4FCGA

Structure of the leucine-rich repeat domain of the type iii effector xcv3220 (xopl)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
296
Chain Sequence
LYFQTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDSGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Structure of the leucine-rich repeat domain of the type III effector XCV3220 (XopL)
rcsb
source organism Xanthomonas campestris pv. vesicatoria
molecule tags Structural genomics, unknown function
total genus 89
structure length 296
sequence length 299
ec nomenclature
pdb deposition date 2012-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fcgA00
2V9SA 3G06A 3WN4A 5IJCA 4LXSA 3WPCA 4R07A 1DS9A 4R6AA 3ULVA 3P72A 1WWLA 1FT8A 4R58A 4HQ1A 4RWTC 2OMVA 3GOZA 3RJ0A 1LTXA 2UZYA 3UL9A 3OGMB 2Z66A 3W3MA 4UFRA 4FDWA 4LSCA 4Q3IA 5IYXC 2Z64A 3KJ4A 2Q4GW 3G39A 4R09A 4M7EC 2ASTB 5IJDA 2Y5QA 3OGLB 1DCEA 4I6JB 2FT3A 5GMGA 1QYYA 2BEXA 4Z79A 4BSRA 2O6RA 3VQ2A 4NKHA 2OMZA 5GQRK 4L3FA 4C2AB 3OJAA 1XEUA 2XOTA 3W3GA 4LXRA 2P1NB 1G9UA 2ID5A 2UZXA 4PQ8A 4K17A 4BV4R 2ASSB 1OOKG 1IO0A 3WPHA 4ARRA 3C6PB 1SQ0B 5HZLB 4L3AA 3RIZA 3W3NA 3WPEA 4TZHA 4Q3GA 4U08A 4AY9X 2A0ZA 1KOOA 4PERA 4V2DA 2BNHA 3O53A 5FTTB 4FD0A 2Z63A 4IM6A 4ECOA 2OMXA 4RCWA 5AZ5A 5GMFA 2P1MB 4EZGA 4KNGA 4WP6A 4GLPA 4RCAB 5GS2B 2ELLA 2JE1A 1OTMA 4ARNA 1A4YA 4XGOA 2JQDA 3W3LA 2RR6A 3CVRA 3C6OB 4FCGA 5B0TA 3O6NA 5AWAA 3OJAB 3REZA 3VQ1A 3RW6A 3M18A 2Z81A 1XWDC 1U0ND 3ZYIA 3WPGA 3BZ5A 3ULUA 2CA6A 4P8SA 2WQUA 4R08A 1OGQA 3E6JA 1FQVA 2JE0A 4KT1A 5AWBA 4WYKA 4FS7A 4CNMA 5LFNA 1PGVA 2P1QB 3M19A 5IJBA 4NKGA 1O6SA 4H09A 3UL8A 1GWBA 4U7LA 4CNCA 3PMHG 5A5CA 3E3ZA 3WPDA 2P1PB 3FXIA 4P91A 3A79B 4V2CA 5D3IA 1FO1A 5CMPA 4MN8B 4U06A 4BSSA 1O6VA 2O6SA 4MQWX 3CIYA 4R6JA 1D0BA 3CIGA 4M7EA 3W3KA 3DZEA 1XECA 4Z8GA 4G8AA 1XKUA 3G3BA 4R5DA 4OQTA 4QC0A 4CC4C 2R9UA 5B4PA 3RGZA 3ZYNA 2OMYA 4LI2A 4GT6A 2Z7XA 3WPBA 4R0AA 1KOHA 2V70A 5GMHA 2XWTC 1YRGA 4R6GA 3WPIA 1W8AA 5AWDA 3E4GA 1XCDA 3RW7A 4B8CD 2P1OB 1M10B 4XSQA 1A9NA 1JL5A 4J0MA 2Z65A 4FHOA 2Z82A 4KXFB 4J4LA 4Z64C 4FMZA 2OMTA 3TSRE 3G3AA 1M0ZA 5CMNA 1H6TA 4XOSA 4CP6A 3ZYOA 4BSUA 1P8VA 4CILA 4PEQB 4CC4A 3ULAA 2WQWA 2V9TB 4LSXC 4Q62A 4PSJA 4Z61C 5GS0A 4Y61B 5B0NA 3E2JA 3ZYJA 1FS2A 1OTOA 3RFJA 4R5CA 2OMWA 1P8TA 3G04C 1P9AG 4QBZA 2WQVA 1M9SA 2Z62A 3JB9j 3SB4A 4C2BB 1OTNA 4U09A 3OGKB 4Z94G 3RGXA 4ECNA 2OMUA 1O6TA 1DFJI 4QXEA 4PKIG 3C6NB 4LSAA 1ZIWA 2Z7XB 3RFEA 3UN9A 5HDHA 4LI1A 1Z7XW 1K5DC 1OZNA 4V2EA 2WFHA 4AW4A 5AWCA 3WPFA 4R6FA 1K5GC 2RA8A 2WQXA 4LSXA 1H6UA 2O6QA 2IFGA 1M9LA 3UL7A 3RFSA 3W3JA 4YEBB
chains in the Genus database with same CATH superfamily
2V9SA 3G06A 3WN4A 5IJCA 4LXSA 3WPCA 4R07A 1DS9A 4R6AA 3ULVA 3P72A 1WWLA 1FT8A 4R58A 4HQ1A 4RWTC 2OMVA 3GOZA 3RJ0A 1LTXA 2UZYA 3UL9A 3OGMB 2Z66A 3W3MA 4UFRA 4FDWA 4LSCA 4Q3IA 5IYXC 2Z64A 3KJ4A 2Q4GW 3G39A 4R09A 4M7EC 2ASTB 5IJDA 2Y5QA 3OGLB 1DCEA 4I6JB 2FT3A 5GMGA 1QYYA 2BEXA 4Z79A 4BSRA 2O6RA 3VQ2A 4NKHA 2OMZA 5GQRK 4L3FA 4C2AB 3OJAA 1XEUA 2XOTA 3W3GA 4LXRA 2P1NB 1G9UA 2ID5A 2UZXA 4PQ8A 4K17A 4BV4R 2ASSB 1OOKG 1IO0A 3WPHA 4ARRA 3C6PB 1SQ0B 5HZLB 4L3AA 3RIZA 3W3NA 3WPEA 4TZHA 4Q3GA 4U08A 4AY9X 2A0ZA 1KOOA 4PERA 4V2DA 2BNHA 3O53A 5FTTB 4FD0A 2Z63A 4IM6A 4ECOA 2OMXA 4RCWA 5AZ5A 5GMFA 4NZRM 2P1MB 4EZGA 4KNGA 4WP6A 4GLPA 4RCAB 5GS2B 2ELLA 2JE1A 1OTMA 4ARNA 1A4YA 4XGOA 2JQDA 3W3LA 2RR6A 3CVRA 3C6OB 4FCGA 5B0TA 3O6NA 5AWAA 3OJAB 3REZA 3VQ1A 3RW6A 3M18A 4NZTM 2Z81A 1XWDC 1U0ND 3ZYIA 3WPGA 3BZ5A 3ULUA 2CA6A 4P8SA 2WQUA 4R08A 1OGQA 3E6JA 1FQVA 2JE0A 4KT1A 5AWBA 4WYKA 4FS7A 4CNMA 5LFNA 1PGVA 2P1QB 3M19A 5IJBA 4NKGA 1O6SA 4H09A 3UL8A 1GWBA 4U7LA 4CNCA 3PMHG 5A5CA 3E3ZA 3WPDA 2P1PB 3FXIA 4P91A 3A79B 4V2CA 5D3IA 1FO1A 5CMPA 4MN8B 4U06A 4BSSA 1O6VA 2O6SA 4MQWX 3CIYA 4R6JA 1D0BA 3CIGA 4M7EA 3W3KA 3DZEA 1XECA 4Z8GA 4G8AA 1XKUA 3G3BA 4R5DA 4OQTA 4QC0A 4CC4C 2R9UA 5B4PA 3RGZA 3ZYNA 2OMYA 4LI2A 4GT6A 2Z7XA 3WPBA 4R0AA 1KOHA 2V70A 5GMHA 2XWTC 1YRGA 4R6GA 3WPIA 1W8AA 5AWDA 3E4GA 1XCDA 3RW7A 4B8CD 2P1OB 1M10B 4XSQA 1A9NA 1JL5A 4J0MA 2Z65A 4FHOA 2Z82A 4KXFB 4J4LA 4Z64C 4FMZA 2OMTA 3TSRE 3G3AA 1M0ZA 5CMNA 1H6TA 4XOSA 4CP6A 3ZYOA 4BSUA 1P8VA 4CILA 4PEQB 4CC4A 3ULAA 2WQWA 2V9TB 4LSXC 4Q62A 4PSJA 4Z61C 5GS0A 4Y61B 5B0NA 3E2JA 3ZYJA 1FS2A 1OTOA 3RFJA 4R5CA 2OMWA 1P8TA 3G04C 1P9AG 4QBZA 2WQVA 1M9SA 2Z62A 3JB9j 3SB4A 4C2BB 1OTNA 4U09A 3OGKB 4Z94G 3RGXA 4ECNA 2OMUA 1O6TA 1DFJI 4QXEA 4PKIG 3C6NB 4LSAA 1ZIWA 2Z7XB 3RFEA 3UN9A 5HDHA 4LI1A 1Z7XW 1K5DC 1OZNA 4V2EA 2WFHA 4AW4A 5AWCA 3WPFA 4R6FA 1K5GC 2RA8A 2WQXA 4LSXA 1H6UA 2O6QA 2IFGA 1M9LA 3UL7A 3RFSA 3W3JA 4YEBB
chains in the Genus database with same CATH topology
2V9SA 3G06A 3WN4A 5IJCA 4LXSA 3WPCA 4R07A 1DS9A 4R6AA 3ULVA 3P72A 1WWLA 1FT8A 4R58A 4HQ1A 4RWTC 2OMVA 3GOZA 3RJ0A 1LTXA 2UZYA 3UL9A 3OGMB 2Z66A 3W3MA 4UFRA 4FDWA 4LSCA 4Q3IA 5IYXC 2Z64A 3KJ4A 2Q4GW 3G39A 4R09A 4M7EC 2ASTB 5IJDA 2Y5QA 3OGLB 1DCEA 4I6JB 2FT3A 5GMGA 1QYYA 2BEXA 4Z79A 4BSRA 2O6RA 3VQ2A 4NKHA 2OMZA 5GQRK 4L3FA 4C2AB 3OJAA 1XEUA 2XOTA 3W3GA 4LXRA 2P1NB 1G9UA 2ID5A 2UZXA 4PQ8A 4K17A 4BV4R 2ASSB 1OOKG 1IO0A 3WPHA 4ARRA 3C6PB 1SQ0B 5HZLB 4L3AA 3RIZA 3W3NA 3WPEA 4TZHA 4Q3GA 4U08A 4AY9X 2A0ZA 1KOOA 4PERA 4V2DA 2BNHA 3O53A 5FTTB 4FD0A 2Z63A 4IM6A 4ECOA 2OMXA 4RCWA 5AZ5A 5GMFA 2P1MB 4EZGA 4KNGA 4WP6A 4GLPA 4RCAB 5GS2B 2ELLA 2JE1A 1OTMA 4ARNA 1A4YA 4XGOA 2JQDA 3W3LA 2RR6A 3CVRA 3C6OB 4FCGA 5B0TA 3O6NA 5AWAA 3OJAB 3REZA 3VQ1A 3RW6A 3M18A 2Z81A 1XWDC 1U0ND 3ZYIA 3WPGA 3BZ5A 3ULUA 2CA6A 4P8SA 2WQUA 4R08A 1OGQA 3E6JA 1FQVA 2JE0A 4KT1A 5AWBA 4WYKA 4FS7A 4CNMA 5LFNA 1PGVA 2P1QB 3M19A 5IJBA 4NKGA 1O6SA 4H09A 3UL8A 1GWBA 4U7LA 4CNCA 3PMHG 5A5CA 3E3ZA 3WPDA 2P1PB 3FXIA 4P91A 3A79B 4V2CA 5D3IA 1FO1A 5CMPA 4MN8B 4U06A 4BSSA 1O6VA 2O6SA 4MQWX 3CIYA 4R6JA 1D0BA 3CIGA 4M7EA 3W3KA 3DZEA 1XECA 4Z8GA 4G8AA 1XKUA 3G3BA 4R5DA 4OQTA 4QC0A 4CC4C 2R9UA 5B4PA 3RGZA 3ZYNA 2OMYA 4LI2A 4GT6A 2Z7XA 3WPBA 4R0AA 1KOHA 2V70A 5GMHA 2XWTC 1YRGA 4R6GA 3WPIA 1W8AA 5AWDA 3E4GA 1XCDA 3RW7A 4B8CD 2P1OB 1M10B 4XSQA 1A9NA 1JL5A 4J0MA 2Z65A 4FHOA 2Z82A 4KXFB 4J4LA 4Z64C 4FMZA 2OMTA 3TSRE 3G3AA 1M0ZA 5CMNA 1H6TA 4XOSA 4CP6A 3ZYOA 4BSUA 1P8VA 4CILA 4PEQB 4CC4A 3ULAA 2WQWA 2V9TB 4LSXC 4Q62A 4PSJA 4Z61C 5GS0A 4Y61B 5B0NA 3E2JA 3ZYJA 1FS2A 1OTOA 3RFJA 4R5CA 2OMWA 1P8TA 3G04C 1P9AG 4QBZA 2WQVA 1M9SA 2Z62A 3JB9j 3SB4A 4C2BB 1OTNA 4U09A 3OGKB 4Z94G 3RGXA 4ECNA 2OMUA 1O6TA 1DFJI 4QXEA 4PKIG 3C6NB 4LSAA 1ZIWA 2Z7XB 3RFEA 3UN9A 5HDHA 4LI1A 1Z7XW 1K5DC 1OZNA 4V2EA 2WFHA 4AW4A 5AWCA 3WPFA 4R6FA 1K5GC 2RA8A 2WQXA 4LSXA 1H6UA 2O6QA 2IFGA 1M9LA 3UL7A 3RFSA 3W3JA 4YEBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9S A;  3G06 A;  3WN4 A;  5IJC A;  4LXS A;  3WPC A;  4R07 A;  1DS9 A;  4R6A A;  3ULV A;  3P72 A;  1WWL A;  1FT8 A;  4R58 A;  4HQ1 A;  4RWT C;  2OMV A;  3GOZ A;  3RJ0 A;  1LTX A;  2UZY A;  3UL9 A;  3OGM B;  2Z66 A;  3W3M A;  4UFR A;  4FDW A;  4LSC A;  4Q3I A;  5IYX C;  2Z64 A;  3KJ4 A;  2Q4G W;  3G39 A;  4R09 A;  4M7E C;  2AST B;  5IJD A;  2Y5Q A;  3OGL B;  1DCE A;  4I6J B;  2FT3 A;  5GMG A;  1QYY A;  2BEX A;  4Z79 A;  4BSR A;  2O6R A;  3VQ2 A;  4NKH A;  2OMZ A;  5GQR K;  4L3F A;  4C2A B;  3OJA A;  1XEU A;  2XOT A;  3W3G A;  4LXR A;  2P1N B;  1G9U A;  2ID5 A;  2UZX A;  4PQ8 A;  4K17 A;  4BV4 R;  2ASS B;  1OOK G;  1IO0 A;  3WPH A;  4ARR A;  3C6P B;  1SQ0 B;  5HZL B;  4L3A A;  3RIZ A;  3W3N A;  3WPE A;  4TZH A;  4Q3G A;  4U08 A;  4AY9 X;  2A0Z A;  1KOO A;  4PER A;  4V2D A;  2BNH A;  3O53 A;  5FTT B;  4FD0 A;  2Z63 A;  4IM6 A;  4ECO A;  2OMX A;  4RCW A;  5AZ5 A;  5GMF A;  2P1M B;  4EZG A;  4KNG A;  4WP6 A;  4GLP A;  4RCA B;  5GS2 B;  2ELL A;  2JE1 A;  1OTM A;  4ARN A;  1A4Y A;  4XGO A;  2JQD A;  3W3L A;  2RR6 A;  3CVR A;  3C6O B;  4FCG A;  5B0T A;  3O6N A;  5AWA A;  3OJA B;  3REZ A;  3VQ1 A;  3RW6 A;  3M18 A;  2Z81 A;  1XWD C;  1U0N D;  3ZYI A;  3WPG A;  3BZ5 A;  3ULU A;  2CA6 A;  4P8S A;  2WQU A;  4R08 A;  1OGQ A;  3E6J A;  1FQV A;  2JE0 A;  4KT1 A;  5AWB A;  4WYK A;  4FS7 A;  4CNM A;  5LFN A;  1PGV A;  2P1Q B;  3M19 A;  5IJB A;  4NKG A;  1O6S A;  4H09 A;  3UL8 A;  1GWB A;  4U7L A;  4CNC A;  3PMH G;  5A5C A;  3E3Z A;  3WPD A;  2P1P B;  3FXI A;  4P91 A;  3A79 B;  4V2C A;  5D3I A;  1FO1 A;  5CMP A;  4MN8 B;  4U06 A;  4BSS A;  1O6V A;  2O6S A;  4MQW X;  3CIY A;  4R6J A;  1D0B A;  3CIG A;  4M7E A;  3W3K A;  3DZE A;  1XEC A;  4Z8G A;  4G8A A;  1XKU A;  3G3B A;  4R5D A;  4OQT A;  4QC0 A;  4CC4 C;  2R9U A;  5B4P A;  3RGZ A;  3ZYN A;  2OMY A;  4LI2 A;  4GT6 A;  2Z7X A;  3WPB A;  4R0A A;  1KOH A;  2V70 A;  5GMH A;  2XWT C;  1YRG A;  4R6G A;  3WPI A;  1W8A A;  5AWD A;  3E4G A;  1XCD A;  3RW7 A;  4B8C D;  2P1O B;  1M10 B;  4XSQ A;  1A9N A;  1JL5 A;  4J0M A;  2Z65 A;  4FHO A;  2Z82 A;  4KXF B;  4J4L A;  4Z64 C;  4FMZ A;  2OMT A;  3TSR E;  3G3A A;  1M0Z A;  5CMN A;  1H6T A;  4XOS A;  4CP6 A;  3ZYO A;  4BSU A;  1P8V A;  4CIL A;  4PEQ B;  4CC4 A;  3ULA A;  2WQW A;  2V9T B;  4LSX C;  4Q62 A;  4PSJ A;  4Z61 C;  5GS0 A;  4Y61 B;  5B0N A;  3E2J A;  3ZYJ A;  1FS2 A;  1OTO A;  3RFJ A;  4R5C A;  2OMW A;  1P8T A;  3G04 C;  1P9A G;  4QBZ A;  2WQV A;  1M9S A;  2Z62 A;  3JB9 j;  3SB4 A;  4C2B B;  1OTN A;  4U09 A;  3OGK B;  4Z94 G;  3RGX A;  4ECN A;  2OMU A;  1O6T A;  1DFJ I;  4QXE A;  4PKI G;  3C6N B;  4LSA A;  1ZIW A;  2Z7X B;  3RFE A;  3UN9 A;  5HDH A;  4LI1 A;  1Z7X W;  1K5D C;  1OZN A;  4V2E A;  2WFH A;  4AW4 A;  5AWC A;  3WPF A;  4R6F A;  1K5G C;  2RA8 A;  2WQX A;  4LSX A;  1H6U A;  2O6Q A;  2IFG A;  1M9L A;  3UL7 A;  3RFS A;  3W3J A;  4YEB B; 
#chains in the Genus database with same CATH topology
 2V9S A;  3G06 A;  3WN4 A;  5IJC A;  4LXS A;  3WPC A;  4R07 A;  1DS9 A;  4R6A A;  3ULV A;  3P72 A;  1WWL A;  1FT8 A;  4R58 A;  4HQ1 A;  4RWT C;  2OMV A;  3GOZ A;  3RJ0 A;  1LTX A;  2UZY A;  3UL9 A;  3OGM B;  2Z66 A;  3W3M A;  4UFR A;  4FDW A;  4LSC A;  4Q3I A;  5IYX C;  2Z64 A;  3KJ4 A;  2Q4G W;  3G39 A;  4R09 A;  4M7E C;  2AST B;  5IJD A;  2Y5Q A;  3OGL B;  1DCE A;  4I6J B;  2FT3 A;  5GMG A;  1QYY A;  2BEX A;  4Z79 A;  4BSR A;  2O6R A;  3VQ2 A;  4NKH A;  2OMZ A;  5GQR K;  4L3F A;  4C2A B;  3OJA A;  1XEU A;  2XOT A;  3W3G A;  4LXR A;  2P1N B;  1G9U A;  2ID5 A;  2UZX A;  4PQ8 A;  4K17 A;  4BV4 R;  2ASS B;  1OOK G;  1IO0 A;  3WPH A;  4ARR A;  3C6P B;  1SQ0 B;  5HZL B;  4L3A A;  3RIZ A;  3W3N A;  3WPE A;  4TZH A;  4Q3G A;  4U08 A;  4AY9 X;  2A0Z A;  1KOO A;  4PER A;  4V2D A;  2BNH A;  3O53 A;  5FTT B;  4FD0 A;  2Z63 A;  4IM6 A;  4ECO A;  2OMX A;  4RCW A;  5AZ5 A;  5GMF A;  4NZR M;  2P1M B;  4EZG A;  4KNG A;  4WP6 A;  4GLP A;  4RCA B;  5GS2 B;  2ELL A;  2JE1 A;  1OTM A;  4ARN A;  1A4Y A;  4XGO A;  2JQD A;  3W3L A;  2RR6 A;  3CVR A;  3C6O B;  4FCG A;  5B0T A;  3O6N A;  5AWA A;  3OJA B;  3REZ A;  3VQ1 A;  3RW6 A;  3M18 A;  4NZT M;  2Z81 A;  1XWD C;  1U0N D;  3ZYI A;  3WPG A;  3BZ5 A;  3ULU A;  2CA6 A;  4P8S A;  2WQU A;  4R08 A;  1OGQ A;  3E6J A;  1FQV A;  2JE0 A;  4KT1 A;  5AWB A;  4WYK A;  4FS7 A;  4CNM A;  5LFN A;  1PGV A;  2P1Q B;  3M19 A;  5IJB A;  4NKG A;  1O6S A;  4H09 A;  3UL8 A;  1GWB A;  4U7L A;  4CNC A;  3PMH G;  5A5C A;  3E3Z A;  3WPD A;  2P1P B;  3FXI A;  4P91 A;  3A79 B;  4V2C A;  5D3I A;  1FO1 A;  5CMP A;  4MN8 B;  4U06 A;  4BSS A;  1O6V A;  2O6S A;  4MQW X;  3CIY A;  4R6J A;  1D0B A;  3CIG A;  4M7E A;  3W3K A;  3DZE A;  1XEC A;  4Z8G A;  4G8A A;  1XKU A;  3G3B A;  4R5D A;  4OQT A;  4QC0 A;  4CC4 C;  2R9U A;  5B4P A;  3RGZ A;  3ZYN A;  2OMY A;  4LI2 A;  4GT6 A;  2Z7X A;  3WPB A;  4R0A A;  1KOH A;  2V70 A;  5GMH A;  2XWT C;  1YRG A;  4R6G A;  3WPI A;  1W8A A;  5AWD A;  3E4G A;  1XCD A;  3RW7 A;  4B8C D;  2P1O B;  1M10 B;  4XSQ A;  1A9N A;  1JL5 A;  4J0M A;  2Z65 A;  4FHO A;  2Z82 A;  4KXF B;  4J4L A;  4Z64 C;  4FMZ A;  2OMT A;  3TSR E;  3G3A A;  1M0Z A;  5CMN A;  1H6T A;  4XOS A;  4CP6 A;  3ZYO A;  4BSU A;  1P8V A;  4CIL A;  4PEQ B;  4CC4 A;  3ULA A;  2WQW A;  2V9T B;  4LSX C;  4Q62 A;  4PSJ A;  4Z61 C;  5GS0 A;  4Y61 B;  5B0N A;  3E2J A;  3ZYJ A;  1FS2 A;  1OTO A;  3RFJ A;  4R5C A;  2OMW A;  1P8T A;  3G04 C;  1P9A G;  4QBZ A;  2WQV A;  1M9S A;  2Z62 A;  3JB9 j;  3SB4 A;  4C2B B;  1OTN A;  4U09 A;  3OGK B;  4Z94 G;  3RGX A;  4ECN A;  2OMU A;  1O6T A;  1DFJ I;  4QXE A;  4PKI G;  3C6N B;  4LSA A;  1ZIW A;  2Z7X B;  3RFE A;  3UN9 A;  5HDH A;  4LI1 A;  1Z7X W;  1K5D C;  1OZN A;  4V2E A;  2WFH A;  4AW4 A;  5AWC A;  3WPF A;  4R6F A;  1K5G C;  2RA8 A;  2WQX A;  4LSX A;  1H6U A;  2O6Q A;  2IFG A;  1M9L A;  3UL7 A;  3RFS A;  3W3J A;  4YEB B; 
#chains in the Genus database with same CATH homology
 2V9S A;  3G06 A;  3WN4 A;  5IJC A;  4LXS A;  3WPC A;  4R07 A;  1DS9 A;  4R6A A;  3ULV A;  3P72 A;  1WWL A;  1FT8 A;  4R58 A;  4HQ1 A;  4RWT C;  2OMV A;  3GOZ A;  3RJ0 A;  1LTX A;  2UZY A;  3UL9 A;  3OGM B;  2Z66 A;  3W3M A;  4UFR A;  4FDW A;  4LSC A;  4Q3I A;  5IYX C;  2Z64 A;  3KJ4 A;  2Q4G W;  3G39 A;  4R09 A;  4M7E C;  2AST B;  5IJD A;  2Y5Q A;  3OGL B;  1DCE A;  4I6J B;  2FT3 A;  5GMG A;  1QYY A;  2BEX A;  4Z79 A;  4BSR A;  2O6R A;  3VQ2 A;  4NKH A;  2OMZ A;  5GQR K;  4L3F A;  4C2A B;  3OJA A;  1XEU A;  2XOT A;  3W3G A;  4LXR A;  2P1N B;  1G9U A;  2ID5 A;  2UZX A;  4PQ8 A;  4K17 A;  4BV4 R;  2ASS B;  1OOK G;  1IO0 A;  3WPH A;  4ARR A;  3C6P B;  1SQ0 B;  5HZL B;  4L3A A;  3RIZ A;  3W3N A;  3WPE A;  4TZH A;  4Q3G A;  4U08 A;  4AY9 X;  2A0Z A;  1KOO A;  4PER A;  4V2D A;  2BNH A;  3O53 A;  5FTT B;  4FD0 A;  2Z63 A;  4IM6 A;  4ECO A;  2OMX A;  4RCW A;  5AZ5 A;  5GMF A;  2P1M B;  4EZG A;  4KNG A;  4WP6 A;  4GLP A;  4RCA B;  5GS2 B;  2ELL A;  2JE1 A;  1OTM A;  4ARN A;  1A4Y A;  4XGO A;  2JQD A;  3W3L A;  2RR6 A;  3CVR A;  3C6O B;  4FCG A;  5B0T A;  3O6N A;  5AWA A;  3OJA B;  3REZ A;  3VQ1 A;  3RW6 A;  3M18 A;  2Z81 A;  1XWD C;  1U0N D;  3ZYI A;  3WPG A;  3BZ5 A;  3ULU A;  2CA6 A;  4P8S A;  2WQU A;  4R08 A;  1OGQ A;  3E6J A;  1FQV A;  2JE0 A;  4KT1 A;  5AWB A;  4WYK A;  4FS7 A;  4CNM A;  5LFN A;  1PGV A;  2P1Q B;  3M19 A;  5IJB A;  4NKG A;  1O6S A;  4H09 A;  3UL8 A;  1GWB A;  4U7L A;  4CNC A;  3PMH G;  5A5C A;  3E3Z A;  3WPD A;  2P1P B;  3FXI A;  4P91 A;  3A79 B;  4V2C A;  5D3I A;  1FO1 A;  5CMP A;  4MN8 B;  4U06 A;  4BSS A;  1O6V A;  2O6S A;  4MQW X;  3CIY A;  4R6J A;  1D0B A;  3CIG A;  4M7E A;  3W3K A;  3DZE A;  1XEC A;  4Z8G A;  4G8A A;  1XKU A;  3G3B A;  4R5D A;  4OQT A;  4QC0 A;  4CC4 C;  2R9U A;  5B4P A;  3RGZ A;  3ZYN A;  2OMY A;  4LI2 A;  4GT6 A;  2Z7X A;  3WPB A;  4R0A A;  1KOH A;  2V70 A;  5GMH A;  2XWT C;  1YRG A;  4R6G A;  3WPI A;  1W8A A;  5AWD A;  3E4G A;  1XCD A;  3RW7 A;  4B8C D;  2P1O B;  1M10 B;  4XSQ A;  1A9N A;  1JL5 A;  4J0M A;  2Z65 A;  4FHO A;  2Z82 A;  4KXF B;  4J4L A;  4Z64 C;  4FMZ A;  2OMT A;  3TSR E;  3G3A A;  1M0Z A;  5CMN A;  1H6T A;  4XOS A;  4CP6 A;  3ZYO A;  4BSU A;  1P8V A;  4CIL A;  4PEQ B;  4CC4 A;  3ULA A;  2WQW A;  2V9T B;  4LSX C;  4Q62 A;  4PSJ A;  4Z61 C;  5GS0 A;  4Y61 B;  5B0N A;  3E2J A;  3ZYJ A;  1FS2 A;  1OTO A;  3RFJ A;  4R5C A;  2OMW A;  1P8T A;  3G04 C;  1P9A G;  4QBZ A;  2WQV A;  1M9S A;  2Z62 A;  3JB9 j;  3SB4 A;  4C2B B;  1OTN A;  4U09 A;  3OGK B;  4Z94 G;  3RGX A;  4ECN A;  2OMU A;  1O6T A;  1DFJ I;  4QXE A;  4PKI G;  3C6N B;  4LSA A;  1ZIW A;  2Z7X B;  3RFE A;  3UN9 A;  5HDH A;  4LI1 A;  1Z7X W;  1K5D C;  1OZN A;  4V2E A;  2WFH A;  4AW4 A;  5AWC A;  3WPF A;  4R6F A;  1K5G C;  2RA8 A;  2WQX A;  4LSX A;  1H6U A;  2O6Q A;  2IFG A;  1M9L A;  3UL7 A;  3RFS A;  3W3J A;  4YEB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...