F93C 1YEIL 3GRWA 3MRLA 1BD2D 5BS0B 3P77A 4N1CA 4HPOH 4EEEA 5I1DA 1IEAB 4Y5XA 2P46B 4PGDA 4HK3N 5H2BA 5T1MA 1WZ1L 2VRAA 3NIDE 3CIYA 1QSVA 4Q3GA 2GHWB 2DLEA 1YC8A 3VD5A 4XOSA 1CN4A 5CP3A 2AJSL 2IF7A 4M48L 1J12A 1LO0H 3WDHA 1AC0A 1IQDA 3MXVL 1MCLA 4AENB 1WUNT 1SQ0B 1MHCA 4QRQB 5FKPA 4AEIL 1G84A 4H1LH 4FXGB 4F33A 3SDDD 1MJ7L 2J8UB 3U7WL 5I1HH 1B4RA 5E99L 3ARPA 4LLMA 2WZPD 4JZNA 4OV6F 4F58H 4NO5B 4ZAKD 4LAQH 3P0YH 4WU5B 4MD4B 5DGQA 3S36H 1WCQA 3KLAA 4EUPH 4NFDA 5MI0B 1YNLH 5LCVL 1O6VA 1O0VA 1YPZF 4JG0L 2BHZA 1YA5A 5IUSA 2CQVA 4WV1C 3HUJA 4WO4D 3NCYS 5FFLA 1X5IA 3RJQB 3STLA 3MJ6A 4H88L 1HI6A 2IBGA 4GQPH 2VLKB 5I2IA 3FB5B 5GS0H 4P5TD 5DD5H 3SGEI 2QQKH 2CDFB 3D3VD 3SO3B 4X0KA 1XMWA 1FVDB 5EOCH 2Z81A 3RVUD 3MA7A 4ONOA 2ZUQC 2XZZA 1CVRA 3OF6D 1J1OH 2DQCL 4YNYA 4OCNC 2WP3T 3P73B 1TETH 2JCCB 1FO0A 5T3ZD 1M9LA 2MQ0A 4E42B 5J06A 1XGTB 3MJGX 4G5ZH 5HHQB 2LVEA 2IMNA 1VEPA 2F15A 43C9A 5IEKA 1DUZB 2MOVA 4U0RC 3DZEA 1H3GA 2AEPH 4DKEH 3GMLB 3VWKA 3RVTC 1OGTB 2C1PA 3MRDB 4NWUH 3MGOA 2Z31A 4HCRL 1QSEB 3X11A 1S7RA 4XNXL 3V4UH 3EDJA 3V6FA 1TQBB 2C5DC 3UZVB 1AKJD 4NFBA 3FQTA 3TV3H 3RWFA 5C70A 1NCAH 1IC5H 3DBXA 4RRPG 5D2NC 2X4TA 5TH2B 3RQ3A 4PRIA 1HYSC 2QSCL 1PG7X 4MB5A 1OW0A 2AXFB 3FRPG 4L4TB 3QPXL 1UWEL 2AJVH 5F1NB 1CICC 1H3VA 3MLTA 3WFCH 4FQ2L 1M6OB 4GKZA 1Z2KA 4FQXC 4XH2B 2AKRB 3GMOA 5DD6A 5KSAA 5I75C 1FZMA 2JF1A 3HG1E 3RIAK 5JO5A 4ZD3L 4MA1C 3V4PL 3L5XL 4X6FA 1ZT1B 2BSTB 2FX9H 4LXSA 4NQUA 1Y0LA 1X5GA 2A77L 3IKKA 1FL3B 4GBXB 2AABL 2BOCB 1C08A 2UWEA 3QIBB 2EICA 3U1SL 3QCTL 1N64L 3V79C 4IRJA 5DR5L 4X6DA 4K3DL 2UWEF 4UOJA 1FSKB 5IWLC 1IGFL 2VISA 2P45B 5ERWB 5IESL 4X6DF 2Z63A 4LCIL 5JMOC 4EBQH 1IGTB 4QTHA 3W0WA 4NZUH 4L1DA 1TVDA 2HVJB 4N5UA 2L0DA 1TIUA 2ORBL 5INDB 5MENE 4HBCH 5DMKB 4R4FH 3W3KA 2P47B 4UIKL 5DRZB 1L7TL 3CSGA 1D3CA 2FB4H 3DO7B 1MIMH 5KZCD 4GMTL 3O2VL 3ZYOA 1NSNL 1KF9B 3NTCL 4PJ7B 4FFYH 4PRHA 1UM6L 5JUEH 4M6MH 4P23B 3HE6D 3TZVC 5B4PA 1KCSH 2FNBA 1YEDB 3IFLH 1E4XI 4LSVL 3GSWB 3V5HA 3BKJH 2WBKA 3TBVB 5BS0A 5F9OL 3GJFK 1CF8H 1I9JH 4S0TD 1U3HD 2Z8SA 4U1JB 1T4KB 3PDOB 3I6KB 3V7AE 4ECOA 2ADGB 2R8SH 4DUWA 3ZHLA 5F8RC 2L7UA 5DQ9B 3MBEC 3BWAA 1U8QA 3ZDZE 4N0CD 1U92B 1IAIM 1G7JA 1BJ8A 2VIRA 4QRQA 2OXHA 4FXGA 5MP6L 1F02I 1Q8MA 3IRZA 1C5BL 5C0EA 1NKRA 5GSRB 2F5AL 2QKIB 5IHZB 4MD4A 2EYSB 2DM7A 3MGAA 1L6ZA 4QWWD 4R58A 4QRUB 4C4KO 1WFOA 2A83B 3D2UD 1OP3H 3HC3L 2EIBA 4HUXB 2NY5L 3P30H 1AO7B 3BP4B 1BZ9B 3LQZB 3MMEB 2VNCA 5KAQG 1GGUA 1OWWA 1FFOB 1KIQB 3VD9A 1KJ3L 2YEZB 3FB5A 4F57L 4I0PC 2NZ9D 2CDFA 3Q48A 4QHNB 3EIFA 3PQYD 1FVDA 1V3JA 3Q1SH 5GJTH 3U9UB 4NCDA 4B50A 1LHZA 5D1ZB 4BYHA 4ONFL 5C6PB 2A38A 2W38A 3ARBA 4JM4L 3O41A 4KQ3L 1PKQE 2NLJA 3KHOA 4R6FA 4KJPD 2EIZB 4RBPK 4RGND 4NCC2 3RWEA 2WWMD 1DUZA 5DJ0A 1ZT4B 1R0AL 1I1AD 2VDRH 1OD9A 1H9VA 3GMLA 5E7BA 4PJ9B 2GJ6E 1EHNA 2M2DA 4XMKL 1QSEA 4OGAC 5HY9B 1MLCB 4OZHB 2VZTA 4PRPE 5ITBL 1R24A 2BVEA 1I9RL 4YDLC 5EBGA 5CJBA 5DXWA 4WUUD 3S3SA 4F9LC 3OR6B 1JZ8A 2R69H 4S1RH 2Z93B 2NY5C 1OSPH 5AZEH 3VXSD 3ZE1E 3DI2B 2EO9A 4JN2B 5F1NA 3ULVE 4OZIE 3TWCH 3DIFA 2PCPB 2NMSA 2AKRA 1YY8B 2VDML 1LP9E 3TA3C 3ZZ1A 5F3HB 2XWBA 3O4LD 5F3BB 3WIFB 3RVVD 1ZT1A 3ES6B 4D9LH 1DZBA 1OGQA 2JJTA 4ZO6A 5I1EH 1YNTA 4IHOA 5CUSL 3GNMH 3QIBA 2R1YA 4EI5A 4S2SB 4WI9A 4LF3B 2FD6L 3SKMA 2IANA 1EGJL 5ERWA 1TVHB 3MOAH 2F19L 5DJDB 5D72L 5HI4C 3VXME 4QCIA 3OJVC 5DMKA 1A3RL 4OFKA 1Z6JT 5DRZA 2EE9A 3O3DB 5E8OB 4K2UL 3UCRA 3DO7A 4F3FA 4LAJH 5E8NA 3VXRB 4NYLB 3GSNL 1BWMA 5HI3C 1ZOXA 4PJCA 5JOFA 3LPGA 4PJCF 4P23A 4JHZA 1UJ3C 1MCNA 2XZCH 1KTLB 3RWIA 3GSWA 3MR9A 3BEVA 4V1DA 1I9EA 2JIXB 4PG9A 4FCGA 2YA1A 1F58H 1MQ8A 4U1JA 4OLUL 4D8PB 3QO1B 1F45A 4TRPL 4YFEA 2R0ZH 3JV6B 4PTTA 2X6MA 3LKNA 5DQ9A 3CC5B 1KENH 1G9ML 3CFCH 3BRFA 3QQ9C 1U92A 2PKDA 1KTRL 5SX5H 5LG1A 4HBQA 1RJYB 3C6SA 4RIRA 4AQOA 2FYYB 4L8SC 3VW3H 1P7KB 2JJUA 2I60H 4JFFB 3TN0B 2UVFA 2B8OT 1TITA 1NBZB 1VEMA 2W1NA 3MJ9H 1QFWI 5IHZA 1A7QL 2AGJL 2EYSA 4X6EB 1U41A 2DL9A 2XWTB 4N68A 4QRUA 2A83A 5CJ8A 5FYLL 3STBA 2OMVA 1V3MA 5CGYD 1YEGL 1ZMYA 2VMFA 3QXAB 2VDOH 4RWHA 2XQYK 3TBYB 3E8UL 4LSDA 2GT9B 3FN9A 4IRSD 4R3SB 3LQZA 3MMEA 2NY3C 4LNRA 3FN0H 2EYTB 1BZ7A 1UZ6F 1UG9A 3JTSB 4MXQD 4N0UE 1KIQA 3VWJC 5GZOD 2YEZA 4QKXB 5KVFH 1IL1B 5I0ZA 2OMTA 4QHNA 4P2CG 1VA9A 2BNQA 3GFUA 4NQXB 3MRHB 5EFIB 3T2OA 4OD2B 4MJ4A 4CUCA 1NANH 3UDWA 3SE9H 3BQUD 4NZRH 3HG1D 1NDGB 4KKLC 3VGAB 1G9MC 4NHUA 3BP7B 3CCHA 2FEDD 2PYFB 4KMTH 4JM2B 1ZT4A 3MLVH 3HE7D 4LMQI 4PJ9A 1KLGB 5DUPH 2BNRE 5C08E 3UJIH 3Q2CA 3WJJA 1HILA 2YWYA 5BMFH 4CGTA 4OZHA 5FUCC 4U1HB 1GGBH 3RDTC 1DBJL 3ZYZA 4OCSH 4C57C 5ABDE 5EORH 5ICYB 3UEZA 4FP8L 4NO0A 3QEUB 4P2OA 3QULB 2AJUL 5FYKE 2I9TA 2Z93A 3T0BA 2OK0L 1RFDH 1J8HB 4U1KA 5TJWK 3MRRA 1ZK9A 3BT2H 2YA0A 2R0LL 1JUFB 4MVBD 1RSFA 3IU4H 4JN2A 4DN3H 3SDAC 2ED9A 4X6CB 2O6SA 2PCPA 2Y36H 4HHAB 3K4AA 1YY8A 4LOUD 1SM3H 1S78C 3DSNA 3T0EC 3SKUD 4Y2OA 4Y2DD 4OSUH 4DWHA 5F3BA 4JQIL 2VJXA 3G6DL 1QQDB 4FQ1H 4CVUA 3RHWK 4EN3C 2FO4B 4GUPA 1AC6A 4LF3A 4LARH 1E0OB 3VRLF 1IAKB 3H2WA 5CEXA 3S98A 2V9QA 4NQVB 4OZGF 5D8JH 2HTLC 3T0AA 1TVHA 3VI3E 1HSBB 2ZSVA 4WV1B 2RAMA 5T1DH 3ROLA 5D7LA 1XR8B 2X9XA 2IQAB 3FAWA 4HC1L 1JCKA 4CU7A 1DQJA 4R2GD 4FTVE 1YDPB 4QHMB 5KSUB 1NGWA 3K1KC 4RFOH 3O3EB 1L7IH 3O3DA 4WUKH 5E8OA 2RIKA 4JFDB 5IKCA 3FFDB 2ZUQB 3LEVH 2HVKA 4ZPVB 4R07A 4L4VA 4K9EH 5GMHA 1P8VA 1KJ2B 4PBVC 3D39A 1Y18B 2JE8A 4PJFB 1JV5B 4Z0BH 2WSKA 1RJLB 1G0DA 2A6IB 3VA2C 1G6VK 4U0RB 2R0WH 3FKUS 1HIMH 1JNJA 3RP1A 4ZNCD 4M8QB 4D8PA 5J11C 3QO1A 4MMXC 2GW5A 3UTSB 5I8EA 1UXWB 3VJ6B 2J1KA 5A2JH 5D2NB 1CFNB 4UT9L 1ZE3C 3MUY1 1RJYA 4YPGB 4YO0B 4OQ1A 2FYYA 4LVEA 2P42B 1OWRM 5JOPD 1HXMB 4MZ2A 3E3ZA 4ZXBC 3V6OE 2ZJSH 1CICB 1GCFA 3DSFH 4JFFA 4YBLC 3J7HA 1SBBA 4M7KH 3TN0A 1KXQE 4PREB 4FQXB 3UP1A 5J9PA 3LB6D 1NBZA 3QUYD 4GG6E 3JUYA 5I75B 4N5EC 4ZOEA 2R0KL 2JJSC 4X6EA 1EX0A 4MA1B 4UILL 1AJ7H 1JHTB 5E03A 4KDTC 2VXUL 3EOTH 2FHBA 2GT9A 3I75A 3ARTA 4HWZB 3BIKA 1GSMA 4R3SA 2XFXB 3WUWB 1XIWA 2EYTA 4L8CB 5J8OA 1VPOL 1L0QA 3PIQB 1IL1A 3O4OB 4L8DB 3WYRA 3B43A 3ULAA 1RZJH 4J4PC 1W72B 4GAJH 5EFIA 2NTSP 3RFEA 5LXGH 1MVUA 1ITCA 3U6RA 1NC2B 2YBRB 5HHOE 1NDGA 2I5YH 3K2MC 3RAJL 4NZRL 1BBJB 1Y6MR 3BP7A 5ESVB 2J8UE 4FFVC 4TTDC 25C8L 1OAKH 3D25A 4PLOB 1F8TH 3IJHB 2FATL 3MLZL 4YHML 2P5WB 5GGTH 4DUVA 4LSXA 1UA6L 1LMKA 3O8XD 1V5JA 3TZVB 1EJOH 1CD0A 3QRGL 4PLJC 3PGFH 4TNWK 2M8XA 2ATPB 4H09A 1D5BA 5ICYA 5GRJH 1GGBL 2AK4E 3HFMH 1B0WA 4NM4L 3QEUA 3QULA 2VLJD 3VXMD 4PJAE 1JPFB 1J8HA 1G0YR 3DMMD 4FFZH 3VFRB 2VLKE 3H42L 5ICZB 1JUFA 3ZDYE 2R4RL 3B8YA 1SJHB 3MBEB 1RIUH 4HHAA 4NP4L 4JHBA 3RWJA 2LVCA 1LEKB 4FQQB 3VG0H 3OTTA 2J6EL 1U8MA 2QSVA 5KTEH 2VL5B 5C0BA 4FMZA 3NH7H 1S7UB 1SBSH 4HH8A 2JCCE 4AMKL 4J3UA 1QQDA 4XSQA 2V2XB 5I15H 3VXOA 2WBJC 3OJDA 2R39A 5GGRB 4XZUB 3TBSB 4FQPA 4P46D 5EZIL 3TNNA 4KMQA 4P48A 4APQA 4NQCA 2OTWB 1DE4B 4NQVA 4PUBH 3E6FB 4F8QA 3DXAB 2IEPA 4NRZB 2DM2A 3N9GH 1HSBA 2R1XB 4Y4HD 5BO1H 3K8MA 3E2HC 4KK9C 5GRVK 3CPLB 5I8OH 1XR8A 1D5XA 2IQAA 5E1AB 4XBGB 3A6BH 1Z5LB 3B5TA 1CYGA 3MO1A 3SDXB 4QHMA 5KSUA 4Y4FD 4I0PB 2ESVD 1RIHL 3IYLW 1OT1A 2QR0A 4F9PC 3BYYA 1DQML 2IFFH 32C2B 4JFDA 4L4TE 3RZCC 4LMQE 3UTTB 2R23B 3MRQB 1CE1L 5L2JA 1J5OH 3QPQD 3QDJE 1TZIA 5L7XL 1ZVSA 1YEFH 5AAMA 1KJ2A 3HC0A 3CDCA 1DFBH 4XPFH 1NAKL 1JV5A 1ZKAA 1JJUA 1ULVA 1B9ZA 1RJLA 1NBVL 1NGYA 3UL7A 4N0YH 4UZGA 4Z95L 1FGVL 1WWBX 4XCEB 3DGCR 4M8QA 1J1XH 5TF1H 4RMQA 1ZLSH 4MS8C 4MXVF 1BQHG 2XKSA 1ZLVK 2HMIC 1G9NL 3UTSA 4ZDHB 2BSED 3V5DA 3M8OH 1MCOL 3MV9B 3T1FB 5KSBF 2X70B 3ISWA 4YDLB 3K2UH 2FIKA 3T2PA 2DLFH 4GW4B 1CFNA 2YS4A 3LS5L 4XC3H 4YPGA 3M45A 4LLDB 4YO0A 3W5MA 2MTPA 3MOBH 1KULA 1OPGL 4MXWH 1Q0YH 4N9GB 3PNWB 3HPLB 4PJ7E 3BOVA 3T65B 4KVCH 3TA3B 3U79A 3B9VA 4R5DA 4ZFGH 3G6JE 3C08L 4X4ZA 5F7EH 2ICEB 1U42A 3ZE0E 2DQHL 4K9EC 8FABA 2X4NB 3L3GA 3QNZA 4NGHL 4WRLA 5K9QG 5BXFA 3QO0A 3O6LL 5IT2H 4KTDH 2DTMH 3D48R 3PIQA 4DKFH 5GSVA 4L8DA 4PJ5E 5D7IF 1W72A 2G2RB 2ID5A 1LDPL 3BPLC 1G9NC 4U08A 4OQTL 3W9EA 3GM0A 1Z9MA 3GO1H 3KJ4C 4IRZL 4M5YH 1JNLL 1BBJA 5ESVA 4XPGH 4GKSA 3ZL4H 1BM3H 1JRHL 2P5WA 2HJFA 4WFGE 5DI8A 3DX7A 1YYLH 2EDBA 3TZVA 1F3JA 3QWRA 5SWZE 1UJ3B 4RMSA 1H8OA 3BN9D 4FRWA 1RV6X 3VWKD 4M03A 4G6AC 2P1PB 2Z31D 3GMMB 4UDUB 1NCCL 1MUJB 3LKRB 3OGOE 1AO7E 2I9LB 4JPIB 4G8AA 3VGBA 4OZFH 3HFML 1GPOH 4HK3J 3JV0A 1T5WB 1S7QA 3RNKA 3U7AA 3L5HA