2XOTA

Crystal structure of neuronal leucine rich repeat protein amigo-1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
335
structure length
331
Chain Sequence
RSVVSCPANCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Role of Glycans and Dimerisation in Folding of Neuronal Leucine-Rich Repeat Protein Amigo-1
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Amphoterin-induced protein 1
total genus 74
structure length 331
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xotA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2xotA01
1KLUA 1AFVL 1XCQA 2A0LD 3S36H 5KG9B 3CDGA 1R3HB 2VXQL 1EH9A 2VUYA 3LS4L 4XP4L 3QUXC 5DJ8B 5J3HC 2FCBA 2BRRH 4Q9BA 1VFUA 1J88A 3ZDZF 2CGRH 1GHFH 4PRNA 4Y4HA 3LV3B 4R0LA 3MBXH 4ZTOL 2FJHB 3U4AA 3OKOB 4K2UL 4OLXH 4JQIH 4JFQB 3SGJC 4NO5B 5GS0C 5IEHA 4LK4A 5I8EB 3DSFL 4PRHB 1CLCA 5GSRA 5IW1B 1EZVX 2V5TA 1U41A 3ULUF 2FX9H 7FABL 1FL3A 1NSNL 3SKNA 1OLLA 1YEJH 2KZWA 4PJHF 1BIIA 3VXQB 4BZYA 4JB9H 5D8JH 3OR7B 4OZHA 3AS1A 4TUJB 1IL1B 1MH5A 2B0SH 1A6WH 5IB3A 5DJAA 3QQ3A 3OB8A 4Q6IA 1A9EA 3TCLA 1CDIA 4JHWH 3BPLC 4FTVD 3PIQA 2VSDA 3MV8A 4X6EB 4D8PA 3MJ8B 2WQUA 5FUOH 5EZLB 4M9OA 5D96C 4YHKH 4I4WB 1J9CT 3GHBH 3S37L 1J5OL 1S7XA 2EO9A 5ERWA 1NEZB 4FQLL 2Z93A 4LDOB 4MA8L 5E2JA 2ADIB 5HD8C 3V5KB 1NGZB 3Q6GH 1I3UA 5GGTH 4OD1H 3C8KB 4LAQL 5ISZE 2NYYD 4M4PA 3VDCA 3O3EB 4PRIB 1R3LA 2WZPD 5EFIB 3VGGA 5BRZB 2QTEA 1FNEB 1ZWIA 1KXQE 2F53B 1JBJA 1C7TA 4S1SL 3VH8A 2UY6A 2VXTH 2IWGA 1EEZB 2RQ8A 4DGIL 3DYPA 1HOCA 4JREC 2OMWA 3UTTA 2X4OA 4L9LB 5HHQB 5ENWA 1OPGH 2W60B 1G7JA 3RZCB 5DRNB 2B20A 1M7DB 2R23A 4I48B 4QHNA 4P2QE 1L0YA 3P11L 5I1DA 1N4XH 1R3KB 1BMGA 2YEZB 4BSVB 3WFCL 4U6VL 4XP1H 4J8RB 1Q0XH 5L6YL 3ROLB 2BHYA 3LN9A 3DSNA 3HE7C 4D9RE 4NKDB 1X5IA 4PTTB 1MLCB 4GKZB 4L8CA 1ZKAA 1YEEL 3B2UD 1RURH 2APWA 2OMNA 2AI0L 4XWOD 3U6RB 5D7KE 2Y1VA 3IJSB 2P5WD 1CFSB 5IOPA 1FZMA 3VMNA 4B0MM 5DJZB 4YZFE 1A5FH 1ZLUH 3GNML 3VXRE 4NO3A 4NZUH 3AU1B 1DQTA 2AP2A 4EKXA 1UKQA 2HJFB 4R97B 2CMRL 4F15C 1CD9B 5KJRH 1VESA 3Q2CA 5SWZD 2FHFA 2ZNXA 5AYQA 5K9JH 1FORL 3WS6C 4W4OA 1QNZL 3MLYL 4GUPB 4GW4A 3IS0X 1H5BA 3ZYOA 1RULL 2PO6B 3EJJX 5CINH 4O2CA 2P1QB 4H20L 5I0DA 3LRGA 3LN5A 3NGBB 4X9GA 3G5YB 3ZYNA 2P43B 4OB5L 5CEYB 5K9QI 4EXPX 3U4EA 4NO0D 1AKJB 3G5YA 5GGUA 2F54D 4FXKB 4HG4J 4YHZL 3IDIA 4JGJA 2DQHH 1T1ZA 4BUHA 1IGIH 3DBXA 3H42L 4XMKH 3BH9B 5CKAA 2HKFL 1QLEL 2A6DB 3SDDA 3DYOA 2W91A 4PLKC 2I07B 1OGAE 5MEOB 1LK3L 2VN4A 2OJZL 1DEEA 1NCBL 2ADFL 3ZT7A 2NY6B 4M5ZL 5D5ME 1UM5L 3L5IA 4ZG1A 4I0PD 5TE7H 3WLWC 5DEFB 5KSAA 3QAZB 1Z0NA 4HWBL 4PJAA 1DN0A 3HI1B 3P0GB 2DTML 4Y5VC 3QJHB 4X6BB 4I8DA 2BVTA 2Z7XB 5H35A 3TA3B 5D6CA 5EZJA 3U1SL 5TE4H 3WEXA 5FXCH 5D7IB 3VFPA 4K7PL 3VXTA 4P48A 1QTYT 3FB7A 4O4YL 5EU7E 3LKOB 5F71A 2Z82A 3Q5TA 3ARSA 4U06A 2ZSVA 5D7IA 1J1OL 1FZKA 1CXLA 1DQDH 4LVOB 1CN4A 3K81A 2R69H 3IFPB 5IJBA 1EZVY 4N8CL 3MUGB 1BJ1J 4U1SB 1L7IL 2BERA 5TQ0L 2PF6A 4PJAB 1MFCL 2VZ1A 3HHRB 3QWOB 4IOFC 2MQ3A 5JHDA 1MFAH 4NGHH 2EH8L 4F7TA 4MJ2A 2OSLA 3IU3A 4UNVA 4IRSD 4Y89A 2R56H 3HG1A 4NJAH 1EEZA 5DZOA 5D7JB 1KJ2A 1FZJA 4PIRF 5JMRA 3B5HA 3S3SA 3U46B 4L3AA 3CUPA 3U7AA 3DGGA 5IBTL 3QZWG 1IKNA 2HRPL 4LLMA 5JIKA 1AQDB 4J7RA 2IC2A 1AE6H 3PWPE 4X7CC 2UY7A 1SQ0B 2J12B 1BAFH 1S7WA 4FQLH 5JOPD 4JPWL 4LPVA 4S1DD 4KK6C 2EDDA 3ZKNC 5FGBC 2YD1A 1GZPB 4NJ9H 5D3IA 5TDNA 4ZXBD 5AAMA 3RDTB 1CF8L 3WPHA 3OL2A 3MLTB 3G06A 1KN4H 1MHHA 1QRKA 1D6VH 1XF4A 2GCYA 5E00A 4OM1L 3KJ6H 4N0YL 5KANG 2AJUL 5DQDL 5A1AA 5FB8A 4GXVH 4FABH 1XF3A 2N7AA 3A67H 4NZDA 5AYUH 1BX2B 2HJLB 4G7VL 2ESVB 2P5WA 2GFBB 3MRJB 3CVHA 5J4MA 4R07A 3W11D 4HBQA 3DVFA 5IK3B 1BFTA 1NJ9B 4PJ8D 3QCVL 1A6VH 5J13B 3GMNA 3BGFB 4LSQL 5FECB 4D0BA 4N9GB 1S8DB 1I8LC 3L5HA 3LKRB 4NNXB 3DROB 2H41A 4FRWA 4TVPE 1CT8A 3KDMB 4POZC 4KHXH 2XG5A 4UT9H 3O8XC 1W0YT 5CP3A 1FFNA 4FTVB 1S7RA 2IALA 2NXZD 3BP6B 4GXVL 4FABL 4EXKA 4QXGL 1B0GA 3TP4A 2Q8AH 4QHUB 2X2YA 1LTXA 2X1QA 4P9ML 4OSUH 4GAJH 2UUDK 1NL0L 1BVLB 3PF2A 1JGLH 5KOMC 1S3KL 4HW6A 5BQ7B 3BAEH 3VCLB 5F72S 3P4NB 1F2XK 4H8WL 3OGKB 4UBDD 3P9LA 5L7XL 4PJCA 3MV9B 1KCVH 5CHNB 2YHGA 3S37X 2OL3L 3NIFE 4Y16B 1AHWC 4UQ3A 3TBWB 1KJMA 5DMGC 2E7MA 3R0MA 3P73A 3ZKXC 2XWTC 1XEUA 1ZHKA 3IDNA 5C0DB 5CD3A 4DTGL 3GKZA 1RUML 1RFDL 5JORA 2OMTA 4K7PY 2HAZA 2XPGB 4OZGF 1P2CA 1K4DA 1PG7L 1OAKH 3ILQC 4LCUB 3TT3L 4NZRL 1DLHB 3V5KA 3QUMB 1FYTB 3AMLA 4MQ7A 3VFWB 4ELMB 3T77A 4RDQF 1R5WB 3S34L 5DD0L 3FT4B 4HUUB 4Y4KD 4HGKC 5IJVA 5CAYB 5I9QC 2QQLH 3MRDB 3DMMB 3OMZA 5IGXH 1Q9LA 1QUNA 1A14H 2YPKB 1JK8B 3EBAA 3PV7A 2B8OT 2MCPH 2LTQB 2DI9A 3FO1B 1A9EB 2NY3B 4P2QB 3L3IB 1IM9D 1XGQA 4EI6A 3QEQA 3A6CH 3T3PF 3V6FB 5C71A 1P8VA 2R4SL 1M7IB 1BEYH 3DX9A 3MGTB 2J4WL 2X41A 1KB5L 1CFTB 1B0RB 1RJYA 2YA2A 4Y4FD 3VXOA 1F13A 4L8DA 5D1QA 1IZJA 1KELL 4KPHL 1VPOH 4OZFH 3IKCB 3CUPB 4NQED 3OGOE 5E1AA 3ZDZE 5E1HB 2XZAH 5EC1A 4NO5A 3B5TA 4KQ3L 1T04B 2I60L 4M48L 1NBZB 4HIEA 3P77B 4JRXA 3TIEA 4XBEH 3EGSA 3F8UB 3I6LE 1HHHA 3OG6B 4WV1B 3S3PA 1IM3A 3T04D 2V2TA 4U2YA 7FABH 5C08D 3ARGC 4U6YB 4JJ5A 4FZEH 2R8SH 1CQYA 1LDPL 4UTAL 5HI4C 4MQ7B 2CUMA 3SQOL 4P5KB 1I8MB 4G80A 4XHJC 2X4RB 3RVUD 1DVFB 5JLZA 4P3WA 4IIQB 4NOFA 1ZHLA 2C1PB 5D7LB 1DBJH 2ZOKA 1IAOA 1Y18A 5CZXC 5ACLA 1X5AA 4M62L 1CDUA 3DUUA 3FMGL 4YHYC 1XKUA 1WAAA 4X8JA 3O4OB 1UJ3C 2FNBA 3FN0H 3KGRA 3MV9A 5T3ZE 4Q9QL 3SEPA 1RMFL 3ULUH 4XMKL 1N5AB 1OGAB 1P7QA 2FEDC 1S7SA 3L3GB 5AZ2H 1QSFD 3HZMB 1PLGH 2Q20A 1J5OH 1DBBL 4KDWA 1JNLL 2FGZA 1G7MA 2Y23A 3I50L 2WSKA 2PTTB 3GSWB 3GFUA 3WNPA 4N90D 4NC1E 2F74A 2EH7L 4KZEH 4FQPA 3KPSB 5DC0A 3RWFA 1M6OB 1RZKL 3VXME 3L95B 1G9ML 2PYFA 3KJ6L 5D71L 5AZEH 1OTOA 1DR9A 4DWHA 5FIEA 2BVEA 1IZKA 4LEOA 4J6RL 3FOLA 5CGYC 1ITCA 4S1SH 4HX1A 3U30C 5GPRA 4WFEE 4RGND 4LF3A 4C2AB 1JPSH 2NY5H 4I18A 4K17A 5EUKB 4MJ5B 3V9FA 4EZMA 3D85D 2YS4A 3TNMA 5HYJB 3KPOA 3QUYB 2CR3A 4QF1B 4IHOB 4OJFL 3C5ZB 1LO5B 3O45A 4O02L 5I30H 1EUTA 2BVUA 2HMID 4Y4FA 1FL5B 3WFEH 1TMCB 4JVUA 1RIUL 2H9GA 1TVHB 4P9HH 2HFEA 3D2UB 3MUHL 3WUWG 4EDWL 1FT8A 1S7QB 2YZ1A 3V0WH 3WFCH 2CA6A 1ZA6B 3FT4A 4QHMA 3PHQA 2G60L 4PGEB 4HT1L 1N64L 2VDRH 5FYKU 3K4DA 5F88A 2W65B 4JAMB 4JREB 4DVBA 1NCAL 5C0AB 2AJVL 4ODTL 4LCWD 4QXTA 3V79C 3ELAT 1V7ML 2NY0D 4K3HA 2DLHA 5E08H 2WINA 1QLFA 3QDMA 4PJXA 2XA8H 4LPCA 1LNUA 3D85B 5C0GA 3MO1A 4HUNB 4DQOH 2M8XA 1MFEL 5GGVH 1HHIA 3HZYB 4GKSA 4EUPH 4B8CD 4P99A 1MFBH 4R2GB 1RZ7L 4MNGE 3TEUA 1CBVH 3LQZA 1KB9J 2V7HB 1KJ2L 2D9CA 3UDWA 5FM5M 3LH2H 3U4BH 5FCUH 4C56A 4CNIB 2XKSA 3CZFA 3HMXH 1LK2A 5D9SB 1OGAA 5CUSL 5FV2A 1IKFH 5E2UL 3V6OA 4N8VG 2VNCA 3ZHKA 1GC1C 4HDIA 1RIVH 4YHML 5ADPH 4OI7A 3DUUB 1UM4H 3LKOA 4LKCA 4OGYL 4POUB 5DR5H 5C0CA 4XVJH 2C3GA 4JCLA 4KKAC 4OKVB 4DJMA 5C9JA 1BOYA 3ZDXF 1AIFB 4RDQG 1UQSA 3L9RA 3ARGA 1IC7L 3RJQB 1ONQA 4PJGE 3EOTL 5D7SH 3E6FB 2E9IA 2OJZH 4H26A 4U08A 5D7LE 3AREB 2EDRA 4FTVE 2BZDA 2PO6C 4MLIA 2R23B 5CJQH 1JFQH 5E8PA 4NM4H 1QYGL 3KLDA 5DC9B 3V5HB 3HCVA 3LKQA 1WAAF 3LPFA 3QA3B 4L4VE 5EZOH 1GGBL 1WJ3A 3CPLB 4U1IA 3IVKB 5FKPB 5FFLA 2VLRA 5I1JL 2BNQE 4HUUA 3EDFA 3NIGF 3G5VA 1EEYA 3MCLH 3DNKA 3GBNH 2ESVD 4GAGL 3C5ZC 1GAFL 3NPZB 3G04C 3NIDE 3D2UD 4U7LA 1NCCL 2IH1B 1G0XA 3W0WB 3EZJB 1ZAGA 2Y6SC 1RZFH 2RA8A 4HS8H 1F4XH 2AJYH 3C5ZD 4LLAA 1R3JB 3OJDB 1BWWA 4NKQB 3FO0H 1AY1H 3RX8A 2W38A 3AVEA 5IP4A 3WHE1 1T66C 1GGIL 4IOIB 4G8GD 4AZ8A 2AKRA 5KVDL 3B9DA 3T2OA 2MKWA 1NCWH 3I6LD 3ZTJH 1WWWX 2BX5A 2MSPA 5AWCA 4FZ8L 4TNVK 1HYSC 4JFYA 4JPWH 4NRYB 4V2EA 1ORQA 4JHAL 1U8PA 4IRJD 4HUXA 4TPRL 4G5ZL 1XCTA 1B0WA 2EDBA 5BV7C 3MRRA 2IH3A 5I75B 1CICC 2DIAA 2EDQA 4C4KT 3WPEA 3P0VH 1MNUL 2ASSB 1FIGH 2OM5A 1NAMB 4ETYA 2XWBB 3CSPA 4YO0A 5GQBA 2DI7A 1LILA 2BOCB 2E27H 2VQ1A 1H3TA 1QRNB 5DS8B 1PW3A 3WSQH 4YXHH 4KPHH 3OR6B 4OZFA 3QULB 5EO1A 2WBJB 5DLMH 5EB9A 3TVMD 3G9VA 4TUKL 5CZXD 1F4YH 3MA7B 3GHEL 2P5WB 5EDXA 5C0AE 3O3AB 2GQHA 3JSSA 4FMZA 3WBDA 4HQ1A 1OT1A 4O9HH 2EE3A 4DUVA 3S7GA 1DCEA 3DGCR 1XGUB 3U2SA 2X4SA 4BK5A 2YUXA 3W3LA 3LKNB 1S7UB 4UDTA 5HVHB 4GMSL 4QEGA 4W6WB 2DQTL 3VRLE 3I84A 5TFSL 3BH8B 1XGPA 1Y6KR 2VL5A 2NY1C 1C1EH 1CGSL 2UYLA 3SDCC 5HHOD 4S11A 3NACL 1MUJA 2R15A 3KPLB 1HILA 4LLWA 5GS2D 5IW6B 4GKNA 5FOBB 4JFZH 1FS2A 3QCVH 3JVGC 1WBZA 4X9FA 1BJ1H 3UAJC 2Z4QA 2D31A 5M7QA 4F2MA 5F9JB 1J8HD 5DD1H 3VG0H 4LBEB 1MRCH 5DZNA 4PJFF 3VFOA 2HT3C 5F9AC 4JRYE 4ENED 1INDL 4XAWL 1DLFL 2D0GA 4EDWH 1LGVA 4G8GB 5F7YC 2O5XH 5CP7A 1UVQA 2EDXA 2J2ZA 4BM7A 4LSPH 5DRZB 2P48B 1SEBA 4U1MB 1YQ2A 2V2WB 1NSNH 1KEGH 1C7SA 4AJ0A 2R2EB 4HK3J 4YDLC 1XF3B 4ZDHB 1NC2D 2XG4A 4MQXD 3UN9A 4PJGB 1H3XA 3FQTA 1Q0YL 4R4ND 4H8WH 4QT5B 4JE4B 1NLDL 3SCMD 2UV3A 1A9NA 4F58L 1MCNA 1CS6A 4HKXA 2I24N 5HDBE 3VXSB 4ONFH 5C0BB 3VXMB 3GSQA 4G6KH 5TDNB 5FYJU 2C5DC 4Z7VE 3RY6C 4YXLL 3LN4B 1FSKB 2G75B 5F9OL 1UWXK 3NCJL 1A5FL 1BD2D 4OZFB 4RIRA 2VQ1B 3VXRB 3GK8H 2FWOB 4GS7B 3RNQA 3DGGB 2BEXA 4XXDA 5HYQB 32C2A 2AK4B 4QXUL 4LFHG 5C0JA 2FGWL 3IAGC 3T4AB 1YNKL 1L7TL 3UJIL 1YNLL 2YUZA 3MNZB 1YEFH 4OFVA 4NKMB 3WKMH 2HN7B 1V5JA 5JOFA 1A3LL 4ZSOE 5HTSA 5TDOB 1I4FB 1EFQA 4FN0A 5DHVB 8CGTA 1IAII 1N6QH 3B83A 2CKBA 2VJXA 3MRPB 3V7MA 5C86A 3O2VH 3ALPA 4OQ1A 2OBGA 3MOBH 3WHXB 4F7MB 1UADC 3INUH 4PRPA 2IEPA 4N0UE 3GIVB 3SGKC 2HTKC 1HINL 1QFWH 2YWYA 3RWGA 2VLJD 1C5CL 3WXVL 5CLTA 1Q94B 3WIHL 5A16B 2R0LH 1MLBB 1MCWW 4QRSB 1FAIH 4A6YH 4GKOA 2XZAL 1XZ0B 4Q3GA 4LHJB 1TTGA 4MJID 3ME0A 3F7VA 1KEML 1Z5LB 4NN5B 5E9DE 5I8CA 3LN5B 4X8XA 1DVFA 2O5YH 3IDYC 4QHMB 5LCVL 3WL9B 1EERB 3CFJB 3ES6A 1JWUA 1GAFH 2W07A 1EFXD 5E4IA 2ZJSL 1FNAA 1QRNE 1MI5B 2XWTB 2FR4B 2HWZL 5IFHH 4YDKH 5F9WB 2HFFA 4PJ5A 5HDQL 4LLDA 3I3EA 2EE9A 2ED8A 5JDSA 1MQ8A 2A6DA 3SDDB 1HCVA 1ZVSB 1FFQA 2YOCA 4Y2OA 4OBSA 5EBWA 1MRDH 2I9LB 4YBHA 3MXWH 4M3KB 5T1MA 1IL1A 1QR1B 1NGWA 2MWCA 1TZGL 3F7VB 1NEUA 2BFVH 3ARGB 5L2KE 5I1IH 1ZT4B 3BHBB 3CX2A 3PL6A 1JWMB 4E41A 1E6JL 4YQXL 1G9NC 1FLTX 4X4MA 1DBBH 1E4WL 4MDJA 3DVNB 4UZGA 2B0SL 4ZFOA 1M0ZA 4NQUA 4K3EL 2Y36H 3IDJB 1J10A 3AAZB 5E6ZA 4KY1L 1QYGH 5LWYL 3BJ91 3BW9B 2XN9B 4WI2A 3SDAC 3WHXA 3QZWA 2J8UE 4P5TB 5ENWB 1I8IA 3L1OH 4WDIA 3H42H 4I3SH 1XIWC 1X4ZA 2HG5B 5EPMB 4K7PX 1CCZA 5DEGB 5B38G 3T0AA 2BNQB 4XBGA 1N26A 1WTGT 3QZWB 5C07D 4U1KB 2PXYD 2NQCA 3SGKA 3ULUE 5I0ZA 3K0WA 1GOHA 2HKHH 4WUUB 4F7EB 1VSCA 1S7TB 3V2AR 5K9OB 3GI9L 1FG2A 2F8VA 3MGOB 4N0YH 4PV9B 3FZUC 4FG6D 5SWSE 3QP3A 2EYSB 1XEDA 2VTFA 4PBWD 5EBMB 1JGUL 2JELH 3LN4A 5J1SC 4Y4HD 5EUOF 5CS7A 1BQHB 5CIPB 5AWNH 3ZTNH 3O2WL 1FFRA 3N0PB 2Z92B 5E6IB 5EO9B 5J13C 4L3EE 4D2NA 2ZCKL 4HT1H 4XPAL 4DGIH 3EZ8A 3IETA 5IWLA 2ESVE 4ODTH 5GS0H 4UV4H 2GW5A 5E0QA 4OF7A 1N8ZB 3RVXC 1VGKA 3MLWL 2DQJH 1TDQA 4U6XB 5DHVH 1F42A 1DDHB 1H5BC 4N0FB 4U7SA 3A6CL 2D03L 5FO8B 1MFEH 3IKCA 4Z9KB 3UL8A 4PJIA 4WTZA 3D25A 1CL7L 2R1XB 3DVGA 1JWMA 3SKJL 3HI5L 1GGUA 5AWNL 3ZTNL 4NBZB 2AJXH 3MLZL 1F8TL 1JIBA 3RAJL 4Y5VA 5KAQF 3MYJA 3V6FA 5FO9B 6CGTA 3M17A 3WNKA 1AR1D 1D3CA 2XZCH 3LQAH 1HI6A 1YYMH 3W11C 5ESVB 1A2YB 1HWGB 1U95B 1CFBA 3R4DA 5FKAB 1PX4A 3O6KH 4MD5B 4PRNB 1AKJD 4NHUB 1YEGH 4JO3H 4OQTL 3WPFA 1NBYA 4M1CD 4BH7A 4TRPH 1I3GL 1T3FB 4G9DB 1PEWA 4F57H 1LO3L 1HCFX 1IM9B 2OK0H 5D7SL 1QZ1A 4XPBL 4J4PD 1G9EA 2QQNH 2YMXL 4UINL 2YPLE 1DL7L 5F3HB 3QIUC 3VG9C 3ZE2E 3DMMC 5D2LA 3T3MF 3CSBA 3VXNB 4NC2B 3OPZL 3KLHC 3FOMA 4S1DC 3WE6A 1NC4D 3KPRD 4V1DE 3H9HB 4YBQD 1ES0A 3EYUL 4ZYKB 4BH8B 3UROR 3O6KL 3T65B 1MJ8L 4RAUB 4P3CL 1YNTB 4PJFB 4RNRB 2MQ0A 1JNLH 2CLRA 4PGZA 5JTWA 1I1AB 1KTLA 1W8NA 3SJVB 5JW5A 4KHXL 4F37F 1IM9A 2I5YL 2DM2A 5IJKC 4PJBE 5EOCH 1DZBA 5D1ZC 5J89A 1HZHH 1KPRB 1Z9SA 5T1DL 3AC0A 3X11B 1TVHA 3D87B 5JW5B 3TFKD 3W3GA 4HEME 4NYLB 3SKMB 1T6VN 3DXAD 3EDDA 4G6AD 5FKAA 2YKLL 4HXBL 3IFNL 1MPAH 5C0BE 2FBJH 3MV01 4GRWE 4PG9A 3WN4A 1LO0H 3MLPA 4MJ6A 2I60H 4XNMA 4BFIA 1P4BL 1LEIA 4NM8H 2CIKB 2CD0A 2V70A 1CGYA 4FQCL 5JNYA 3NABH 4YHZH 5DJ2A 1OW0C 4M6AA 5J12B 4F3FA 3B8YA 2VLKE 3O9WC 2DQIL 3UC0H 2P44B 3ULUA 3VRLF 1ZA6A 2JCCE 2DLFL 4WRLA 4ZPVA 15C8H 2I26N 3REVA 3V4UL 4PJBA 4QRRB 4YGAB 4XMLH 1VADB 3LPGA 4ERSL 1G6RA 4MJIA 1I9RL 2FZ3A 3SY0B 1REIA 1CD8A 3FT2B 1NDMB 3NVQA 4OF0A 4W6XB 3L7FB 4PD4K 3WIIH 4NIKB 4M7ZC 4AY9X 3DBXB 3I2CL 1G7LA 3HUJF 3E2HC 5C0CE 4CU7A 3E0GA 5TH2A 1SYSB 4NBXB 3U4EB 4P2CG 3VRIB 3CXDH 5L2KA 1KPUB 1FP5A 4TUKH 1NGPL 3GSVA 4GG8A 5TE6L 1DQDL 1MAJA 4PY7A 1D6EB 2AJSL 5ILTL 4JFXA 4PJ5D 2WQXA 2PO6A 2FATL 3PWUA 1MELA 3MRKB 1AO7A 1SYVA 3HKFA 3RVVC 3VWJC 4MA7L 3WIIL 4PRAB 4M7JH 4U0RC 4Q0XL 4XNQA 4E0RA 4X0KB 1KPRA 1M05B 2Z31A 5H2BA 4YDKL 1GIGH 2X4OB 5DK0B 1J1PL 3VFGH 3NFSH 2V2TB 1EDQA 5I1HL 4OM0H 4E0RB 1S7SB 3G5XB 3VJ6A 4HLZH 3S35X 1YECL 2NX5B 1KEGL 4QYOA 1EHNA 5T1LD 5EO1B 3D69B 2D2OA 3SN6N 1O6VA 3TC9A 3MC0A 2GJZB 3L3HB 1INQB 3I6KB 2BVQB 4G6FB 5GGRY 4YO0B 1HIML 5EN2A 5BMFL 4CUCA 4F80A 3FN3A 2MMXA 3KPPB 4MA7H 3UJJL 4JRYA 4YDJB 2FJGB 1BGXL 1GIGL 3MJ9A 2BSRA 4KWUA 2XWJB 3RJDA 5AG8A 3LQMA 2EIZA 4YXLH 2V9RA 4OLEA 3RHWF 5KSAB 3L7FA 4K3DL 4YHOH 2L0DA 3UBXG 3ZHLA 2WBJD 4GRLD 1ZVYA 4MXVF 1TETH 5C6TH 2BHZA 5CSZB 2VDQH 1K8DA 2H6PB 4YBLB 4OGAD 3MV8B 1OL0A 5B38A 4MMXC 3AXLA 3LKQB 4HIEB 4JRXB 2BP3A 3HUJE 5GGVY 5HYFA 1FBIH 1CD1A 1LO5A 1ZT7A 3MCLL 3E6JA 1HI6B 3RWEB 1L7TH 4WW2C 4KKCC 5HGDA 1NLBL 5GZNC 4QRTA 1CR9L 4QRPD 3O41B 3MV7E 3LEXA 4Z77B 2UZYB 2DICA 1BIIB 3QXUA 3MRBB 1VFAB 4R6FA 3D9AH 2JJUA 1DL7H 4XVSH 3BI9X 1JGDA 1P7KB 2D7MA 4KQ4L 4XCFH 3SE4C 5ICXB 3D39E 4JFQA 4KVCH 5IEKB 5C0NC 2NTFB 4E42B 1P1ZB 5B38B 3HZKA 3EOBB 2DWDB 4I3GA 1YYLL 2IAMA 1KUMA 2VYRE 4KDTC 1K6QL 3KYMA 4KI5D 2CXGA 4PJIE 1ADQH 4G9FD 2FLBT 4PTUA 3CLFH 3HMXA 3CDCA 1JPGB 4WW2F 5IIEA 1AP2A 3BEVB 1UT9A 1CFSA 2V7NA 1ONQB 5DWUH 1ZLSH 5J7CC 1CT8B 2V6HA 5DRWA 2XACC 3L3JA 4I5BB 5EN2B 1ZIWA 4JDZB 5K9OA 2FWOA 2P7TA 4J8RA 5KVGH 4K2UH 1FGVL 3L5WA 2XT1B 4NUJA 1F6FB 2AJZB 2YD4A 3GJFK 4L4VB 3VXNA 1SYSA 2BSSB 3RWDA 3KJ4A 3H7BA 3QHZL 5EO0B 1EK3A 1G6RL 4KQ3H 4M48H 2NY4C 3TH3T 3LV3A 1IGML 3QCUH 4JRWA 1T80A 2RIKA 5JO5B 2X40A 4MJ4A 5GGVL 4EI5D 4M9PA 3V4PH 2R4RH 2W1NA 1BM3H 1KC5H 5I19L 3BP6A 4AEIL 2EDYA 5HPOA 3WJLA 1TZGH 2O5ZL 1FFNB 3QRGH 1RZGB 4KROD 3VE0A 5EOCJ 1UM5H 4PRIE 4PBXA 4YUEL 4QTIH 4OZHF 1SEQL 2V2WA 1IEBA 2J4WH 5D7IE 3FO2B 4V1DB 3DROA 5KTEH 4L5FH 2DYPB 3Q6FB 3NTCL 3GSVB 5GS0A 4ZUSB 4M6OH 1G6RH 1OTSD 2JF1A 3U0TB 1T1WB 5HDOA 5E2VL 5SWQB 4WWID 4KXZH 2YA0A 5LGHL 3T0EC 1Q1JH 2PXYA 4OIIL 3WIFA 2DKUA 1U93B 3BDYH 1BREA 1ZVSA 3BSZL 4UU9A 4YFLF 4Z61C 5HGAB 2Y07H 4PJAE 4BZ2H 2FRGP 1I9IH 5EIVA 1KGCD 4GXUN 5IT2H 2W92A 3BKYL 1JK8A 4K94H 2WFHA 3V6ZA 1NUFA 4HUKB 1PQZB 3BGFC 4FS0A 1AJ7H 1RJZA 4TYUA 5KSUB 1I1CA 3F7PC 4U1GB 4EQ2A 3MLVL 5BZDA 2P8MB 1BVZA 4CVXA 4CC4C 2GKIA 1PY4A 1M71B 2AV7A 3THMH 5I1EH 1R3IH 3PP3H 4U1MA 5A2JH 1KOOA 2X6MA 5F3BA 1QFWI 4MS8D 1ZE3C 3NBNA 5LG1A 4ZFZB 1JZ4A 1T7VA 2NR6D 5JORB 1IQDB 1G9MC 3CXHJ 3GZKA 1HH9A 3CFBA 5K9QG 1BZ9B 2QSQA 2ARJA 2W0PA 3MCKA 2W9EH 4LGRB 2JCCB 1UJTA 2D03H 5GS0L 1NFIA 1UWEH 3ARQA 1CICB 5EBGA 2VSCA 2IQAA 3K1DA 3O11B 3O6ML 1G7HA 5DD0H 1R3IL 4MNQE 4EVNB 1RIUH 4UT6L 2LE9A 3BP7A 2LQRA 1UB5B 1LHZA 1XCQB 2F58H 4OFIA 5FA4A 3V6OC 2VDKL 1P4IL 2ATPA 2X4QB 3JV6B 3O9WD 1MIEH 4N0CC 5E8EA 4AIOA 3RHWK 4UILH 2BJML 3DUHA 5IFAH 1CGXA 5DQDH 3MOQA 3X13A 5BCAA 1JUFB 3W5MA 4YWGH 3PHOB 3QQ9C 5HPMB 1KJVB 3PP4L 3HC4H 1N3NA 3DARA 4PJ9C 4RRPG 2CUHA 3FONB 3O6NA 2HT3D 4UFRA 3FQUB 4V2DA 4QKXB 3WJJC 4KUCF 3G39A 5SWSA 4PJ7A 5D5MB 3SKOB 1TJHL 4JANB 4EI6B 1IC4H 3QJHA 3KXFA 3O9WA 5IMLA 3E4GA 1I1AD 5E9DD 2NY1D 4NRZB 4JFYB 1MAKA 1NEZA 4XB8A 2AEPL 5GS0D 3VXSE 5E94B 1MY7A 1IT9H 3KYMB 4PREB 5T1KB 3VFVA 3KJ4C 3MRDA 3QPXH 2P5WE 3CK0H 2NX5D 4DOHE 4O5LL 5HDLA 2EC9T 1R5WA 1W0VA 3PUCA 4O2FB 4OZ4A 4BELD 2NX5E 4B41A 4JM4L 1MH5B 4CADB 3BOVA 1N6VA 3AREA 3NACH 4L1DA 5EU5A 4Y4FC 1IC4L 1V3KA 4O00A 2NMSA 4BQCA 5L6YH 3QHTC 2RFXA 3DRTA 4KROC 3O6FD 5F6HI 4Z5RA 4JM2A 5C07A 3BZEB 3BKMH 4N0FA 5DMJB 1NAKL 1J8HE 1KJ2B 2KQMA 5T1DH 5LQBH 2UUDH 1OGQA 1C8PA 4OCSL 1U8JB 1W8OA 3DHMA 2F9BT 2YKLH 2CKBH 5B4MD 3MV8E 4ZMAT 5DQ9B 4XP9H 1ETZA 1D9KB 4J23A 2OTUB 2Y06H 4O2EB 5F7EL 2Y9RT 3SDYH 3S88L 3PWPB 2Q86B 2HVJB 4XCNA 2WWKO 5B39A 4PGBA 3KWWB 4KZEL 4JPVH 4YPGB 4ZO7A 5DD6B 3C8HA 3C2AH 4NNYB 2VAJA 5ACMA 3GBML 4R4BA 5GGSA 4MXQD 3P73B 4J6RH 4AEHH 1QNZH 3GI8H 3K8MA 1Z9OA 2YEZA 5CZKA 5L0QC 2W65A 2JQDA 1T5WA 2BXZA 3D39B 2G5BA 1NCTA 2BOBB 3DECA 2DQEH 4XP5H 4KFZC 3GGWA 5A3IC 3B43A 2Z8SA 3MYZA 2DQHL 1FO0L 4KK8C 5F7HA 4ODUB 3MXWL 5DK0A 5IMMA 4HGMA 1FGNL 1G7PA 3K2UH 2FECL 4Z7WF 4QY8B 4PYGA 2JKXA 4FS7A 4WTXA 5SV4A 8FABA 1NBVH 1NMBH 4NPYB 4ZSOB 5J0BA 1KCRH 4R4NC 3KPNA 3MRKA 4QNPF 1EVUA 2YSSB 3QJFB 2XKNA 4HWNA 1NGPH 2AVGA 1T89C 1D7FA 1A6ZA 2OZ4L 3MNVA 5CJOL 5D5MA 3SKOA 5E5MB 4PJ8C 5C2BL 4Z77A 5FHBL 3FB5A 4L3CA 3BVNA 1MLBA 2PNDA 2XN9E 2OMXA 4Z8GA 1YEIH 4Z7UB 5DGQA 5GGSY 4GW5B 2YWZA 3CC5A 4LU5L 5I1KH 3PHOA 3AY4C 5HI3D 4IRSA 1UCBL 2XN9D 4JQIL 2KKQA 4Y5YB 4KKNA 3LQAC 3EYVA 5F7UA 3TO4A 2SEBA 2X09A 1K8DB 4DUXA 5EIIB 2WQRA 3MJGX 5E2TL 2VXSL 2ATKA 1YEHH 4FQJL 3QWRA 4TSCH 2EICA 1T2QL 2PTUA 5TF0A 3M1BA 4AEIH 5E8PB 3KPSE 2CR6A 4H88L 3HE7B 1U58A 2GUOB 3QEHA 4MAYB 4YGVA 1FFPB 1BFOA 5FYKL 3F7QA 5TQ0H 2A73B 1QFUH 2JIXD 3I3DA 4HAFA 4S0TD 3QFDB 2R0WH 4ONHB 3U79A 3PJSA 4XVTH 1UQSB 3L9RB 4LRNL 3D3VA 2VISA 4KRPC 1WFNA 4HX1B 2OTPA 4L3EB 2BK8A 1XIWB 4DVRH 2ITCB 5B8CC 4MJ6B 1MJ8H 5GS2H 1G7IA 4ZUVB 2A77L 1P9MA 4GOSA 3VFRB 4AM0A 1JL8A 2WLZA 5F7NC 1X6NA 4ZS7L 2X1WL 1QVOA 2XOTA 4KV5F 3BEWA 1I7ZA 1NMCB 3OJAB 4J4LA 4IRSC 3FRPG 5EOCL 2QKIB 2IANB 5L2KD 2OP4L 1RFDH 5JQHC 1ND0B 3BPNB 4LL9A 4RQQA 3QDGD 1MAML 5DEZA 1OP3H 5GRXG 4ZAKD 1J8HB 2IADB 3SJVA 4JQXC 1J11A 4U1SA 3OKLB 1HOCB 1TITA 5I30L 5FYLE 1AGBA 1HHGB 4WV1C 3JTTB 5IEKA 1U93A 3ZKMD 4KUZH 3QNXB 4P2OA 1MCJA 2H45A 4YK4C 2PKDA 1G7IB 5F9OH 2IAMC 5GGQH 3N1PC 5BV7L 2VLME 2X4PB 4MMZC 4XVSL 1JF6A 2Z31D 4QRUB 4JCMA 3UC0L 3BPOB 5D6CB 4JFDE 1ZSDA 2HKHL 4Y16C 1NBQA 4XNYH 4LVHB 4U1HB 3DVGB 2NPLX 1JTTA 5DQJB 5LGJA 5DD5L 3HN3A 4HEPG 3BIBX 1ZT7B 3T0BA 3GMQB 5DVOA 3W2DL 4MNQB 5EORH 4F7PB 2WMPA 2E7CA 3RVTD 1H6TA 1ZHNB 2EXWC 2WNGA 2WIIB 5MEOA 2BDNL 3ULVA 2CDEA 3C8DA 5GIRB 3MBEB 1T20B 2PXYB 2CIIB 5IMOA 3QHZH 3GMPB 3QUMA 4AYFA 1DBAH 3MMEA 2Q76B 1MCFA 4JM2F 3E3QC 3OAUL 5DS8A 4R5DA 2XTLA 3QO0B 1JYWA 4XI5C 1Q8MA 4JHZA 3O4LE 5C0DA 3SJVE 1WFUA 2D31B 4Y0GA 1CWVA 1KTDB 1TENA 4I0PB 2APTA 2PW1B 1GL4B 3UCRA 4KZDH 1G1CA 4KKCD 2VLMD 4DN3H 1JN6A 4YDIH 4XPTL 5BQ7A 2HH0H 2IADA 2ZJSH 3W0WD 5A2LH 4DZBB 1K4CB 4L9LA 2BMKB 2NY7H 4OF3A 4GJTB 1AGFA 3U0WL 4GRLC 5BS0D 5F9DC 4XNQB 4NM4L 4QRQA 2OZ4A 1B0GB 1DE4B 3MLRL 1I7ZB 2XQYK 5KW9H 3O3AA 5EU4B 1M9SA 1YEGL 4JO3L 4OQTH 4X98B 2G5BB 1DBML 1N2RB 4KI5F 1W0WB 2AJZA 3PWLA 4OCWH 4NQXA 5AAWA 1EMTH 1FNEA 1M10B 4ZQKA 4PTTA 2N56A 3S96B 4F9LA 5KN5B 5HYJE 3DMMD 3EOAB 1EFXB 1EO8L 3FHAA 1QFOA 3X3GH 3FN9A 3H3KA 5I76A 2NY2D 4XPFL 2X05A 2YPLD 1SJHA 4Y61B 3HRPA 3OKYA 4RZCA 2X4RA 5TGBB 3BRFA 2FT3A 4PGEA 4JZJC 5IWLC 4CU6A 2W60A 5FOJA 4KGJA 4GQPH 3PGCB 5FYJE 2WIIA 1AHWA 4OD1L 3QEUB 1FE8L 2Q4GW 4GW1A 2CH8A 4JO1L 2XQBL 3C2SA 3HC0A 5CD5D 4N8CH 1ZGLA 3MV9D 3RWJB 2HMIC 3QH3A 4BA8A 2FATH 4AL8H 1WWCA 3RL1B 4QWWC 4MJ5A 3QUKA 2QLVB 2VKWA 3FCTB 5GJSL 5HVHC 1C12B 1RY7B 1BJMA 5SWZA 4ODBD 1IC5H 4KVCL 4PRHA 4FQXD 2QEJA 4TTDD 4M7KL 3FXIA 1JHTA 3HB3D 1U8HB 2VIRA 4I2XA 3RUGF 4HMDA 2A6IB 4UOJA 4AMKL 3PWVB 4U6XA 4YWGL 5ECJE 2DQGH 3PP4H 4LXRA 2Z91A 1B4JH 1MCIA 4DGVL 1SJEA 4UILL 4GBXC 4MWFA 2HLFC 2Q8BH 5EWIH 2FEEI 1JHKL 4FFWD 3PL6D 3HC4L 4YDVB 3UPAA 5D8JL 5IVOA 1AGEA 3NCYP 1GJIA 3VFMB 2OJEA 3LSOA 3RWIB 3SCMB 2A6KA 2JCCA 4JRYB 3BQUA 4QXGH 2IGFL 4U31A 4HXAL 3C60D 2F5BL 4MDIB 2R0KL 1CZ8H 1T0MA 2HJKA 3GMMA 4XMPH 3W5NA 5C2BH 5BS0A 4P9MH 5C0CB 3H0TA 4M00A 3HS0B 1QBMH 2YRPA 3BGAA 2CO7B 1PYWB 2VQTA 1IGCH 3LDBB 4ONHA 4S1RL 1G9NL 4PGBB 5ICYB 3OB0H 5SX5H 5DUPL 2FYYB 1AXSB 3MLYH 5DI8A 1PAMA 1LK2B 3DURB 1RVFH 4G6AC 4XBGB 3TA3C 1CIUA 3X14B 4QBZA 4WJ5A 3LB6C 4P46B 3ARED 2GAZA 1DFJI 4QT5A 3QYCA 3U0PA 4EN3D 4OTXL 1OW0A 4MAUH 1WCBB 1NH6A 3D0LA 4TSBH 4UOW1 4X6FB 1OOAA 4WV1A 4JLRB 1OQXA 4NKMA 3IDJA 2I07A 3OAZK 1ZA3B 4XH2A 5CLWA 3W0WE 4R7NA 4P0DA 1DS9A 4IM8A 1ZGLP 4OM0L 1OF2A 4X83A 3QI9C 1F6AA 5T33L 1IJ9A 4DVBB 1H8OA 5MEPA 1D5XB 1FNSH 5IB1A 3FAXA 3CFKB 3CVHL 4NWTH 1QLRB 5INDB 4N8PA 4PJIB 3MODL 1E4WH 2OS7A 4K94L 5FOBA 3A0OA 3C2AL 1J0HA 3MFFA 1ED3A 2FH6A 1I3GH 5D7KD 4JFDD 5DJCB 1MAMH 1NC4B 4A2MA 4X9IA 4E5XA 1HQRA 1TQBB 1P4LA 2KPNA 3MACH 4NRXA 1L0XA 3IETB 1WBYA 3ES6B 3MLTA 2YC1B 4FQ1H 5FCUL 4DN3L 5EU3A 4JJHA 4R58A 5F21B 2EXYD 1ZHBA 4DKDC 4PV9A 1NC2A 2C1OA 2YXFA 1NMAL 4JR9H 4LPTA 4Z7NE 2A74B 3BT2H 4LSVH 4NGHL 1OLZA 2OTWA 1IKFL 1QG3A 3EO9H 4JKWA 2PR4H 4HH9B 2ZOKB 3U46A 1OOKG 2R4RL 1BM3L 1KC5L 5IW6A 1CGVA 2DL2A 3HG1D 5EU7C 5F3HA 5E8EB 3SE9H 5IKCB 1LD9A 1W72A 1FIGL 2HVJA 4XCNB 4N8VB 3RVTC 1WCBA 2DBLL 3F7RA 4UBDC 4ETQB 1EAPB 4YEFA 1H6UA 1RU9H 3WLWD 5EUOE 4EJ1C 4P5MA 3EUUA 2OMUA 3HPLB 4YX2H 3LKNA 4TQEH 3VI3F 4XC1H 3SGJA 2F54A 4NZTL 2IAMB 3HZMA 4JKPL 3EO1B 4HCRL 4XWGL 3GMRA 4J3XA 3PXHA 4J0MA 1JNHA 5KSBF 3O0RL 2IALB 4AEEA 4JN1H 3ZL4L 4G3YH 1U8NA 2FL5A 4EUPG 3BZEA 3MCG1 3OR6A 2COQA 3SOBL 1U2CA 2R39A 2VAAA 3NABL 2H2PD 1HHKA 2WLYA 4GLPA 4NDMB 3DIFB 2DQIH 1U2HA 5T1KD 1RIHH 1A7NL 3QEGH 5CD5C 1FFPA 1D6VL 5C0BA 1E4XL 5D70L 4OFYD 2EZ0D 1CVSC 1KIPA 2Q7NA 3QG7L 3SBWC 2AGJL 4RMTA 1K85A 1F90H 4PJHB 5JUEL 2VERN 4ZODA 5DEFA 2RJMA 4W70A 2VQUA 2X70A 1A64A 4PRBB 3VGEA 4JVPA 1NGYB 3FQXB 5T1LB 3QSKB 3TT1L 5IV2A 3V5HA 4JDVA 4XCCH 3RNKA 3QXDA 2D7QA 2FSEB 1JHTB 2LVCA 3CC5B 5CJ8A 2AK4E 4IRJB 2AS5M 1WBXA 3BESR 1BF2A 1LVEA 4MCYA 5CSBA 5F7WC 4LSUH 2W9DH 4RWTC 1OARH 5D70H 5GS1B 3T8XA 2XA3A 4KK6D 5IFJB 4IRJA 4NKIL 4U1GC 4Z79A 4Z95H 4LKCB 4HIHB 2OP4H 4IJ3C 1H5BB 3HTLX 3STLA 1BGXH 3EDKA 1EJOL 3EYSL 1MWAL 5CIPH 3QNXA 3KPNB 1JGEA 4MSWB 3RX5A 5D71H 1NGYA 3FQXA 5T1LA 5FYLH 3JV6A 1JF5A 4JO2L 4B7LA 3TZVD 3H6JA 4L8BB 1G7PB 4PJ8B 3X3FH 1X44A 3AY4A 1K4CA 3S88H 4LASL 3GOZA 4K55A 1JPSL 5IB5B 4WYKA 1Q0XL 4ELMA 1I7TA 4WHYG 1CFNB 1LE9A 1BAFL 4RA3A 5FK9B 3VWJD 1SYVB 1UFUA 1PDKA 2Z63A 1TJHH 4OZIB 3C09B 3QIUA 3G04A 4PP1C 4Y5XC 2OXGA 1FC1A 5F1IB 5B3JF 2P7TB 3ESVF 4JO4L 4PJXB 3EYSH 1CL7I 2B1AH 3UXFA 4ZQKB 2ELLA 1OVZA 2C7UA 4PGJA 5IW1A 4NNYA 3I02B 4NKHA 3TBTA 3EJYD 5J9PA 2LTQC 2UZIH 2Z8VC 5T3XE 2XYCA 4KMTL 3PWPA 4KJQD 5CP3H 3MLZH 3MJ9L 2MCPL 3AUVA 1WK0A 3RBGA 1S7QA 5IGXL 4KRPB 4KK8D 3WNLA 1T66D 1P4LB 3RI5K 1Q38A 2HT2C 1FBIL 1JPFB 3H3PL 2RGSA 2LV4A 3CLFL 1C08B 4WHTA 5CMPA 3O6MH 3BZFA 4YHLL 2CKNA 1A7RL 5DURD 3C6NB 2R2HB 3B6SB 1KFAL 3V5DB 4OIBA 5MERA 3OGCB 1PKOA 2Y6SD 1DQJA 3UYPA 5J1AB 3GB7B 4Y16D 4HV8A 4IRSB 3LD8B 4MXQC 2E7HA 5INCA 4D0BB 3T8XB 4ZAKA 3SJVD 4GAFB 2FX7L 2YMXH 4QCIB 5IBUG 5I15H 3DI3B 3RTQB 4XPTH 5E5MA 1CI5A 4EI5B 1OF2B 2AQ2A 3VFUB 3WFHB 2UWEE 5ERWB 4Z7VA 5CZVL 5I6XC 1JJUA 3QJFA 4NP4L 4EOWH 1YEHL 4GUPA 1XGTA 2J8UF 1RZGA 5FKPA 3QG6A 1YUHA 1FLRL 2J6EH 3ARZA 5E70A 5GS1C 1U3JA 5JOPE 4TSAH 5A2IH 3LS4H 3SDXA 2C26A 5I19H 2VR5A 1U92A 1UKTA 3U7WL 1QSVA 2FX7H 3TZVC 3N1QC 1TTFA 2RR6A 3VXSD 4PB9H 5ELIA 1EHLH 3VI3E 2VDOH 3VWJB 1RU9L 5SWSB 3T4AA 1S5IH 5AZ2L 2A83B 3L5WB 1TNNA 2WWKT 4HXBH 3PMHG 1MLCA 3BX7C 2VUOA 1LO4H 2M2DA 4FXGA 3QCTH 3IRZA 5IM7B 3WO3B 4Q9QH 5HYEA 3O0RH 3ROLA 2A83A 3B2UC 3DTXA 4WY7H 3SGEH 1BWMA 4GLRI 4X5WA 5D7JA 1UWGH 3QO1A 4JG1L 3N1GC 3F65A 1V3LA 2GYSA 4UDUA 4IIQA 4K8RD 3UTQB 1AR2A 4YGVB 4BQ6A 4NNPH 4JO1H 5I1GH 1U92B 3JV0A 1E27B 4XC3H 4B50A 5DUBB 1U8MB 4P46A 4PJEA 1MREL 4K3DH 3FQTB 3T0DA 1QPXA 4KK5D 4D0CA 4ODHL 4ZXBC 3O4OC 1XGTB 4PEQB 3BISA 4MXVE 5BZWA 1VFBA 5ALBH 1EGJA 2XTJC 4XP6L 5BV7H 4XVUC 5DUMH 1NFDF 2WUCH 4Q9CA 3WUZA 1ES0B 2GITA 5KVDH 1PKQB 1DUYB 3MREB 3W9EA 2NNAB 1UEMA 4IIQC 1AO7E 1G0YR 2G75A 4FQJH 2CRMA 4C83A 1O7VA 5EU3B 1P69B 4JFZL 2NLJA 3NFPA 1OGAD 5EOTB 4L3FA 4GW4B 5ILTH 2ADGA 3TCXA 2ITDA 1T1YB 5JPMB 2VL5B 2YPLB 4WUKH 5H94A 4ZD3H 1SJEB 4WEBH 5EOQL 1BD2E 2MPAH 1DEEB 1QBLL 1NMCC 2XZCL 1MHPL 2HJFA 4HS3B 3O3BA 4XPHL 3EYVB 1K2DA 3CSGA 4N1HB 3FHQA 1N7ML 4LSQH 5DHYA 1A9BB 2DQDL 1RJLA 2BNQD 3WPCA 3GSNB 4M02A 3STZB 3HB3C 1AKJA 1ORSB 4P5TD 3CLEH 5I8OH 5E2WH 3DIFA 2QSVA 5DUPH 1FG2B 2NY3C 3DPBA 2M26A 3FFDA 3VD3A 1YEEH 1HQ4A 1MCOH 5JXEC 4WHDA 4XHQA 1BZ7A 4R3SB 4G6KL 1FG9C 4QYOB 2Q3AA 4ZOCA 3DO7B 2VDPH 2IBZY 3KPRA 2FJHA 2EIDA 5TQ2H 5ADPL 4PRID 3MV11 4Z7UE 1G84A 5FTTB 2VXUH 1UB5A 5FA4B 3SE8L 2ZCKH 1DLFH 4CNIA 5L7XH 5DR5L 5IB2A 4LVNC 1FQVA 2R56L 1LEKA 3O4LA 1F11B 2ICEB 2HVKA 2XN9A 3BW9A 4ZUUA 4WFFE 3SB4A 2GHWB 3CCHB 4AENA 5F97E 1MHCB 1LD9B 1W72B 3QB7C 1SJHB 5IBTH 3NZ8A 3JV5A 3M18A 5HZLB 4HFUL 4QXWA 5IB4B 1DSFL 3IDMA 2AV1B 1T7XA 3TO4C 5HGHB 1T1XB 5DVMA 4U7MA 2BY2A 5D96B 4KI1A 4LGSB 5FECA 2ED7A 2GJZA 3L3HA 3WS3A 3P4OA 4NJ9L 3RKDC 4X4YA 4OZIA 2X10A 1OSZA 5JLZB 3L5XH 4HK0B 3MRCB 5EU4A 1NAKH 3X12B 5L2JA 4CAGA 4IDJL 2WIMA 2YD3A 3OQ3B 2DQFB 1LEKB 3L3KB 1GHFL 2A6JB 3HUJA 3QUZD 4JKMA 3EFFB 4WCYL 3O3BB 1OSPL 2P8MA 4NQDE 4WI8A 1GRWA 2EKSA 3BQUD 3G08A 3GEWB 5I15L 5KSUA 1NC4A 1RUPL 2XQBH 3HC3H 4LLQB 2WWMD 4LPYA 1I1AC 2BCKB 2DYPD 4UV7H 4HKJB 1EO7A 2IANE 4X5XA 5DVKA 3FTGB 3PIQB 1FPTL 1F4AA 5E08L 4NN6B 5EC1B 4JM4H 2FBOJ 4UQ2A 5BRZA 5INDA 4KROB 5F89A 4PGCB 2QADC 3L5XL 2HWZH 3FQWA 1FV1A 1UXWB 1TFHA 1INEL 4QOKA 2VKXA 5DA0B 3VRIA 4HZAA 2ZSWB 2BVOA 4K7PH 3D5OF 2NY0C 2Y5EA 3RZWA 3QUKB 4L4TA 4XPBH 2EE2A 4XBEL 1S9YA 3KYKL 5GGRB 1P9AG 2XRAL 1N3NB 1CXIA 1Y6NR 5C6WH 1RJLB 2K1MA 5DMKB 2V2XA 4LSSL 3MTRA 1C5BH 2G2RA 5GRVK 1RZ8B 3KHOA 5I75C 2IPKB 2NW3A 3Q5OA 4Q9RH 4UTAH 1LK3H 4RBPK 4UB0H 1R5IA 2V17H 4WWKC 1VDGA 4LSRH 4G8IB 3U0PB 4Y19B 1P6FA 4G5ZH 4KRNA 5JHDB 1U6AH 5KG9A 4FQHA 4YXHL 3KR3H 4FD0A 2OL3H 2GJ6D 4HIJB 2VXQH 5EBMA 4IS6B 3UL7A 4NCC2 1ZLVH 1C5DA 4KY1H 4ZOEA 3ZYJA 4DK6A 4LQFH 4MAYD 1MREH 4XXDB 5HYQA 1YRGA 3CU7A 1RMFH 4MQSB 3IDNB 5DMIH 1TVBB 1KB9K 1INQA 3I6KA 3MJ6A 1O7SA 1U3ZA 4K71B 1YECH 1VEMA 4MDIA 4NQXB 4YEBB 1GZQB 2UWEB 4XAKE 2FBJL 1EUUA 2QBWA 2EEBA 1IGFH 1JNHB 3SKMA 4JRXE 5JXEA 3ARFD 3O4LB 2BNQA 1KXVC 3TT1H 1IRAY 3OG4B 1YEJL 4WHCA 4AEFA 2DIBA 4RAVB 3UBXI 3DVIA 4BZ1H 1V8HA 5D7IF 1ED3B 3DV6B 2EYTA 5B3JE 5LVEA 4L8SA 1RZFL 2BRQA 2A0ZA 4Z7VB 1NKOA 2B4CC 4PRHD 5ICXA 5D7JD 5C92A 4AM0B 1KTDA 2Z35B 1WVZA 3I2CH 2I27N 4Y1AD 4Z7QE 3MLVH 3O53A 4FXKA 4GRLA 4POYA 2YD8A 3R8QA 4MCZB 1K8IB 5DA4A 5MHSE 3L1OL 3P30L 4Q6YA 3WE6B 1B4JL 4UTBH 1VPOL 1JTOA 1ZHBB 4WW1B 1OGTA 2XY1A 1F6AB 3MMEB 1DJSA 4N1EA 4G43A 4F58H 4FZ8H 3NOIA 2AV7B 1LO2H 1QRND 1K5NA 1CE6B 3QQ4A 1NCNA 4UT9L 3GSOB 4XH2B 3PE9A 4CN1A 3FO1A 5J3HD 3CFCH 4X5XB 2APBA 1WF5A 1WC7B 4FP8H 2R8SL 3PGDB 3GMLA 4F9PC 5D72H 3TPKA 4TVPH 4HS6B 3P9MA 1Y0LA 3WHE0 1IMHC 5D7LD 2NY4B 2VDRL 4P3DB 4HWBA 4XCYA 4RAHA 4C59B 1MFDL 4C57C 4ODUA 4XNXL 2B2XH 3CFJA 3RIFF 3W3KA 4ZUWA 1KN2H 4NQDB 3GSXA 4WTZG 1DLHA 5JW4M 4M61B 1WLHA 1OGTB 5SWZE 1TVDA 3MYJB 2XNAA 2OXHA 3W9EB 3DX8B 4LSVL 1L0QA 3U0TA 5C0FA 1U3HC 1TZIB 4G9FA 1LEIB 4MD4B 4K3GA 1I9JL 1Y18B 3OKMA 1A7RH 2H2PC 3IU4H 4HC1L 1LMKA 3OGCA 5BZWB 2YRZA 4BYHA 4N90E 3GIZL 2CJUL 3FQRB 1KIQB 3CJJA 3GM8A 4G80B 1E4JA 1OAXH 5FK9A 5HJ3A 2VZVA 4Z0BH 1KLGA 3FB6B 3OPZH 5KVGL 3QI9A 1FGVH 5EOQH 3INUL 4F33B 1PG7X 1KTLB 3WV0A 1HHHB 4XPHH 4JPKL 2AEPH 5CMAA 1AO7D 3GHBL 4UDUB 1KTRL 3MRLA 5AZ5A 1TPXB 4K94C 2B39A 4C4KO 1J05A 1BBDL 1YQVH 4YAQA 2P8PA 3GJFH 1JF1A 4H1LA 5GGSB 3BRDA 2NZ9D 2VL4A 4CW1A 5JHDD 3LRHA 5T3XL 4LFHD 3VWKA 3PWJB 3QFDA 4W4OC 2FJFB 3LMJL 1HXMA 5DFTA 1SEQH 3L3OB 5T1MB 2IH3B 5I18H 3MACL 1YEDA 3IFNH 5JW4R 1I8MA 3TFKC 3VFNA 4GXUM 3BKCH 1IQWH 1CR9H 4JPKH 2HH0L 5FF6A 4YE4H 5IV2B 3MSPA 4FFVC 3BQUC 4L8BA 5IYXC 1YUHB 3NCJH 2XIDA 1DN2A 2G9HA 1IGTB 4XPGL 3HG1E 1A22B 3K8KA 3VH8B 2FIKB 3ZT6A 4ZPTA 4I9WD 1NCCH 1IAKB 3SQOH 3BKYH 2XI9A 1I3RA 4WUUE 3OAUH 4YBQC 3MR9A 1R3LB 5F44A 1V7NL 1Q9OB 3IXAB 4R2GD 1XAUA 1S7WB 4ZAKB 3BP4A 4RMSA 3SKNB 4DKEH 4BV4R 1UZ8A 5E8NA 1ZHKB 4C54A 1XGQB 4CNMA 1A4KA 5IQ9B 1WITA 2ADIA 1A6UH 5I8EA 3MRIB 5BO1L 3ARDA 4G6JL 2R9UA 1E6OH 3WDIA 1CD1B 3M8OL 5DVLA 2XQYG 1IGTA 3D6GA 3AM8C 5IMKB 5ITBL 5D1XC 2ZUQB 4LEXL 4CGTA 4NM8L 3MJ8A 1RUKL 2E6JA 4MD0A 2H26A 2V7HA 5E03A 3LVEA 2DBJA 2EYRB 4RA0C 3MJ7A 5C0IA 4JHBA 5LBSL 3QIBD 4OFKA 3B9KC 3ZYIA 4Z7NF 4J1UA 1JWSA 4ZUTB 3UTSA 2OR9L 1A6AB 4XVJL 3ULUD 1QFHA 1ZK9A 4M1DL 1FAKT 5AZEL 3GHEH 5GJSH 1AD0A 2YD2A 4EBQL 3ZSSA 4MGXA 4PUBL 4MLSA 3BRGC 1H3UA 2O5ZH 3S3JA 1SJVA 4X99B 3RGHA 1IC5L 3C6SA 4YIQA 1FIEA 1GCFA 3G6AA 3JXAA 2JB6B 5CILH 1EXUB 3MZGB 3E3QE 3NTCH 3EO9L 3LEVH 3BKJH 3ARUA 4DOHB 3D0VB 4KH2A 2H32A 2VWEC 4M6MH 1YJDH 4Z0XA 2CLVB 5IBLC 1EAPA 4OGZA 5D2LF 4CMHB 2XTJE 1KFAH 5C2UB 2BFVL 2MCG1 2J8HA 4WO4A 2KZ1B 1KIQA 1S9WB 3MROA 2GCYB 4U1JB 4R3SA 4WI3A 1E6JH 4JM2B 4JY6B 2NW3B 3FJTA 2WP3T 4AT6B 1IVLA 5E6IC 3MLXH 5J8OA 3TF7C 4IOSD 4JFXB 3MV8D 5EUKA 3I3BA 2VITB 4MD4A 4IRZH 3SPVA 3ZE0F 4TTDC 5GMFA 5DO2D 1ULVA 1L4IA 3OHXB 4G8GA 2IG2L 1F4XL 1FV1B 1UXWA 3V4VH 1BLNB 1MCBA 3MRNA 1RHHB 1YY8B 3CIGA 3R06B 2R0WL 3EYQC 1JTPA 4X6CA 2PXYC 4PG9B 2I9LA 2NXYC 2UVEA 4RFNC 2VWEE 4DFHA 4JDTH 3RW6A 3ZKMC 1JPST 2QQLL 2YSSA 2VLKD 2NW2A 4L29A 1RZKC 1NLBH 4O02H 1R0AL 3KYOA 4FHBD 5E7BA 5GSVA 5I8KL 4YDIL 3VXUA 4MNGA 3SE3A 1YN7A 2RB8A 1X3DA 5H94B 1X6LA 2ZCLH 4DGYH 2DWEB 1MI5A 5L88L 3IDGB 2WBWB 4RGMB 5HBBA 4LHUD 5FHAH 4NFBA 3UL9A 4HPYL 1UWEL 1KYOJ 1F3DJ 2E7LC 2IG2H 4LMQE 2IPTH 1Z3GL 1KPVB 5EZIL 4CBPA 4DN4L 2BJMH 1T7YA 5FM8A 5F7LB 2I9TA 3O81A 1Z6JT 3QCTL 4WU5A 1ZMYA 4FFZH 4GQ9L 2RAMA 3K7UA 4PR5A 5C08A 4S1RH 5KSAC 4LCCB 4B5EA 4JQVA 5D7LA 1FZJB 5IVZA 4M7ZB 1SVZA 1CLZH 4MX7B 4IS6A 2Z7XA 1HHGA 2K7QA 3PDOB 1X5HA 4AENB 12E8H 5FHAL 5DWUL 2AJ3B 3BD3A 1ZLSL 4M1CC 1JFQL 2QR0A 1I3VA 5GHWL 4Z0XB 1KB5B 2OI9B 1XR8B 3HR5A 3T1WA 5CBAB 3F12A 3BPOC 1IT9L 3IGAA 3ULAA 4N68A 3TT3H 3L3GA 1L9NA 3C5SA 3W9DA 1EXUA 3PDDA 2VXVL 4O58L 3MCKB 4Z94G 3FL7A 1X5ZA 1VB9A 5KZCD 4HH9A 4OUUB 4Q9RL 3HS0A 3CFIC 5SWZB 4NP4H 1QSFA 3M19A 1W2KT 3VGAC 2D9QB 1C12A 4NCDA 3KYNB 1AI1H 1JHLH 1RD6A 2F5AH 5DTFB 2DS4A 3GJEB 4OZIE 3ARBB 2OJEB 3SCMA 4PJ9D 2DDQH 1A4YA 4U6HB 1BOGA 2R2BA 5ID1B 4PTUB 4Z0BL 4KAQH 2XV6B 2DWEA 1KELH 2GSIB 3OKKA 2V9TA 3JWOH 2OMBA 3GSNL 1WZLA 4D8PB 5CBEA 4OF8A 3TIEB 5JPMA 4QF1A 3C5JB 3FT3A 5J12C 4Z7WB 5I17B 2AJSH 1QEWA 3DX7B 3QQNA 1TIUA 3VFWA 1FNGB 5I1IL 3QUXB 3GGWB 5D1ZA 4R8WH 5I71B 4GW5A 3I9GH 4KJWD 5E2WL 3W82A 3WL9A 1D5XA 5FGSA 5JZ7D 3MUZ1 1T2QH 3ARBA 3WFBL 3BT2L 2DDQL 2DLEA 4R96B 4LHUA 3V4PL 2R2CA 3BPCA 3LS5L 5EA0H 3VFOB 4JFPA 5L8JB 1OP5H 1QPPA 4YEEA 4R6AA 1RUMH 5HGDB 1QFUL 3R8BB 2IMNA 2V5SA 3GSNH 1OB1A 2F53D 3GIVA 1IO0A 1D0BA 4OGAC 2F15A 3U1SH 1MPAL 3W9DB 1XIWD 2EKSB 3NCCB 3G08B 1VEPA 5CCKL 3HCVB 3GSUA 4KTEH 3HUJB 3VFSB 1B4RA 1WFOA 2BSRB 1D5BB 1RZJL 4L4TD 5HHVH 2WQ8A 2AK1L 3CVIH 4N9OB 3B9EA 1FZMB 1LO2L 1DQLL 1AO7B 1OSZB 4JFOA 4Z5RB 5C3LD 2F53A 2AK4A 4KRMB 2QJDA 1PVHA 1T03L 15C8L 4P57B 3CX5J 5K33A 4WO4D 1DVFC 2J88L 1N5YL 1INDH 1HSBB 4XAWH 2AV1A 2VDNH 2VB5A 3OV6A 5J6GB 4RIRB 2XZZA 3UTSB 4NJAL 2V7NB 1DBKL 4Z18A 3P9LB 1MCCA 4XCEA 2X89D 4XOSA 1RPQA 3VD5A 3B8SA 3GMPA 2OTUA 4N5UA 3MRGA 3GUTA 3GSQB 1F4HA 3VFTB 5DRNA 3QUYD 5ANMA 3CFEB 2X1OA 5JW4N 3C5JA 2H26B 1RUPH 2V5YA 5DRXA 2B4CH 1VFOA 3IDXH 4GMSH 1U8JA 1MJUH 5FB8B 1OTTD 1ADQA 4OV6F 4M3JA 4XCCL 4RWYL 4X7SH 2EZ0C 5E94A 2NTFA 2E6QA 4PGDA 1T04A 3QT2A 2ADGB 4R6JA 4MYWB 3RAJH 2AXJA 4MDJB 5FUZH 1RULH 4X4XB 5FYLD 3DRTB 3UPRB 2HT4C 1MVUA 4YHNB 4JFPB 1Z5LA 3HE6C 4LRIA 1AXTL 4LNVA 4K9EC 1CFTA 2AJUH 5C0FB 1Q9OA 3IXAA 3QNYA 2NZIA 1X7QA 9CGTA 4PLNC 4LLMB 4HPYH 5MP6H 1XFPA 5F9JA 3NZHH 5HY9B 1QKZL 1BX2A 3MJ9H 1CLOH 4ZFOL 2VDMH 1G6VK 3BZ4A 2ADFH 4G6FD 4U1IB 3C6LD 5IJCA 3IGAB 4UINH 4QRRA 1T1YA 5DJ8A 3TYFA 1MFNA 3QDJE 1A3RL 1X5XA 4RAVA 3L7EA 2RCSL 2CDGB 4NZTH 1I8KA 1NANH 2C4XA 1CDBA 4MA3B 2H3NA 1E4XI 4G43B 3SO5A 3OF6D 5CFHA 3GI9H 2WBJA 4HS8L 5MEQB 3G9AB 3SOBH 3TBTB 2Y5TB 1XF5A 2P1YA 4OLUH 4WEUD 2AXGA 1J0ZA 1OAYL 4B7IA 5JOEA 5F1SA 1CXHA 3CX5K 3JWNC 4IMLA 1JWSB 4ZUTA 3VCLA 4UNTA 3RIFK 4P2RB 3CU1A 5FO7B 4U3HA 3JUYA 4QO1A 1L7IH 1H0DB 5I2IA 2P1NB 3GSWA 4MXWL 3RU8H 1EO8H 1Q9KB 1ZEAL 3UX9B 5JA9A 1I1YA 5D6DA 4BH7B 4U6YA 3QWOA 5BVJB 3KVQA 2PO6D 3UYOD 1R5IB 3CZJA 3F62A 5EIIA 2OX5A 1MWAB 4FXLA 3QUZC 5E56A 3DO3A 5DHXB 4GG6F 4JFED 3WYRA 1SEBB 3WN5C 5EIQA 1AQKL 1A7PL 3VD7A 3BXNB 4R97C 1HE7A 3ULVC 5GZOD 3H9HA 4KMLB 4RMQA 1A6UL 5F7DA 5BO1H 4JFEE 4OLXL 2VOTA 4CN4A 2ED9A 4RMUA 5MHSD 1F3JB 4HZLB 3DSFH 5EBLB 4QGTA 1BQLL 3CFCL 3H9YA 2JLLA 4Y4KB 4J4PA 3BN9D 4JPIA 5GRVL 3SDCD 5IG7B 43C9B 1NKRA 5JHLL 4ZPTB 4XCYB 3WNMA 4OCMC 2HFGL 4P2OD 3D2UA 3KPQB 1IEHA 2VLRB 4IBLT 1XGPB 4TNVF 2X5PA 4NQTA 1UH3A 3OKEB 4A6YB 4Q58C 4P4RA 4ALAL 4TULH 3CFEA 5A2FA 4G8EB 1B88A 2Y72A 3RVWD 5FUCE 4D3CH 1EGJH 4KXFB 1BFVL 3ZDYE 5IOPB 5E2UH 3FB8B 1WAAE 4FQ2L 2HLAA 4U49A 1J0JA 3OHXA 1UVQB 1VA9A 5I1AB 3UBXA 1N0XL 2CIKA 2D7NA 1A6VL 4MZ2A 2X4PA 1OD7A 2C7UB 5D1XA 5D6DC 4PGCA 5D7JC 3KPTA 3OAYH 5DD3H 1EBPA 1F3DH 1DBJL 2DIJA 3BMWA 1CICD 2JK5B 5GGTL 3IDMB 1DQJB 5HI5C 4OT1H 4HIXH 4GT6A 1ZA3A 2Y36L 3QQ9D 4P49A 2X7LB 3DV6A 4LCWA 3FN0L 2EDKA 4U1KA 5CMAB 4IMKA 5ITFB 4UIKH 4ZS6D 3OJ2C 2F8OA 2VDNL 2H32B 4WEBL 3RA7L 3AFLA 4WJ5B 2O93L 4L5FL 3VI4F 4RFOH 1QBBA 4JEGB 2AGJH 1CDCA 3EYQD 4Z7WE 5EC2A 1S5HB 3O6FA 1YQVL 3FZUD 3ARDB 4FG6C 5LGHH 1ZLUK 3J7HA 5F8QC 3X17A 5E6YA 4Z76A 5JHDE 3DX6A 2BOCA 2DQTH 1T22B 2JK5A 4U4BA 5TPWH 2DKSA 4OI9A 4C56D 2C3HA 3OZ9L 5IFJA 3L3JB 3ZT5A 2F19H 2BY3A 3RL2A 3TJEH 2AXHA 4LI2A 2PCPA 4X80L 4YPGA 3OBAA 4LSTH 5SX4I 1U3HD 2RHEA 3RA7H 4LSUL 1MCSA 5HHOA 2VO5A 4P5KA 2R0ZH 2BY0A 5L88H 2ICEA 1YYML 1S7VB 3V7AG 2K3TA 2X1PA 2EIBA 4YC2C 5J56B 2HYMA 1B2WL 3DOSA 1EJOH 1U9KA 3IB4A 4FHOA 1G6RB 4MJIB 4ONOA 2DQJL 4M7KH 4HH8A 3GMOB 1UKSA 1NGQH 2HTLD 2WW8A 4JGUA 4HG4K 3ULSB 3CH8A 1BVKA 2NXYB 3VU2A 5E1AB 3HNVL 3ZKSD 3PABA 5IROA 3JWDL 3TNMB 2ZUUA 3IU4L 2D3VA 43CAA 3TBVA 3CLEL 4HCRA 4ZFFB 5EBLA 2R4SH 2ZSWA 2VDOL 4KV5E 3S8WA 4PY8I 5CEZL 5GS3A 2UZYA 1H3WM 1R6VA 2MQCA 3W39A 1CZ8L 3MR9B 4RX4A 4XMPL 2P8PB 3RL1A 5AD0B 1UXSA 3D25B 5D2NC 1A9BA 5IEHB 2OR8A 1B6DA 1NEZG 4G7YH 3QXDB 1ZTXH 3CMGA 3RWFB 4WENB 4MNHA 1ZT1A 5FAAA 4D0CB 4KRLB 5J1TC 2ZUWA 4OGXL 4I2XE 2X4NB 5DSCB 3F58L 3CXHK 1ITBB 4X0KA 3RGXA 4WNQA 5DJAB 1J7VR 3QNZB 2BNHA 2IANA 4NBYB 3WFZA 4DCQA 4PP2B 4NWUL 5IVXB 4EUPA 3QUZA 3ALWA 5KVFL 3IFPA 5ICYA 4F8TA 4FQIH 5CUSH 1TJGH 1EV2E 3N9GH 2OQJB 4X6DB 4JKPH 5FDWB 1CGUA 3F5WA 1U8LB 4R7DB 5B0TA 1CXFA 1J8KA 1UM6L 2FO4A 5FYKD 3RWGB 5ADOL 3WEXB 1SBSL 3O6FB 5FGBA 3RKPA 1HYSD 2EEAA 5F6IB 5F3BB 5GMGA 5E99L 2DN7A 3HG1B 3PHQB 2YK1L 1H3VA 4O5LH 2CUIA 4U1LB 5HHQA 3SGDH 4OLZL 3NMEA 3QDJB 4HQQH 4KHTL 3LRSB 3ARBC 2YPVL 3T0WA 4KI5C 5ISZD 1SY6A 4ZDHA 3KR3L 3MV7A 3NIGE 3PWUB 4M93B 2H1PL 5FV1L 3C08H 5EFIA 5JR1L 5H37G 2EDFA 3MUY1 4LVEA 5GGUB 1IQDA 5BJTB 1UXSB 2DQUH 4X9BA 4YC2B 1S9YB 1YPZB 5CGYD 4NN7C 4OIIH 5DMIL 5CP7B 1WISA 2XRAH 3EJYC 2EXYC 25C8L 4JQVC 4I0CC 1O0VA 4BQ8A 1S5IL 1V3MA 4R09A 5EG6C 4ZFGL 1LDPH 4P2RE 4XX1G 1W0VB 3UPRA 3QR2A 1GH7A 1DBMH 3B3IA 3GRWL 4JY6A 5MERB 4ECNA 4Z64C 3IXTB 1FVDB 3KPMA 4HS6A 4DUWA 5JPNB 3OKKB 1AY1L 1JPFA 3T3PE 1YMMB 3V6ZB 3BKCL 5JR1H 4LP5A 43C9A 5IG7A 1OY3B 3TIDA 5KVEH 5IJVB 1YC7A 3NFSL 4NO2B 1S7VA 3O9WB 5IMLB 4U1LA 3AU1A 3FO0L 3MRGB 3KJ4B 3RWDB 4I18B 3TBSA 4AK1A 4KKAD 3ESUF 2PN5A 3BE1L 3QHFH 1RUAL 1PKQA 4RFOL 2E3VA 3P72A 4ZS7H 4NOBA 4AIZB 5FYJD 4I9WE 4FQQA 3QDGB 2V9QA 5KOVC 3ARFB 3O4LD 4H8WC 2YBRB 1IGMH 1ZVHA 2A38A 1EEUA 2IAND 3MRRB 1RV6X 4WO4B 5B4PA 5KVEL 3IU3B 2H2SD 2ORBH 5IIEB 3MZTA 3U9UA 1N59A 1RK0A 5D1QD 3LB6D 4ISVB 1SY6L 3L6FB 1VERA 5B8CB 2AJ3A 3RW7A 1LP9E 2CGRL 1A21A 5D1XD 2IPUK 4ALAH 4LVHC 1XH3A 4NKOB 2VLKA 5IQ7L 2OCFD 3MRFB 3NH7H 4L4VA 1UEYA 2LU4A 1P7KA 4LU5H 5I1KL 5J9PB 2DJUA 1FVCB 4HULB 4EDXA 5C0EB 1ZOXA 3OAZH 4LSXC 4UTBL 4F15B 4YFEA 1GOGA 3LIZL 5DMYA 5BMFH 4DZ8A 4R96A 3WPDA 3KNBA 1B0RA 3KG5A 3VXOB 3EDEA 4PRPD 5HHPB 1MRCL 1QSEB 4LQ1A 2ARJQ 4ZNEA 2AEIT 3RI5F 4G42A 5I8OL 5F70A 4N0RA 5CJQL 4R6GA 2ZCHL 4OCXL 1CLYH 5DD1L 1RK1B 2HTKD 4LKXA 4GBXD 3V6OE 3BDBA 5DJDB 3REZA 3RTQD 3QA3A 3S37H 4ONGH 2GT9A 5DFVD 1HDMB 3OJDA 2AERT 1KCSL 5MENA 1T21B 1U3HA 1U91B 2DKMA 5SWQA 3L3OA 3ZO0A 4ZOAA 3LS5H 4G8FB 5A43C 3FQWB 2NNAA 5JQ6H 3WS3B 4CU8A 4Z7OE 2VITA 5K59F 3CVRA 3DV4B 1SM3H 2W9EL 2FHCA 3UZQA 2VAAB 4YK4B 35C8H 4RCAB 3S5LB 3T4YB 1G7QA 1NGXA 3T1FB 1YPZE 4HDIB 1YDPA 4WEMB 1H3PL 4GW1B 4U1NB 1VGKB 3RTQC 5ID0B 3WNOA 1JYXA 2DAVA 4K23L 1HN1A 4H1LG 3RWCB 1J8HA 2A9NH 3RGVB 3L6FA 3MRPA 5EPMA 3MLRH 3MRQB 4Y5YC 1P4IH 2VDKH 1U8MA 3WN5A 2NXZC 2UZIL 1R0AH 1ACYL 2DJ4A 3BPLB 3SDAD 3EW3B 2Z92A 5EO9A 1PKQE 3QUML 1N6QL 1EMTL 2PYEA 1YY9D 3FQRA 3BEWB 1NFDE 4NQCE 3HAEA 1YMME 4IMLB 1AFVH 3HC3L 1XGYL 4XP1L 3KDMA 4KHTH 4NKGA 4NQCD 2P47B 3N1MC 4WIQA 4MB3A 3A79B 3HI5H 2W0FA 1MHEB 1XGRB 3L3DB 4WU5B 3V8OA 3QIUB 1NUDA 3MOBL 1LEGA 2XNAB 1WWAX 5CHNA 2OMVA 4OCLC 1S5HA 3CVHB 1OAUL 4X98A 3SQBA 2VLJA 1E6OL 1I7TB 2VR9A 3TJHD 3VXMA 4NRYA 3RWHA 1G0DA 3WN5B 2F54B 5F1OB 1DBAL 4R5CA 4Y1AA 3M1BB 2QQKH 25C8H 4WDIB 3ZMRA 2DWDA 4JFFD 5LAXA 3DETC 5I1LB 2YPLA 3JV4A 1U8OA 4FDWA 5HJ3B 2R69L 1FL5A 1JN6B 2YN5A 4FQ2H 1S7RB 4R4FL 3RFJA 2IF7A 1NANI 4NUGL 1T6WA 4XXCC 1E4XH 4OZGB 2R2EA 2V5RA 2OTWB 1F90L 1W72L 3CFKA 1EHLL 4R0AA 5DJ2B 3MRNB 5KSAD 4GRWF 1A6WL 4X6DE 5CGMA 1SBBA 3EYOA 5GRUH 4QRSA 3KAAA 2CLZA 3BWUC 3U7WH 4S0SD 3VQ1A 5INCB 2R1WB 1T21A 4JZNB 1IAKA 1IGYB 3D3VE 4AG4H 1CTOA 4K3JH 3DXAA 4PPTA 3S5LG 4C2BB 2P1PB 5ITBH 4P3CH 2XXMB 2ZNWA 1I9IL 1E28A 2W0KA 5GGTA 1F2QA 1KJ3L 4JLRA 1CG9B 1QSEE 2LABA 4XP9L 4NUGH 3PGDA 5DJXB 5TE7L 1AJ7L 5EU6E 1PSKL 4RISH 5KS9A 4PJHA 3F6LA 5F7EH 3C5ZA 4X6DF 5LWYH 3HA0A 1T83C 2HT2D 5SX5K 5HYIA 5LGJB 3RWHB 3SDCA 2DMCA 3OJAA 3EOYG 3TO2B 5I1GL 3GJEA 4QHLB 2NXYD 1FDLH 4X5WB 5IB1B 3BDXA 4OFYA 4JG0L 1BECA 4L4JA 3QISA 4P5TC 3U6RA 2GK0A 4BH8A 4KQ4H 5E4EB 4MB4A 3QXVA 4L3EA 2P24A 2IAMD 2VLLB 1QSZA 2WAHA 1N0LA 2HP4A 2Z65A 3UYRH 1U8NB 1F58H 1FE8H 1I7RB 1ZS8B 2P5EB 3TBYA 3JTTA 2AJVH 2IBZX 3VFMA 2H3NB 1ZEAH 4HIJA 3GO1L 4M7EC 3QEHB 2NY0B 4GSDH 2FD6L 3VXSA 1IGJB 3F12B 4F7TB 4WU7A 3HNVH 1NBYB 5BW7C 3UTTB 1B3JA 4M5YH 4CMMB 1H0DA 1OP3K 3OKDA 2YRLA 5I2IB 4HBCH 4V2CB 3I85A 5JIPA 4NHCL 4KMQA 3V52L 1P7QB 5HI5D 3EYFA 5IKCA 5HGGS 3U36A 4POZD 3P77A 2UWEA 4WWKB 3CH1A 1T2XA 3PWNA 4GRMB 4P2QD 1X4YA 3WXVH 1D6EA 3QHFL 3FKUS 1CLOL 1MFDH 3F5WB 4QRRD 4U33A 2BSED 4OZIF 3DV4A 3P0YH 4Y5VB 2AABH 2VMFA 3MX0A 5TF1H 1S3KH 5HYJD 1FO0A 2FD6H 4GSDL 1PEZA 1A1MA 3TO2A 5TE6H 4YHNA 5F8RC 4BSSA 3G5ZB 4X7EC 3HE7A 2BNRA 4OF5A 5FO8A 5BOZG 5E4EC 3P4MB 1FYTD 1MUJB 3KPLA 5D1QC 5EUOB 2FZ3B 3SY0A 3ZE1E 3A6BH 4ODSH 4FFYH 4P2OC 5CBEB 1IAIH 2PUQT 4OB5H 4DAGH 1Q9LB 3RY6A 4PJEE 1LP9B 1F8TH 4LOUC 3DRQA 1JNNL 1WC7A 4LEXH 3D9AL 4P4KB 1ODAA 3LEYL 5F96L 4JY5L 3TPUB 3CMOL 4R26L 3KPOB 4D3CL 3T2NH 3DXAB 2YD7A 5D2NB 5FYKH 5C0RL 2VIRB 4HPOH 4QTHA 1RAMA 5I1CH 4PSJA 3NAAL 1G9NH 4YZFF 4X7SL 3G3AA 1ZLWK 3JTSA 1A3LH 3KS0H 2JJWA 1L6XA 4A2LA 5BXFA 4GBXA 5ETUB 3BUYA 4P59L 2Z4QB 2GSGA 4HWBH 3MRMA 3O2VL 1WZKA 1MJJB 1U8QB 3P3YA 4NSKB 4K3EH 4LQFL 1LE5A 4HQQL 3TESA 2MHAA 4PJHE 5DT1L 3MV7D 1FCCA 4E9LA 4OCRL 4WHTB 1NDGA 4LSAA 5CJXC 4IRJC 4KAQL 3QEUA 5D9SA 3BKJL 3UO1H 2V9SA 4LSDA 3CD4A 1KIUA 1QSED 1AQKH 4G6ML 1R24A 1VGEH 3MXVH 3TH2T 1I8IB 1VCAA 1NCDL 4P23B 3BWAA 2ZUTA 5C0ND 1BZQK 4U1NA 1UYWH 4JFEB 4ODWA 1GGCH 3VXMD 4RAUA 1RHFA 4FTVA 4WI6A 3H7LA 3QULA 1BQLH 4JFDA 3C60C 1MCPH 4FNLL 4LCCA 2Z0BA 1OCWL 5D5MF 3E8UH 3GMMB 4GG8B 4TSAL 1V05A 4CL7A 5IHUL 2NZ9C 4R4FH 3D18B 4D9RD 5JIIA 2Z31C 3ZHDA 1RSFA 2YD5A 5LJYH 2D7PA 3GSXB 4ZUUB 3S97C 4P23A 3K2MC 1M1SA 4MWFB 5CGTA 2WBJC 2ZG3A 1H8NA 3KLAA 2APXA 2BVPA 1ZHNA 1YMMA 4MNHB 4EQ3A 4PJ7F 4KJQC 2X4UB 4HFWA 4MXWH 1FC2D 1NBZA 3WLBA 1U0ND 4MSWA 2EDWA 4BSUA 4HUMB 4ZFOB 4N5ED 2NW2B 3EFDL 5ID1A 1KJ3H 2GY5A 4PY8J 2FEDD 4PJXE 4TUJA 4NNXA 3CDYA 4L8DB 3UDWC 1M9LA 5LBSH 3SE3C 4YNYB 3QBTB 3C6LB 4MA1B 1KT2A 1CU4H 5JW4Q 1CFQB 3LKSA 5GSRB 3BMVA 1FNGA 2OMYA 4WGVB 3LQAL 1NCWL 2Z66A 1XCDA 1BVKB 4KDTA 3MBEA 2GY7B 3FTGA 3EJZC 4NQEE 5CJXA 2X4UA 4JHAH 5HHNB 3RPIA 1DTUA 3VA2C 1EO5A 4NQSA 3KLSA 4KK5C 2XTJB 3HFMH 2VDLL 1MCEA 3QDJA 3KPQA 5CILL 3LHPL 2YXMA 2ITDB 3U48A 4RWYH 3MA9H 5L0QB 4I0KA 5DHVA 4LSXA 3O11A 1BQHA 5CIPA 5EU6A 1AXSA 1K9TA 2CK0H 1DVFD 2Q7YA 1DQQB 2VXVH 4O58H 4WO4C 2YBRA 5IBUB 4CVWA 1CU4L 3EJZD 1XMWA 2P45B 4U0RB 5DF0A 4ZTOH 3DTXB 3IF1B 5FYKE 1QA9A 1AQDA 5FYJH 4FXGB 4LP4A 1A6TB 3TNNA 5A16A 1S7TA 2C4FT 3TGXA 5IB4A 4OCXH 4OF6A 2ZOLA 3MLWH 1F3RB 3EO0B 2ZZUT 1OPGL 3AS2A 1X5KA 4OLZH 3OKLA 4I18C 3ILPA 1PLGL 1FJ1B 4Y5XB 4BSJA 2DB8A 3W81A 3C60B 2CDFB 1XR8A 4JRYD 5ITFA 3UJIH 1JCKA 3QDAA 2ATKB 3PQYE 4OZHE 35C8L 1T7ZA 1J0IA 1JV5A 3O45B 4DEPC 1P1ZA 4B53A 4NKIH 5HGAA 3HE6A 2ICCA 5ANME 3VW3H 1U8HA 2DM3A 5I1EL 3CVHH 4NWTL 4D0DB 1A7BA 4OCYH 2R9HC 3B4NA 5DJ0A 1MI5D 4EOWL 3H8NA 1YMHA 4QCIA 4YNYA 1ZLWH 2OR7A 4LLVB 3RGVD 1QR1A 1XECA 2DJSA 3SPVB 1RUQL 2P5EE 1NAMH 4KJPD 4HSQA 3VRJB 4YHMH 1D5MB 1G7LB 2R0LL 4I3RL 3QAZC 1GC1L 3HC0B 3T08A 1FLRH 2J6EL 4DGVH 2FIKA 3QFJB 3W2DH 3HMWL 2UYLB 2VC2L 2PTVA 1PQZA 3PHSA 1KB5H 4KJYB 5HDBF 1K3IA 2GK2A 5E00B 1A6PA 3QFJA 1K5GC 1FVEA 1SMAA 2VE6B 3TO4B 3P4MA 12E8L 1QQDA 4ELKA 4K7FA 5J11C 1KLFA 4OQTA