4FCGA

Structure of the leucine-rich repeat domain of the type iii effector xcv3220 (xopl)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
296
Chain Sequence
LYFQTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDSGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Structure of the leucine-rich repeat domain of the type III effector XCV3220 (XopL)
rcsb
source organism Xanthomonas campestris pv. vesicatoria
total genus 89
structure length 296
sequence length 299
ec nomenclature
pdb deposition date 2012-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fcgA00
3BZ5A 3WN4A 4FS7A 3OGLB 4FHOA 3WPDA 4XGOA 1QYYA 1M9SA 3TSRE 3RGZA 4Z64C 4B8CD 3E6JA 3G3BA 4Z79A 4J0MA 4TZHA 3WPHA 4R0AA 2ASTB 5D3IA 4CNCA 4P91A 3ULAA 1DCEA 3WPEA 3W3MA 2OMWA 3RFEA 4CC4C 1H6TA 3ULUA 5GQRK 4ARRA 2Q4GW 3G06A 2JQDA 4ECOA 4UFRA 4RCAB 4FMZA 1ZIWA 2ID5A 2ASSB 3OGKB 1JL5A 3WPIA 4R09A 5IJCA 3WPGA 4HQ1A 1FQVA 3M19A 4R5DA 1DS9A 4Y61B 1A9NA 5CMPA 1XWDC 3VQ2A 4RWTC 1P8VA 1SQ0B 2P1PB 1O6VA 2O6SA 3KJ4A 4NKHA 1PGVA 3G3AA 1M0ZA 3W3GA 4YEBB 3O6NA 5LFNA 1P9AG 4R6AA 5GMHA 2OMZA 4KT1A 3WPFA 3RIZA 5AWCA 2UZXA 1IO0A 2V70A 4XOSA 4KNGA 2OMUA 2OMYA 3FXIA 2XOTA 1O6TA 4H09A 2Z62A 4ECNA 5B0TA 4C2AB 1XCDA 4RCWA 3W3LA 1GWBA 5AZ5A 1KOOA 4PSJA 1D0BA 4AY9X 2RR6A 4GLPA 1U0ND 3WPCA 2WQWA 4M7EC 4MQWX 5CMNA 1FT8A 3P72A 3RW7A 3W3NA 4CP6A 4BSUA 5GS2B 4LXRA 2A0ZA 4FDWA 4EZGA 4P8SA 3VQ1A 4U08A 4C2BB 3ZYJA 4AW4A 3G39A 4LSCA 4BV4R 2XWTC 1G9UA 4R6FA 1O6SA 2WQXA 3C6NB 1XEUA 3ULVA 1XKUA 3RJ0A 3GOZA 5IYXC 3ZYIA 1H6UA 4LSXC 1K5DC 1LTXA 4M7EA 4R07A 4IM6A 4R5CA 1OZNA 4V2DA 2O6QA 3RGXA 4WP6A 2CA6A 4Q3IA 4OQTA 5AWDA 1Z7XW 3CIGA 4G8AA 2WQUA 3REZA 1DFJI 3C6OB 3OGMB 3ZYNA 5IJBA 3A79B 5FTTB 4FD0A 3M18A 4LI2A 4R58A 3UN9A 4R6JA 3W3JA 3OJAB 4QXEA 3CIYA 4V2EA 3E2JA 3O53A 2ELLA 2OMXA 2V9SA 1FS2A 1OTOA 2JE0A 4XSQA 2UZYA 4J4LA 4LSXA 2BNHA 4ARNA 1OTNA 2JE1A 4QC0A 2O6RA 4LSAA 2Z82A 2P1NB 4I6JB 3DZEA 4BSRA 1K5GC 1XECA 2Z65A 3RW6A 1M9LA 3PMHG 4PEQB 3UL9A 4LI1A 2Y5QA 2BEXA 5HZLB 4U06A 2Z7XB 4CNMA 4PKIG 5AWBA 4V2CA 1A4YA 1YRGA 1W8AA 4QBZA 4Q62A 4BSSA 5HDHA 4LXSA 5IJDA 5GMFA 3E4GA 3OJAA 5B0NA 3RFJA 4R6GA 4Z94G 4L3AA 3G04C 1OOKG 3RFSA 3W3KA 2R9UA 2Z66A 2Z81A 2P1MB 2RA8A 4K17A 1M10B 4L3FA 3C6PB 3UL8A 2IFGA 3UL7A 5GS0A 2WFHA 3SB4A 4MN8B 1OGQA 1OTMA 4Q3GA 4CILA 5GMGA 4Z8GA 2Z64A 4U7LA 3JB9j 1KOHA 4FCGA 2WQVA 1P8TA 4KXFB 2P1QB 4GT6A 2Z7XA 4Z61C 4WYKA 5B4PA 4PERA 4CC4A 5AWAA 2OMTA 4R08A 2V9TB 2OMVA 3ZYOA 3CVRA 2FT3A 5A5CA 4NKGA 4U09A 1FO1A 4PQ8A 3E3ZA 1WWLA 3WPBA 2Z63A 2P1OB
chains in the Genus database with same CATH superfamily
3BZ5A 3WN4A 4FS7A 3OGLB 4FHOA 3WPDA 4XGOA 1QYYA 1M9SA 3TSRE 3RGZA 4Z64C 4B8CD 3E6JA 3G3BA 4Z79A 4J0MA 4TZHA 3WPHA 4R0AA 2ASTB 5D3IA 4CNCA 4P91A 3ULAA 1DCEA 3WPEA 3W3MA 2OMWA 3RFEA 4CC4C 1H6TA 3ULUA 5GQRK 4ARRA 2Q4GW 3G06A 2JQDA 4ECOA 4UFRA 4RCAB 4FMZA 1ZIWA 2ID5A 2ASSB 3OGKB 1JL5A 3WPIA 4R09A 5IJCA 3WPGA 4HQ1A 1FQVA 3M19A 4R5DA 1DS9A 4Y61B 1A9NA 5CMPA 1XWDC 3VQ2A 4RWTC 1P8VA 1SQ0B 2P1PB 1O6VA 2O6SA 3KJ4A 4NKHA 1PGVA 3G3AA 1M0ZA 3W3GA 4YEBB 3O6NA 5LFNA 1P9AG 4R6AA 5GMHA 2OMZA 4KT1A 3WPFA 3RIZA 5AWCA 2UZXA 1IO0A 2V70A 4XOSA 4KNGA 2OMUA 2OMYA 3FXIA 2XOTA 1O6TA 4H09A 2Z62A 4ECNA 5B0TA 4C2AB 1XCDA 4RCWA 3W3LA 1GWBA 5AZ5A 1KOOA 4PSJA 1D0BA 4AY9X 2RR6A 4GLPA 1U0ND 3WPCA 2WQWA 4M7EC 4MQWX 5CMNA 1FT8A 3P72A 3RW7A 3W3NA 4CP6A 4BSUA 5GS2B 4LXRA 2A0ZA 4FDWA 4EZGA 4P8SA 3VQ1A 4U08A 4C2BB 3ZYJA 4AW4A 3G39A 4LSCA 4BV4R 2XWTC 1G9UA 4R6FA 1O6SA 2WQXA 3C6NB 1XEUA 3ULVA 1XKUA 3RJ0A 3GOZA 5IYXC 3ZYIA 1H6UA 4LSXC 1K5DC 1LTXA 4M7EA 4R07A 4IM6A 4R5CA 1OZNA 4V2DA 2O6QA 3RGXA 4WP6A 2CA6A 4Q3IA 4OQTA 5AWDA 1Z7XW 3CIGA 4G8AA 2WQUA 3REZA 1DFJI 3C6OB 3OGMB 3ZYNA 5IJBA 3A79B 5FTTB 4FD0A 3M18A 4LI2A 4R58A 3UN9A 4R6JA 3W3JA 3OJAB 4QXEA 3CIYA 4V2EA 3E2JA 3O53A 2ELLA 2OMXA 2V9SA 1FS2A 1OTOA 2JE0A 4XSQA 2UZYA 4J4LA 4LSXA 2BNHA 4ARNA 1OTNA 2JE1A 4QC0A 2O6RA 4LSAA 2Z82A 2P1NB 4I6JB 3DZEA 4BSRA 1K5GC 1XECA 2Z65A 3RW6A 1M9LA 3PMHG 4PEQB 3UL9A 4LI1A 2Y5QA 2BEXA 5HZLB 4U06A 2Z7XB 4CNMA 4PKIG 5AWBA 4V2CA 1A4YA 1YRGA 4NZTM 1W8AA 4QBZA 4Q62A 4BSSA 5HDHA 4LXSA 5IJDA 5GMFA 3E4GA 3OJAA 5B0NA 3RFJA 4R6GA 4Z94G 4L3AA 3G04C 1OOKG 3RFSA 3W3KA 2R9UA 2Z66A 2Z81A 2P1MB 2RA8A 4K17A 1M10B 4L3FA 3C6PB 3UL8A 2IFGA 3UL7A 5GS0A 2WFHA 3SB4A 4MN8B 1OGQA 1OTMA 4Q3GA 4CILA 5GMGA 4Z8GA 2Z64A 4U7LA 3JB9j 1KOHA 4FCGA 2WQVA 1P8TA 4KXFB 2P1QB 4GT6A 2Z7XA 4Z61C 4WYKA 5B4PA 4PERA 4CC4A 4NZRM 5AWAA 2OMTA 4R08A 2V9TB 2OMVA 3ZYOA 3CVRA 2FT3A 5A5CA 4NKGA 4U09A 1FO1A 4PQ8A 3E3ZA 1WWLA 3WPBA 2Z63A 2P1OB
chains in the Genus database with same CATH topology
3BZ5A 3WN4A 4FS7A 3OGLB 4FHOA 3WPDA 4XGOA 1QYYA 1M9SA 3TSRE 3RGZA 4Z64C 4B8CD 3E6JA 3G3BA 4Z79A 4J0MA 4TZHA 3WPHA 4R0AA 2ASTB 5D3IA 4CNCA 4P91A 3ULAA 1DCEA 3WPEA 3W3MA 2OMWA 3RFEA 4CC4C 1H6TA 3ULUA 5GQRK 4ARRA 2Q4GW 3G06A 2JQDA 4ECOA 4UFRA 4RCAB 4FMZA 1ZIWA 2ID5A 2ASSB 3OGKB 1JL5A 3WPIA 4R09A 5IJCA 3WPGA 4HQ1A 1FQVA 3M19A 4R5DA 1DS9A 4Y61B 1A9NA 5CMPA 1XWDC 3VQ2A 4RWTC 1P8VA 1SQ0B 2P1PB 1O6VA 2O6SA 3KJ4A 4NKHA 1PGVA 3G3AA 1M0ZA 3W3GA 4YEBB 3O6NA 5LFNA 1P9AG 4R6AA 5GMHA 2OMZA 4KT1A 3WPFA 3RIZA 5AWCA 2UZXA 1IO0A 2V70A 4XOSA 4KNGA 2OMUA 2OMYA 3FXIA 2XOTA 1O6TA 4H09A 2Z62A 4ECNA 5B0TA 4C2AB 1XCDA 4RCWA 3W3LA 1GWBA 5AZ5A 1KOOA 4PSJA 1D0BA 4AY9X 2RR6A 4GLPA 1U0ND 3WPCA 2WQWA 4M7EC 4MQWX 5CMNA 1FT8A 3P72A 3RW7A 3W3NA 4CP6A 4BSUA 5GS2B 4LXRA 2A0ZA 4FDWA 4EZGA 4P8SA 3VQ1A 4U08A 4C2BB 3ZYJA 4AW4A 3G39A 4LSCA 4BV4R 2XWTC 1G9UA 4R6FA 1O6SA 2WQXA 3C6NB 1XEUA 3ULVA 1XKUA 3RJ0A 3GOZA 5IYXC 3ZYIA 1H6UA 4LSXC 1K5DC 1LTXA 4M7EA 4R07A 4IM6A 4R5CA 1OZNA 4V2DA 2O6QA 3RGXA 4WP6A 2CA6A 4Q3IA 4OQTA 5AWDA 1Z7XW 3CIGA 4G8AA 2WQUA 3REZA 1DFJI 3C6OB 3OGMB 3ZYNA 5IJBA 3A79B 5FTTB 4FD0A 3M18A 4LI2A 4R58A 3UN9A 4R6JA 3W3JA 3OJAB 4QXEA 3CIYA 4V2EA 3E2JA 3O53A 2ELLA 2OMXA 2V9SA 1FS2A 1OTOA 2JE0A 4XSQA 2UZYA 4J4LA 4LSXA 2BNHA 4ARNA 1OTNA 2JE1A 4QC0A 2O6RA 4LSAA 2Z82A 2P1NB 4I6JB 3DZEA 4BSRA 1K5GC 1XECA 2Z65A 3RW6A 1M9LA 3PMHG 4PEQB 3UL9A 4LI1A 2Y5QA 2BEXA 5HZLB 4U06A 2Z7XB 4CNMA 4PKIG 5AWBA 4V2CA 1A4YA 1YRGA 1W8AA 4QBZA 4Q62A 4BSSA 5HDHA 4LXSA 5IJDA 5GMFA 3E4GA 3OJAA 5B0NA 3RFJA 4R6GA 4Z94G 4L3AA 3G04C 1OOKG 3RFSA 3W3KA 2R9UA 2Z66A 2Z81A 2P1MB 2RA8A 4K17A 1M10B 4L3FA 3C6PB 3UL8A 2IFGA 3UL7A 5GS0A 2WFHA 3SB4A 4MN8B 1OGQA 1OTMA 4Q3GA 4CILA 5GMGA 4Z8GA 2Z64A 4U7LA 3JB9j 1KOHA 4FCGA 2WQVA 1P8TA 4KXFB 2P1QB 4GT6A 2Z7XA 4Z61C 4WYKA 5B4PA 4PERA 4CC4A 5AWAA 2OMTA 4R08A 2V9TB 2OMVA 3ZYOA 3CVRA 2FT3A 5A5CA 4NKGA 4U09A 1FO1A 4PQ8A 3E3ZA 1WWLA 3WPBA 2Z63A 2P1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZ5 A;  3WN4 A;  4FS7 A;  3OGL B;  4FHO A;  3WPD A;  4XGO A;  1QYY A;  1M9S A;  3TSR E;  3RGZ A;  4Z64 C;  4B8C D;  3E6J A;  3G3B A;  4Z79 A;  4J0M A;  4TZH A;  3WPH A;  4R0A A;  2AST B;  5D3I A;  4CNC A;  4P91 A;  3ULA A;  1DCE A;  3WPE A;  3W3M A;  2OMW A;  3RFE A;  4CC4 C;  1H6T A;  3ULU A;  5GQR K;  4ARR A;  2Q4G W;  3G06 A;  2JQD A;  4ECO A;  4UFR A;  4RCA B;  4FMZ A;  1ZIW A;  2ID5 A;  2ASS B;  3OGK B;  1JL5 A;  3WPI A;  4R09 A;  5IJC A;  3WPG A;  4HQ1 A;  1FQV A;  3M19 A;  4R5D A;  1DS9 A;  4Y61 B;  1A9N A;  5CMP A;  1XWD C;  3VQ2 A;  4RWT C;  1P8V A;  1SQ0 B;  2P1P B;  1O6V A;  2O6S A;  3KJ4 A;  4NKH A;  1PGV A;  3G3A A;  1M0Z A;  3W3G A;  4YEB B;  3O6N A;  5LFN A;  1P9A G;  4R6A A;  5GMH A;  2OMZ A;  4KT1 A;  3WPF A;  3RIZ A;  5AWC A;  2UZX A;  1IO0 A;  2V70 A;  4XOS A;  4KNG A;  2OMU A;  2OMY A;  3FXI A;  2XOT A;  1O6T A;  4H09 A;  2Z62 A;  4ECN A;  5B0T A;  4C2A B;  1XCD A;  4RCW A;  3W3L A;  1GWB A;  5AZ5 A;  1KOO A;  4PSJ A;  1D0B A;  4AY9 X;  2RR6 A;  4GLP A;  1U0N D;  3WPC A;  2WQW A;  4M7E C;  4MQW X;  5CMN A;  1FT8 A;  3P72 A;  3RW7 A;  3W3N A;  4CP6 A;  4BSU A;  5GS2 B;  4LXR A;  2A0Z A;  4FDW A;  4EZG A;  4P8S A;  3VQ1 A;  4U08 A;  4C2B B;  3ZYJ A;  4AW4 A;  3G39 A;  4LSC A;  4BV4 R;  2XWT C;  1G9U A;  4R6F A;  1O6S A;  2WQX A;  3C6N B;  1XEU A;  3ULV A;  1XKU A;  3RJ0 A;  3GOZ A;  5IYX C;  3ZYI A;  1H6U A;  4LSX C;  1K5D C;  1LTX A;  4M7E A;  4R07 A;  4IM6 A;  4R5C A;  1OZN A;  4V2D A;  2O6Q A;  3RGX A;  4WP6 A;  2CA6 A;  4Q3I A;  4OQT A;  5AWD A;  1Z7X W;  3CIG A;  4G8A A;  2WQU A;  3REZ A;  1DFJ I;  3C6O B;  3OGM B;  3ZYN A;  5IJB A;  3A79 B;  5FTT B;  4FD0 A;  3M18 A;  4LI2 A;  4R58 A;  3UN9 A;  4R6J A;  3W3J A;  3OJA B;  4QXE A;  3CIY A;  4V2E A;  3E2J A;  3O53 A;  2ELL A;  2OMX A;  2V9S A;  1FS2 A;  1OTO A;  2JE0 A;  4XSQ A;  2UZY A;  4J4L A;  4LSX A;  2BNH A;  4ARN A;  1OTN A;  2JE1 A;  4QC0 A;  2O6R A;  4LSA A;  2Z82 A;  2P1N B;  4I6J B;  3DZE A;  4BSR A;  1K5G C;  1XEC A;  2Z65 A;  3RW6 A;  1M9L A;  3PMH G;  4PEQ B;  3UL9 A;  4LI1 A;  2Y5Q A;  2BEX A;  5HZL B;  4U06 A;  2Z7X B;  4CNM A;  4PKI G;  5AWB A;  4V2C A;  1A4Y A;  1YRG A;  1W8A A;  4QBZ A;  4Q62 A;  4BSS A;  5HDH A;  4LXS A;  5IJD A;  5GMF A;  3E4G A;  3OJA A;  5B0N A;  3RFJ A;  4R6G A;  4Z94 G;  4L3A A;  3G04 C;  1OOK G;  3RFS A;  3W3K A;  2R9U A;  2Z66 A;  2Z81 A;  2P1M B;  2RA8 A;  4K17 A;  1M10 B;  4L3F A;  3C6P B;  3UL8 A;  2IFG A;  3UL7 A;  5GS0 A;  2WFH A;  3SB4 A;  4MN8 B;  1OGQ A;  1OTM A;  4Q3G A;  4CIL A;  5GMG A;  4Z8G A;  2Z64 A;  4U7L A;  3JB9 j;  1KOH A;  4FCG A;  2WQV A;  1P8T A;  4KXF B;  2P1Q B;  4GT6 A;  2Z7X A;  4Z61 C;  4WYK A;  5B4P A;  4PER A;  4CC4 A;  5AWA A;  2OMT A;  4R08 A;  2V9T B;  2OMV A;  3ZYO A;  3CVR A;  2FT3 A;  5A5C A;  4NKG A;  4U09 A;  1FO1 A;  4PQ8 A;  3E3Z A;  1WWL A;  3WPB A;  2Z63 A;  2P1O B; 
#chains in the Genus database with same CATH topology
 3BZ5 A;  3WN4 A;  4FS7 A;  3OGL B;  4FHO A;  3WPD A;  4XGO A;  1QYY A;  1M9S A;  3TSR E;  3RGZ A;  4Z64 C;  4B8C D;  3E6J A;  3G3B A;  4Z79 A;  4J0M A;  4TZH A;  3WPH A;  4R0A A;  2AST B;  5D3I A;  4CNC A;  4P91 A;  3ULA A;  1DCE A;  3WPE A;  3W3M A;  2OMW A;  3RFE A;  4CC4 C;  1H6T A;  3ULU A;  5GQR K;  4ARR A;  2Q4G W;  3G06 A;  2JQD A;  4ECO A;  4UFR A;  4RCA B;  4FMZ A;  1ZIW A;  2ID5 A;  2ASS B;  3OGK B;  1JL5 A;  3WPI A;  4R09 A;  5IJC A;  3WPG A;  4HQ1 A;  1FQV A;  3M19 A;  4R5D A;  1DS9 A;  4Y61 B;  1A9N A;  5CMP A;  1XWD C;  3VQ2 A;  4RWT C;  1P8V A;  1SQ0 B;  2P1P B;  1O6V A;  2O6S A;  3KJ4 A;  4NKH A;  1PGV A;  3G3A A;  1M0Z A;  3W3G A;  4YEB B;  3O6N A;  5LFN A;  1P9A G;  4R6A A;  5GMH A;  2OMZ A;  4KT1 A;  3WPF A;  3RIZ A;  5AWC A;  2UZX A;  1IO0 A;  2V70 A;  4XOS A;  4KNG A;  2OMU A;  2OMY A;  3FXI A;  2XOT A;  1O6T A;  4H09 A;  2Z62 A;  4ECN A;  5B0T A;  4C2A B;  1XCD A;  4RCW A;  3W3L A;  1GWB A;  5AZ5 A;  1KOO A;  4PSJ A;  1D0B A;  4AY9 X;  2RR6 A;  4GLP A;  1U0N D;  3WPC A;  2WQW A;  4M7E C;  4MQW X;  5CMN A;  1FT8 A;  3P72 A;  3RW7 A;  3W3N A;  4CP6 A;  4BSU A;  5GS2 B;  4LXR A;  2A0Z A;  4FDW A;  4EZG A;  4P8S A;  3VQ1 A;  4U08 A;  4C2B B;  3ZYJ A;  4AW4 A;  3G39 A;  4LSC A;  4BV4 R;  2XWT C;  1G9U A;  4R6F A;  1O6S A;  2WQX A;  3C6N B;  1XEU A;  3ULV A;  1XKU A;  3RJ0 A;  3GOZ A;  5IYX C;  3ZYI A;  1H6U A;  4LSX C;  1K5D C;  1LTX A;  4M7E A;  4R07 A;  4IM6 A;  4R5C A;  1OZN A;  4V2D A;  2O6Q A;  3RGX A;  4WP6 A;  2CA6 A;  4Q3I A;  4OQT A;  5AWD A;  1Z7X W;  3CIG A;  4G8A A;  2WQU A;  3REZ A;  1DFJ I;  3C6O B;  3OGM B;  3ZYN A;  5IJB A;  3A79 B;  5FTT B;  4FD0 A;  3M18 A;  4LI2 A;  4R58 A;  3UN9 A;  4R6J A;  3W3J A;  3OJA B;  4QXE A;  3CIY A;  4V2E A;  3E2J A;  3O53 A;  2ELL A;  2OMX A;  2V9S A;  1FS2 A;  1OTO A;  2JE0 A;  4XSQ A;  2UZY A;  4J4L A;  4LSX A;  2BNH A;  4ARN A;  1OTN A;  2JE1 A;  4QC0 A;  2O6R A;  4LSA A;  2Z82 A;  2P1N B;  4I6J B;  3DZE A;  4BSR A;  1K5G C;  1XEC A;  2Z65 A;  3RW6 A;  1M9L A;  3PMH G;  4PEQ B;  3UL9 A;  4LI1 A;  2Y5Q A;  2BEX A;  5HZL B;  4U06 A;  2Z7X B;  4CNM A;  4PKI G;  5AWB A;  4V2C A;  1A4Y A;  1YRG A;  4NZT M;  1W8A A;  4QBZ A;  4Q62 A;  4BSS A;  5HDH A;  4LXS A;  5IJD A;  5GMF A;  3E4G A;  3OJA A;  5B0N A;  3RFJ A;  4R6G A;  4Z94 G;  4L3A A;  3G04 C;  1OOK G;  3RFS A;  3W3K A;  2R9U A;  2Z66 A;  2Z81 A;  2P1M B;  2RA8 A;  4K17 A;  1M10 B;  4L3F A;  3C6P B;  3UL8 A;  2IFG A;  3UL7 A;  5GS0 A;  2WFH A;  3SB4 A;  4MN8 B;  1OGQ A;  1OTM A;  4Q3G A;  4CIL A;  5GMG A;  4Z8G A;  2Z64 A;  4U7L A;  3JB9 j;  1KOH A;  4FCG A;  2WQV A;  1P8T A;  4KXF B;  2P1Q B;  4GT6 A;  2Z7X A;  4Z61 C;  4WYK A;  5B4P A;  4PER A;  4CC4 A;  4NZR M;  5AWA A;  2OMT A;  4R08 A;  2V9T B;  2OMV A;  3ZYO A;  3CVR A;  2FT3 A;  5A5C A;  4NKG A;  4U09 A;  1FO1 A;  4PQ8 A;  3E3Z A;  1WWL A;  3WPB A;  2Z63 A;  2P1O B; 
#chains in the Genus database with same CATH homology
 3BZ5 A;  3WN4 A;  4FS7 A;  3OGL B;  4FHO A;  3WPD A;  4XGO A;  1QYY A;  1M9S A;  3TSR E;  3RGZ A;  4Z64 C;  4B8C D;  3E6J A;  3G3B A;  4Z79 A;  4J0M A;  4TZH A;  3WPH A;  4R0A A;  2AST B;  5D3I A;  4CNC A;  4P91 A;  3ULA A;  1DCE A;  3WPE A;  3W3M A;  2OMW A;  3RFE A;  4CC4 C;  1H6T A;  3ULU A;  5GQR K;  4ARR A;  2Q4G W;  3G06 A;  2JQD A;  4ECO A;  4UFR A;  4RCA B;  4FMZ A;  1ZIW A;  2ID5 A;  2ASS B;  3OGK B;  1JL5 A;  3WPI A;  4R09 A;  5IJC A;  3WPG A;  4HQ1 A;  1FQV A;  3M19 A;  4R5D A;  1DS9 A;  4Y61 B;  1A9N A;  5CMP A;  1XWD C;  3VQ2 A;  4RWT C;  1P8V A;  1SQ0 B;  2P1P B;  1O6V A;  2O6S A;  3KJ4 A;  4NKH A;  1PGV A;  3G3A A;  1M0Z A;  3W3G A;  4YEB B;  3O6N A;  5LFN A;  1P9A G;  4R6A A;  5GMH A;  2OMZ A;  4KT1 A;  3WPF A;  3RIZ A;  5AWC A;  2UZX A;  1IO0 A;  2V70 A;  4XOS A;  4KNG A;  2OMU A;  2OMY A;  3FXI A;  2XOT A;  1O6T A;  4H09 A;  2Z62 A;  4ECN A;  5B0T A;  4C2A B;  1XCD A;  4RCW A;  3W3L A;  1GWB A;  5AZ5 A;  1KOO A;  4PSJ A;  1D0B A;  4AY9 X;  2RR6 A;  4GLP A;  1U0N D;  3WPC A;  2WQW A;  4M7E C;  4MQW X;  5CMN A;  1FT8 A;  3P72 A;  3RW7 A;  3W3N A;  4CP6 A;  4BSU A;  5GS2 B;  4LXR A;  2A0Z A;  4FDW A;  4EZG A;  4P8S A;  3VQ1 A;  4U08 A;  4C2B B;  3ZYJ A;  4AW4 A;  3G39 A;  4LSC A;  4BV4 R;  2XWT C;  1G9U A;  4R6F A;  1O6S A;  2WQX A;  3C6N B;  1XEU A;  3ULV A;  1XKU A;  3RJ0 A;  3GOZ A;  5IYX C;  3ZYI A;  1H6U A;  4LSX C;  1K5D C;  1LTX A;  4M7E A;  4R07 A;  4IM6 A;  4R5C A;  1OZN A;  4V2D A;  2O6Q A;  3RGX A;  4WP6 A;  2CA6 A;  4Q3I A;  4OQT A;  5AWD A;  1Z7X W;  3CIG A;  4G8A A;  2WQU A;  3REZ A;  1DFJ I;  3C6O B;  3OGM B;  3ZYN A;  5IJB A;  3A79 B;  5FTT B;  4FD0 A;  3M18 A;  4LI2 A;  4R58 A;  3UN9 A;  4R6J A;  3W3J A;  3OJA B;  4QXE A;  3CIY A;  4V2E A;  3E2J A;  3O53 A;  2ELL A;  2OMX A;  2V9S A;  1FS2 A;  1OTO A;  2JE0 A;  4XSQ A;  2UZY A;  4J4L A;  4LSX A;  2BNH A;  4ARN A;  1OTN A;  2JE1 A;  4QC0 A;  2O6R A;  4LSA A;  2Z82 A;  2P1N B;  4I6J B;  3DZE A;  4BSR A;  1K5G C;  1XEC A;  2Z65 A;  3RW6 A;  1M9L A;  3PMH G;  4PEQ B;  3UL9 A;  4LI1 A;  2Y5Q A;  2BEX A;  5HZL B;  4U06 A;  2Z7X B;  4CNM A;  4PKI G;  5AWB A;  4V2C A;  1A4Y A;  1YRG A;  1W8A A;  4QBZ A;  4Q62 A;  4BSS A;  5HDH A;  4LXS A;  5IJD A;  5GMF A;  3E4G A;  3OJA A;  5B0N A;  3RFJ A;  4R6G A;  4Z94 G;  4L3A A;  3G04 C;  1OOK G;  3RFS A;  3W3K A;  2R9U A;  2Z66 A;  2Z81 A;  2P1M B;  2RA8 A;  4K17 A;  1M10 B;  4L3F A;  3C6P B;  3UL8 A;  2IFG A;  3UL7 A;  5GS0 A;  2WFH A;  3SB4 A;  4MN8 B;  1OGQ A;  1OTM A;  4Q3G A;  4CIL A;  5GMG A;  4Z8G A;  2Z64 A;  4U7L A;  3JB9 j;  1KOH A;  4FCG A;  2WQV A;  1P8T A;  4KXF B;  2P1Q B;  4GT6 A;  2Z7X A;  4Z61 C;  4WYK A;  5B4P A;  4PER A;  4CC4 A;  5AWA A;  2OMT A;  4R08 A;  2V9T B;  2OMV A;  3ZYO A;  3CVR A;  2FT3 A;  5A5C A;  4NKG A;  4U09 A;  1FO1 A;  4PQ8 A;  3E3Z A;  1WWL A;  3WPB A;  2Z63 A;  2P1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...