The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
74
|
sequence length |
335
|
structure length |
331
|
Chain Sequence |
b'RSVVSCPANCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLH'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure and Role of Glycans and Dimerisation in Folding of Neuronal Leucine-Rich Repeat Protein Amigo-1
pubmed doi rcsb |
molecule keywords |
Amphoterin-induced protein 1
|
source organism |
Mus musculus
|
molecule tags |
Cell adhesion
|
total genus |
74
|
structure length |
331
|
sequence length |
335
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-08-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07679 | I-set | Immunoglobulin I-set domain |
A | PF13855 | LRR_8 | Leucine rich repeat |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Alpha Beta | Alpha-Beta Horseshoe | Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) | Ribonuclease Inhibitor |