3GOZA

Crystal structure of the leucine-rich repeat-containing protein legl7 from legionella pneumophila. northeast structural genomics consortium target lgr148
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
320
structure length
320
Chain Sequence
MNYKLTLHPGSNPVEEFTSIPHGVTSLDLSLNNLYSISTVELIQAFANTPASVTSLNLSGNSLGFKNSDELVQILAAIPANVTSLNLSGNFLSYKSSDELVKTLAAIPFTITVLDLGWNDFSSKSSSEFKQAFSNLPASITSLNLRGNDLGIKSSDELIQILAAIPANVNSLNLRGNNLASKNCAELAKFLASIPASVTSLDLSANLLGLKSYAELAYIFSSIPNHVVSLNLCLNCLHGPSLENLKLLKDSLKHLQTVYLDYDIVKNMSKEQCKALGAAFPNIQKIILVDKNGKEIHPSHSIPISNLIRELSGKADVPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Leucine-rich repeat-containing protein
publication title Crystal structure of the leucine-rich repeat-containing protein LegL7 from Legionella pneumophila. Northeast Structural Genomics Consortium target LgR148.
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
total genus 125
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2009-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3gozA01
4Q62A 4AY9X 1FS2A 4NKHA 4R5DA 5CMPA 5HZLB 4R09A 1FQVA 1H6TA 4PKIG 2UZXA 3TSRE 3KJ4A 1XKUA 4L3FA 2BEXA 4HQ1A 3O6NA 4H09A 2WQVA 4ARRA 2JE0A 4MN8B 3G3AA 4FS7A 3W3NA 4L3AA 4NKGA 2P1QB 2Z63A 4FD0A 1K5DC 1WWLA 4PQ8A 3G06A 2OMWA 1DS9A 4I6JB 4OQTA 3WPFA 3E2JA 1IO0A 4GT6A 2V9TB 4XSQA 3RFEA 3BZ5A 5IYXC 3W3KA 3SB4A 5CMNA 3REZA 5IJBA 4PEQB 3C6OB 5D3IA 4BV4R 4CNCA 1A4YA 4BSUA 4KXFB 4R6FA 4R0AA 1KOOA 3WPIA 3M19A 2RA8A 3RGZA 2Z7XA 2O6RA 4MQWX 3WPCA 3G3BA 3CIGA 3WPEA 3O53A 2XOTA 3C6NB 3UL7A 2Z66A 5B0TA 2ID5A 3OJAA 4YEBB 4KT1A 1DCEA 2BNHA 3RW7A 2OMZA 3WPBA 3VQ2A 4LXRA 3W3JA 3UN9A 4ECOA 1D0BA 2O6SA 2P1OB 2Z65A 5A5CA 1M10B 5LFNA 4EZGA 4GLPA 5GS2B 2OMUA 3WPGA 3WPHA 1U0ND 1JL5A 3ZYIA 4Z8GA 2WFHA 1K5GC 4XOSA 5HDHA 1A9NA 3RFJA 2XWTC 4LI1A 3RGXA 1ZIWA 2OMXA 2OMVA 4WP6A 4V2DA 1XEUA 1P9AG 2FT3A 3A79B 1W8AA 4FMZA 4M7EC 3RIZA 2O6QA 1Z7XW 4FCGA 5GMFA 4AW4A 3G39A 4BSSA 4J4LA 1OZNA 3ULVA 2JE1A 4PERA 4Q3GA 1P8TA 2P1MB 3E3ZA 3ZYJA 1OOKG 5FTTB 3E6JA 4IM6A 4R6GA 2R9UA 1XCDA 3W3LA 2V9SA 4R5CA 3JB9j 4KNGA 2ELLA 3OGMB 4J0MA 5B0NA 1OTNA 5GMGA 4XGOA 1O6TA 5GQRK 2Q4GW 4Z61C 3M18A 4CNMA 4LSCA 3UL9A 3ZYNA 4QC0A 4P8SA 5B4PA 4B8CD 2WQWA 4V2CA 3UL8A 1YRGA 1O6VA 2ASTB 3DZEA 4R08A 4U06A 3FXIA 2IFGA 2Z81A 4CILA 4Z94G 5GS0A 3GOZA 4Q3IA 2P1PB 2UZYA 4Z79A 4ECNA 1P8VA 3RW6A 2Z7XB 4QBZA 4R58A 5IJDA 4RCWA 3RJ0A 4R07A 4M7EA 1SQ0B 1FO1A 4PSJA 3P72A 4CC4C 3OJAB 3ULUA 1M9SA 4U7LA 2Z64A 4LSXC 2JQDA 1DFJI 3ZYOA 4RCAB 3CVRA 4FHOA 5AWAA 1O6SA 1G9UA 1LTXA 2P1NB 4C2AB 4LXSA 4UFRA 3W3GA 4Y61B 4G8AA 2WQXA 5AWDA 5IJCA 4LI2A 4V2EA 2Z82A 4BSRA 1OGQA 3VQ1A 1OTOA 2OMTA 3OGLB 1FT8A 3WN4A 4FDWA 2A0ZA 2WQUA 4R6JA 1M0ZA 3E4GA 3G04C 3C6PB 3WPDA 1PGVA 2CA6A 4QXEA 4U09A 2RR6A 5AWCA 3ULAA 3RFSA 2Y5QA 4R6AA 5AWBA 2ASSB 1GWBA 2Z62A 4K17A 3CIYA 3OGKB 1M9LA 1KOHA 4TZHA 4RWTC 4ARNA 4C2BB 4LSAA 4P91A 3W3MA 5AZ5A 1XWDC 1OTMA 3PMHG 4U08A 4CC4A 4Z64C 4WYKA 5GMHA 4LSXA 1XECA 1H6UA 4CP6A 1QYYA 2V70A 2OMYA
chains in the Genus database with same CATH superfamily
4Q62A 4AY9X 1FS2A 4NKHA 4R5DA 5CMPA 5HZLB 4R09A 1FQVA 1H6TA 4PKIG 2UZXA 3TSRE 3KJ4A 1XKUA 4L3FA 2BEXA 4HQ1A 3O6NA 4H09A 2WQVA 4ARRA 2JE0A 4MN8B 3G3AA 4FS7A 3W3NA 4L3AA 4NKGA 2P1QB 2Z63A 4FD0A 1K5DC 1WWLA 4PQ8A 3G06A 2OMWA 1DS9A 4I6JB 4OQTA 3WPFA 3E2JA 1IO0A 4GT6A 2V9TB 4XSQA 3RFEA 3BZ5A 5IYXC 3W3KA 3SB4A 5CMNA 3REZA 5IJBA 4PEQB 3C6OB 5D3IA 4BV4R 4CNCA 4NZRM 1A4YA 4BSUA 4KXFB 4R6FA 4R0AA 1KOOA 3WPIA 3M19A 2RA8A 3RGZA 2Z7XA 2O6RA 4MQWX 3WPCA 3G3BA 3CIGA 3WPEA 3O53A 2XOTA 3C6NB 3UL7A 2Z66A 5B0TA 2ID5A 3OJAA 4YEBB 4KT1A 1DCEA 2BNHA 3RW7A 2OMZA 3WPBA 3VQ2A 4LXRA 3W3JA 3UN9A 4ECOA 1D0BA 2O6SA 2P1OB 2Z65A 5A5CA 1M10B 5LFNA 4EZGA 4GLPA 5GS2B 2OMUA 3WPGA 3WPHA 1U0ND 1JL5A 3ZYIA 4Z8GA 2WFHA 1K5GC 4XOSA 5HDHA 1A9NA 3RFJA 2XWTC 4LI1A 3RGXA 1ZIWA 2OMXA 2OMVA 4WP6A 4V2DA 1XEUA 1P9AG 2FT3A 3A79B 1W8AA 4FMZA 4M7EC 3RIZA 4NZTM 2O6QA 1Z7XW 4FCGA 5GMFA 4AW4A 3G39A 4BSSA 4J4LA 1OZNA 3ULVA 2JE1A 4PERA 4Q3GA 1P8TA 2P1MB 3E3ZA 3ZYJA 1OOKG 5FTTB 3E6JA 4IM6A 4R6GA 2R9UA 1XCDA 3W3LA 2V9SA 4R5CA 3JB9j 4KNGA 2ELLA 3OGMB 4J0MA 5B0NA 1OTNA 5GMGA 4XGOA 1O6TA 5GQRK 2Q4GW 4Z61C 3M18A 4CNMA 4LSCA 3UL9A 3ZYNA 4QC0A 4P8SA 5B4PA 4B8CD 2WQWA 4V2CA 3UL8A 1YRGA 1O6VA 2ASTB 3DZEA 4R08A 4U06A 3FXIA 2IFGA 2Z81A 4CILA 4Z94G 5GS0A 3GOZA 4Q3IA 2P1PB 2UZYA 4Z79A 4ECNA 1P8VA 3RW6A 2Z7XB 4QBZA 4R58A 5IJDA 4RCWA 3RJ0A 4R07A 4M7EA 1SQ0B 1FO1A 4PSJA 3P72A 4CC4C 3OJAB 3ULUA 1M9SA 4U7LA 2Z64A 4LSXC 2JQDA 1DFJI 3ZYOA 4RCAB 3CVRA 4FHOA 5AWAA 1O6SA 1G9UA 1LTXA 2P1NB 4C2AB 4LXSA 4UFRA 3W3GA 4Y61B 4G8AA 2WQXA 5AWDA 5IJCA 4LI2A 4V2EA 2Z82A 4BSRA 1OGQA 3VQ1A 1OTOA 2OMTA 3OGLB 1FT8A 3WN4A 4FDWA 2A0ZA 2WQUA 4R6JA 1M0ZA 3E4GA 3G04C 3C6PB 3WPDA 1PGVA 2CA6A 4QXEA 4U09A 2RR6A 5AWCA 3ULAA 3RFSA 2Y5QA 4R6AA 5AWBA 2ASSB 1GWBA 2Z62A 4K17A 3CIYA 3OGKB 1M9LA 1KOHA 4TZHA 4RWTC 4ARNA 4C2BB 4LSAA 4P91A 3W3MA 5AZ5A 1XWDC 1OTMA 3PMHG 4U08A 4CC4A 4Z64C 4WYKA 5GMHA 4LSXA 1XECA 1H6UA 4CP6A 1QYYA 2V70A 2OMYA
chains in the Genus database with same CATH topology
4Q62A 4AY9X 1FS2A 4NKHA 4R5DA 5CMPA 5HZLB 4R09A 1FQVA 1H6TA 4PKIG 2UZXA 3TSRE 3KJ4A 1XKUA 4L3FA 2BEXA 4HQ1A 3O6NA 4H09A 2WQVA 4ARRA 2JE0A 4MN8B 3G3AA 4FS7A 3W3NA 4L3AA 4NKGA 2P1QB 2Z63A 4FD0A 1K5DC 1WWLA 4PQ8A 3G06A 2OMWA 1DS9A 4I6JB 4OQTA 3WPFA 3E2JA 1IO0A 4GT6A 2V9TB 4XSQA 3RFEA 3BZ5A 5IYXC 3W3KA 3SB4A 5CMNA 3REZA 5IJBA 4PEQB 3C6OB 5D3IA 4BV4R 4CNCA 1A4YA 4BSUA 4KXFB 4R6FA 4R0AA 1KOOA 3WPIA 3M19A 2RA8A 3RGZA 2Z7XA 2O6RA 4MQWX 3WPCA 3G3BA 3CIGA 3WPEA 3O53A 2XOTA 3C6NB 3UL7A 2Z66A 5B0TA 2ID5A 3OJAA 4YEBB 4KT1A 1DCEA 2BNHA 3RW7A 2OMZA 3WPBA 3VQ2A 4LXRA 3W3JA 3UN9A 4ECOA 1D0BA 2O6SA 2P1OB 2Z65A 5A5CA 1M10B 5LFNA 4EZGA 4GLPA 5GS2B 2OMUA 3WPGA 3WPHA 1U0ND 1JL5A 3ZYIA 4Z8GA 2WFHA 1K5GC 4XOSA 5HDHA 1A9NA 3RFJA 2XWTC 4LI1A 3RGXA 1ZIWA 2OMXA 2OMVA 4WP6A 4V2DA 1XEUA 1P9AG 2FT3A 3A79B 1W8AA 4FMZA 4M7EC 3RIZA 2O6QA 1Z7XW 4FCGA 5GMFA 4AW4A 3G39A 4BSSA 4J4LA 1OZNA 3ULVA 2JE1A 4PERA 4Q3GA 1P8TA 2P1MB 3E3ZA 3ZYJA 1OOKG 5FTTB 3E6JA 4IM6A 4R6GA 2R9UA 1XCDA 3W3LA 2V9SA 4R5CA 3JB9j 4KNGA 2ELLA 3OGMB 4J0MA 5B0NA 1OTNA 5GMGA 4XGOA 1O6TA 5GQRK 2Q4GW 4Z61C 3M18A 4CNMA 4LSCA 3UL9A 3ZYNA 4QC0A 4P8SA 5B4PA 4B8CD 2WQWA 4V2CA 3UL8A 1YRGA 1O6VA 2ASTB 3DZEA 4R08A 4U06A 3FXIA 2IFGA 2Z81A 4CILA 4Z94G 5GS0A 3GOZA 4Q3IA 2P1PB 2UZYA 4Z79A 4ECNA 1P8VA 3RW6A 2Z7XB 4QBZA 4R58A 5IJDA 4RCWA 3RJ0A 4R07A 4M7EA 1SQ0B 1FO1A 4PSJA 3P72A 4CC4C 3OJAB 3ULUA 1M9SA 4U7LA 2Z64A 4LSXC 2JQDA 1DFJI 3ZYOA 4RCAB 3CVRA 4FHOA 5AWAA 1O6SA 1G9UA 1LTXA 2P1NB 4C2AB 4LXSA 4UFRA 3W3GA 4Y61B 4G8AA 2WQXA 5AWDA 5IJCA 4LI2A 4V2EA 2Z82A 4BSRA 1OGQA 3VQ1A 1OTOA 2OMTA 3OGLB 1FT8A 3WN4A 4FDWA 2A0ZA 2WQUA 4R6JA 1M0ZA 3E4GA 3G04C 3C6PB 3WPDA 1PGVA 2CA6A 4QXEA 4U09A 2RR6A 5AWCA 3ULAA 3RFSA 2Y5QA 4R6AA 5AWBA 2ASSB 1GWBA 2Z62A 4K17A 3CIYA 3OGKB 1M9LA 1KOHA 4TZHA 4RWTC 4ARNA 4C2BB 4LSAA 4P91A 3W3MA 5AZ5A 1XWDC 1OTMA 3PMHG 4U08A 4CC4A 4Z64C 4WYKA 5GMHA 4LSXA 1XECA 1H6UA 4CP6A 1QYYA 2V70A 2OMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q62 A;  4AY9 X;  1FS2 A;  4NKH A;  4R5D A;  5CMP A;  5HZL B;  4R09 A;  1FQV A;  1H6T A;  4PKI G;  2UZX A;  3TSR E;  3KJ4 A;  1XKU A;  4L3F A;  2BEX A;  4HQ1 A;  3O6N A;  4H09 A;  2WQV A;  4ARR A;  2JE0 A;  4MN8 B;  3G3A A;  4FS7 A;  3W3N A;  4L3A A;  4NKG A;  2P1Q B;  2Z63 A;  4FD0 A;  1K5D C;  1WWL A;  4PQ8 A;  3G06 A;  2OMW A;  1DS9 A;  4I6J B;  4OQT A;  3WPF A;  3E2J A;  1IO0 A;  4GT6 A;  2V9T B;  4XSQ A;  3RFE A;  3BZ5 A;  5IYX C;  3W3K A;  3SB4 A;  5CMN A;  3REZ A;  5IJB A;  4PEQ B;  3C6O B;  5D3I A;  4BV4 R;  4CNC A;  1A4Y A;  4BSU A;  4KXF B;  4R6F A;  4R0A A;  1KOO A;  3WPI A;  3M19 A;  2RA8 A;  3RGZ A;  2Z7X A;  2O6R A;  4MQW X;  3WPC A;  3G3B A;  3CIG A;  3WPE A;  3O53 A;  2XOT A;  3C6N B;  3UL7 A;  2Z66 A;  5B0T A;  2ID5 A;  3OJA A;  4YEB B;  4KT1 A;  1DCE A;  2BNH A;  3RW7 A;  2OMZ A;  3WPB A;  3VQ2 A;  4LXR A;  3W3J A;  3UN9 A;  4ECO A;  1D0B A;  2O6S A;  2P1O B;  2Z65 A;  5A5C A;  1M10 B;  5LFN A;  4EZG A;  4GLP A;  5GS2 B;  2OMU A;  3WPG A;  3WPH A;  1U0N D;  1JL5 A;  3ZYI A;  4Z8G A;  2WFH A;  1K5G C;  4XOS A;  5HDH A;  1A9N A;  3RFJ A;  2XWT C;  4LI1 A;  3RGX A;  1ZIW A;  2OMX A;  2OMV A;  4WP6 A;  4V2D A;  1XEU A;  1P9A G;  2FT3 A;  3A79 B;  1W8A A;  4FMZ A;  4M7E C;  3RIZ A;  2O6Q A;  1Z7X W;  4FCG A;  5GMF A;  4AW4 A;  3G39 A;  4BSS A;  4J4L A;  1OZN A;  3ULV A;  2JE1 A;  4PER A;  4Q3G A;  1P8T A;  2P1M B;  3E3Z A;  3ZYJ A;  1OOK G;  5FTT B;  3E6J A;  4IM6 A;  4R6G A;  2R9U A;  1XCD A;  3W3L A;  2V9S A;  4R5C A;  3JB9 j;  4KNG A;  2ELL A;  3OGM B;  4J0M A;  5B0N A;  1OTN A;  5GMG A;  4XGO A;  1O6T A;  5GQR K;  2Q4G W;  4Z61 C;  3M18 A;  4CNM A;  4LSC A;  3UL9 A;  3ZYN A;  4QC0 A;  4P8S A;  5B4P A;  4B8C D;  2WQW A;  4V2C A;  3UL8 A;  1YRG A;  1O6V A;  2AST B;  3DZE A;  4R08 A;  4U06 A;  3FXI A;  2IFG A;  2Z81 A;  4CIL A;  4Z94 G;  5GS0 A;  3GOZ A;  4Q3I A;  2P1P B;  2UZY A;  4Z79 A;  4ECN A;  1P8V A;  3RW6 A;  2Z7X B;  4QBZ A;  4R58 A;  5IJD A;  4RCW A;  3RJ0 A;  4R07 A;  4M7E A;  1SQ0 B;  1FO1 A;  4PSJ A;  3P72 A;  4CC4 C;  3OJA B;  3ULU A;  1M9S A;  4U7L A;  2Z64 A;  4LSX C;  2JQD A;  1DFJ I;  3ZYO A;  4RCA B;  3CVR A;  4FHO A;  5AWA A;  1O6S A;  1G9U A;  1LTX A;  2P1N B;  4C2A B;  4LXS A;  4UFR A;  3W3G A;  4Y61 B;  4G8A A;  2WQX A;  5AWD A;  5IJC A;  4LI2 A;  4V2E A;  2Z82 A;  4BSR A;  1OGQ A;  3VQ1 A;  1OTO A;  2OMT A;  3OGL B;  1FT8 A;  3WN4 A;  4FDW A;  2A0Z A;  2WQU A;  4R6J A;  1M0Z A;  3E4G A;  3G04 C;  3C6P B;  3WPD A;  1PGV A;  2CA6 A;  4QXE A;  4U09 A;  2RR6 A;  5AWC A;  3ULA A;  3RFS A;  2Y5Q A;  4R6A A;  5AWB A;  2ASS B;  1GWB A;  2Z62 A;  4K17 A;  3CIY A;  3OGK B;  1M9L A;  1KOH A;  4TZH A;  4RWT C;  4ARN A;  4C2B B;  4LSA A;  4P91 A;  3W3M A;  5AZ5 A;  1XWD C;  1OTM A;  3PMH G;  4U08 A;  4CC4 A;  4Z64 C;  4WYK A;  5GMH A;  4LSX A;  1XEC A;  1H6U A;  4CP6 A;  1QYY A;  2V70 A;  2OMY A; 
#chains in the Genus database with same CATH topology
 4Q62 A;  4AY9 X;  1FS2 A;  4NKH A;  4R5D A;  5CMP A;  5HZL B;  4R09 A;  1FQV A;  1H6T A;  4PKI G;  2UZX A;  3TSR E;  3KJ4 A;  1XKU A;  4L3F A;  2BEX A;  4HQ1 A;  3O6N A;  4H09 A;  2WQV A;  4ARR A;  2JE0 A;  4MN8 B;  3G3A A;  4FS7 A;  3W3N A;  4L3A A;  4NKG A;  2P1Q B;  2Z63 A;  4FD0 A;  1K5D C;  1WWL A;  4PQ8 A;  3G06 A;  2OMW A;  1DS9 A;  4I6J B;  4OQT A;  3WPF A;  3E2J A;  1IO0 A;  4GT6 A;  2V9T B;  4XSQ A;  3RFE A;  3BZ5 A;  5IYX C;  3W3K A;  3SB4 A;  5CMN A;  3REZ A;  5IJB A;  4PEQ B;  3C6O B;  5D3I A;  4BV4 R;  4CNC A;  4NZR M;  1A4Y A;  4BSU A;  4KXF B;  4R6F A;  4R0A A;  1KOO A;  3WPI A;  3M19 A;  2RA8 A;  3RGZ A;  2Z7X A;  2O6R A;  4MQW X;  3WPC A;  3G3B A;  3CIG A;  3WPE A;  3O53 A;  2XOT A;  3C6N B;  3UL7 A;  2Z66 A;  5B0T A;  2ID5 A;  3OJA A;  4YEB B;  4KT1 A;  1DCE A;  2BNH A;  3RW7 A;  2OMZ A;  3WPB A;  3VQ2 A;  4LXR A;  3W3J A;  3UN9 A;  4ECO A;  1D0B A;  2O6S A;  2P1O B;  2Z65 A;  5A5C A;  1M10 B;  5LFN A;  4EZG A;  4GLP A;  5GS2 B;  2OMU A;  3WPG A;  3WPH A;  1U0N D;  1JL5 A;  3ZYI A;  4Z8G A;  2WFH A;  1K5G C;  4XOS A;  5HDH A;  1A9N A;  3RFJ A;  2XWT C;  4LI1 A;  3RGX A;  1ZIW A;  2OMX A;  2OMV A;  4WP6 A;  4V2D A;  1XEU A;  1P9A G;  2FT3 A;  3A79 B;  1W8A A;  4FMZ A;  4M7E C;  3RIZ A;  4NZT M;  2O6Q A;  1Z7X W;  4FCG A;  5GMF A;  4AW4 A;  3G39 A;  4BSS A;  4J4L A;  1OZN A;  3ULV A;  2JE1 A;  4PER A;  4Q3G A;  1P8T A;  2P1M B;  3E3Z A;  3ZYJ A;  1OOK G;  5FTT B;  3E6J A;  4IM6 A;  4R6G A;  2R9U A;  1XCD A;  3W3L A;  2V9S A;  4R5C A;  3JB9 j;  4KNG A;  2ELL A;  3OGM B;  4J0M A;  5B0N A;  1OTN A;  5GMG A;  4XGO A;  1O6T A;  5GQR K;  2Q4G W;  4Z61 C;  3M18 A;  4CNM A;  4LSC A;  3UL9 A;  3ZYN A;  4QC0 A;  4P8S A;  5B4P A;  4B8C D;  2WQW A;  4V2C A;  3UL8 A;  1YRG A;  1O6V A;  2AST B;  3DZE A;  4R08 A;  4U06 A;  3FXI A;  2IFG A;  2Z81 A;  4CIL A;  4Z94 G;  5GS0 A;  3GOZ A;  4Q3I A;  2P1P B;  2UZY A;  4Z79 A;  4ECN A;  1P8V A;  3RW6 A;  2Z7X B;  4QBZ A;  4R58 A;  5IJD A;  4RCW A;  3RJ0 A;  4R07 A;  4M7E A;  1SQ0 B;  1FO1 A;  4PSJ A;  3P72 A;  4CC4 C;  3OJA B;  3ULU A;  1M9S A;  4U7L A;  2Z64 A;  4LSX C;  2JQD A;  1DFJ I;  3ZYO A;  4RCA B;  3CVR A;  4FHO A;  5AWA A;  1O6S A;  1G9U A;  1LTX A;  2P1N B;  4C2A B;  4LXS A;  4UFR A;  3W3G A;  4Y61 B;  4G8A A;  2WQX A;  5AWD A;  5IJC A;  4LI2 A;  4V2E A;  2Z82 A;  4BSR A;  1OGQ A;  3VQ1 A;  1OTO A;  2OMT A;  3OGL B;  1FT8 A;  3WN4 A;  4FDW A;  2A0Z A;  2WQU A;  4R6J A;  1M0Z A;  3E4G A;  3G04 C;  3C6P B;  3WPD A;  1PGV A;  2CA6 A;  4QXE A;  4U09 A;  2RR6 A;  5AWC A;  3ULA A;  3RFS A;  2Y5Q A;  4R6A A;  5AWB A;  2ASS B;  1GWB A;  2Z62 A;  4K17 A;  3CIY A;  3OGK B;  1M9L A;  1KOH A;  4TZH A;  4RWT C;  4ARN A;  4C2B B;  4LSA A;  4P91 A;  3W3M A;  5AZ5 A;  1XWD C;  1OTM A;  3PMH G;  4U08 A;  4CC4 A;  4Z64 C;  4WYK A;  5GMH A;  4LSX A;  1XEC A;  1H6U A;  4CP6 A;  1QYY A;  2V70 A;  2OMY A; 
#chains in the Genus database with same CATH homology
 4Q62 A;  4AY9 X;  1FS2 A;  4NKH A;  4R5D A;  5CMP A;  5HZL B;  4R09 A;  1FQV A;  1H6T A;  4PKI G;  2UZX A;  3TSR E;  3KJ4 A;  1XKU A;  4L3F A;  2BEX A;  4HQ1 A;  3O6N A;  4H09 A;  2WQV A;  4ARR A;  2JE0 A;  4MN8 B;  3G3A A;  4FS7 A;  3W3N A;  4L3A A;  4NKG A;  2P1Q B;  2Z63 A;  4FD0 A;  1K5D C;  1WWL A;  4PQ8 A;  3G06 A;  2OMW A;  1DS9 A;  4I6J B;  4OQT A;  3WPF A;  3E2J A;  1IO0 A;  4GT6 A;  2V9T B;  4XSQ A;  3RFE A;  3BZ5 A;  5IYX C;  3W3K A;  3SB4 A;  5CMN A;  3REZ A;  5IJB A;  4PEQ B;  3C6O B;  5D3I A;  4BV4 R;  4CNC A;  1A4Y A;  4BSU A;  4KXF B;  4R6F A;  4R0A A;  1KOO A;  3WPI A;  3M19 A;  2RA8 A;  3RGZ A;  2Z7X A;  2O6R A;  4MQW X;  3WPC A;  3G3B A;  3CIG A;  3WPE A;  3O53 A;  2XOT A;  3C6N B;  3UL7 A;  2Z66 A;  5B0T A;  2ID5 A;  3OJA A;  4YEB B;  4KT1 A;  1DCE A;  2BNH A;  3RW7 A;  2OMZ A;  3WPB A;  3VQ2 A;  4LXR A;  3W3J A;  3UN9 A;  4ECO A;  1D0B A;  2O6S A;  2P1O B;  2Z65 A;  5A5C A;  1M10 B;  5LFN A;  4EZG A;  4GLP A;  5GS2 B;  2OMU A;  3WPG A;  3WPH A;  1U0N D;  1JL5 A;  3ZYI A;  4Z8G A;  2WFH A;  1K5G C;  4XOS A;  5HDH A;  1A9N A;  3RFJ A;  2XWT C;  4LI1 A;  3RGX A;  1ZIW A;  2OMX A;  2OMV A;  4WP6 A;  4V2D A;  1XEU A;  1P9A G;  2FT3 A;  3A79 B;  1W8A A;  4FMZ A;  4M7E C;  3RIZ A;  2O6Q A;  1Z7X W;  4FCG A;  5GMF A;  4AW4 A;  3G39 A;  4BSS A;  4J4L A;  1OZN A;  3ULV A;  2JE1 A;  4PER A;  4Q3G A;  1P8T A;  2P1M B;  3E3Z A;  3ZYJ A;  1OOK G;  5FTT B;  3E6J A;  4IM6 A;  4R6G A;  2R9U A;  1XCD A;  3W3L A;  2V9S A;  4R5C A;  3JB9 j;  4KNG A;  2ELL A;  3OGM B;  4J0M A;  5B0N A;  1OTN A;  5GMG A;  4XGO A;  1O6T A;  5GQR K;  2Q4G W;  4Z61 C;  3M18 A;  4CNM A;  4LSC A;  3UL9 A;  3ZYN A;  4QC0 A;  4P8S A;  5B4P A;  4B8C D;  2WQW A;  4V2C A;  3UL8 A;  1YRG A;  1O6V A;  2AST B;  3DZE A;  4R08 A;  4U06 A;  3FXI A;  2IFG A;  2Z81 A;  4CIL A;  4Z94 G;  5GS0 A;  3GOZ A;  4Q3I A;  2P1P B;  2UZY A;  4Z79 A;  4ECN A;  1P8V A;  3RW6 A;  2Z7X B;  4QBZ A;  4R58 A;  5IJD A;  4RCW A;  3RJ0 A;  4R07 A;  4M7E A;  1SQ0 B;  1FO1 A;  4PSJ A;  3P72 A;  4CC4 C;  3OJA B;  3ULU A;  1M9S A;  4U7L A;  2Z64 A;  4LSX C;  2JQD A;  1DFJ I;  3ZYO A;  4RCA B;  3CVR A;  4FHO A;  5AWA A;  1O6S A;  1G9U A;  1LTX A;  2P1N B;  4C2A B;  4LXS A;  4UFR A;  3W3G A;  4Y61 B;  4G8A A;  2WQX A;  5AWD A;  5IJC A;  4LI2 A;  4V2E A;  2Z82 A;  4BSR A;  1OGQ A;  3VQ1 A;  1OTO A;  2OMT A;  3OGL B;  1FT8 A;  3WN4 A;  4FDW A;  2A0Z A;  2WQU A;  4R6J A;  1M0Z A;  3E4G A;  3G04 C;  3C6P B;  3WPD A;  1PGV A;  2CA6 A;  4QXE A;  4U09 A;  2RR6 A;  5AWC A;  3ULA A;  3RFS A;  2Y5Q A;  4R6A A;  5AWB A;  2ASS B;  1GWB A;  2Z62 A;  4K17 A;  3CIY A;  3OGK B;  1M9L A;  1KOH A;  4TZH A;  4RWT C;  4ARN A;  4C2B B;  4LSA A;  4P91 A;  3W3M A;  5AZ5 A;  1XWD C;  1OTM A;  3PMH G;  4U08 A;  4CC4 A;  4Z64 C;  4WYK A;  5GMH A;  4LSX A;  1XEC A;  1H6U A;  4CP6 A;  1QYY A;  2V70 A;  2OMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...