4C2BB

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation in complex with high affinity gpib alpha
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
264
Chain Sequence
PICEVSKVASHLEVNCDKRRLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNRLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQVVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 60
structure length 264
sequence length 264
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4c2bB00
2OMUA 1FT8A 2P1OB 3RFEA 4XSQA 4R07A 5CMPA 1OTNA 1QYYA 4RWTC 3RJ0A 3CVRA 3ULAA 1O6TA 1OTMA 5AWAA 5GQRK 3O53A 3OGLB 4FD0A 3G39A 4H09A 3E6JA 2XOTA 4GLPA 4R5CA 4BSUA 5B0NA 1XECA 3DZEA 1W8AA 4PSJA 3WPEA 1JL5A 4WYKA 2ASTB 4K17A 1FS2A 2Z7XB 4PKIG 1M9SA 1OTOA 4KT1A 4FHOA 4KNGA 4MN8B 4Q62A 3SB4A 1WWLA 1A4YA 4U06A 2V9SA 3RGZA 3RW7A 4CILA 4LXSA 3E4GA 2ID5A 1ZIWA 4ECNA 3UN9A 3UL7A 5GS0A 2Y5QA 1D0BA 2P1PB 3ZYNA 2WQWA 4XGOA 3WPIA 5GMFA 4CC4A 2P1MB 3C6OB 3RFSA 4HQ1A 1IO0A 1K5GC 4Z79A 2A0ZA 1XEUA 3REZA 4BV4R 3WPCA 3CIGA 4V2EA 3UL9A 5HZLB 2Z65A 3O6NA 3TSRE 4Y61B 2CA6A 3C6PB 4R6FA 3OJAA 4Z94G 4BSSA 2V70A 4U09A 3ZYJA 3G06A 5AWDA 3RW6A 2WQVA 4QC0A 4WP6A 3RFJA 4LXRA 1A9NA 2O6RA 1M0ZA 1DCEA 1K5DC 1H6TA 3PMHG 3ULVA 3W3LA 5IJDA 3ULUA 4V2DA 1OGQA 2WQXA 4R6JA 3C6NB 4IM6A 1Z7XW 3M18A 5B4PA 2BNHA 4PERA 2IFGA 3G04C 2Q4GW 4Q3IA 4CP6A 1KOHA 4Z61C 3VQ1A 2UZYA 3WN4A 3WPGA 2Z62A 4OQTA 1GWBA 4RCAB 2WFHA 4LI2A 3WPFA 2Z66A 4CC4C 3E2JA 4NKHA 4P8SA 2OMZA 4LSAA 4UFRA 4R09A 1DS9A 3OGMB 5GS2B 1O6VA 1FO1A 3GOZA 2OMVA 3ZYIA 1XKUA 2P1NB 5HDHA 4NKGA 4L3FA 3W3NA 4B8CD 5CMNA 4R6AA 4TZHA 2R9UA 1P8TA 4LSXC 4C2BB 3OJAB 2Z64A 4V2CA 3OGKB 4P91A 2JE1A 5B0TA 3G3AA 4Q3GA 5AWCA 5IYXC 1XCDA 2OMYA 3FXIA 4U08A 4AY9X 2Z81A 3A79B 4AW4A 5D3IA 2OMTA 4QBZA 4ECOA 4LSXA 4FCGA 1P8VA 3UL8A 1OZNA 3W3MA 4R0AA 3M19A 1G9UA 4MQWX 5GMGA 4PQ8A 4GT6A 5IJBA 4C2AB 1DFJI 1PGVA 3W3JA 3VQ2A 4Z8GA 4G8AA 2Z63A 4FS7A 4BSRA 2BEXA 1M10B 1M9LA 1OOKG 3G3BA 3BZ5A 2V9TB 4Z64C 3RGXA 4KXFB 4ARRA 2JQDA 2RA8A 4LI1A 3WPBA 4R58A 1XWDC 3W3KA 4J4LA 4FDWA 3KJ4A 5GMHA 4I6JB 4RCWA 1LTXA 2FT3A 2ELLA 3ZYOA 3W3GA 2Z7XA 1YRGA 2UZXA 3WPHA 2ASSB 5FTTB 2OMXA 4QXEA 5A5CA 3JB9j 3P72A 5AWBA 2O6SA 4U7LA 3RIZA 1U0ND 3CIYA 2P1QB 2XWTC 5AZ5A 2WQUA 4R6GA 5IJCA 1FQVA 4M7EC 1SQ0B 4FMZA 4EZGA 3WPDA 4CNCA 4ARNA 4CNMA 4L3AA 2O6QA 4R5DA 1O6SA 4R08A 3E3ZA 4YEBB 4PEQB 1KOOA 2JE0A 1H6UA 5LFNA 4LSCA 1P9AG 2Z82A 2RR6A 4J0MA 2OMWA 4M7EA 4XOSA
chains in the Genus database with same CATH superfamily
2OMUA 1FT8A 2P1OB 3RFEA 4XSQA 4R07A 5CMPA 1OTNA 1QYYA 4RWTC 3RJ0A 3CVRA 3ULAA 1O6TA 1OTMA 5AWAA 5GQRK 3O53A 3OGLB 4FD0A 3G39A 4H09A 3E6JA 2XOTA 4GLPA 4R5CA 4BSUA 5B0NA 1XECA 3DZEA 1W8AA 4PSJA 3WPEA 1JL5A 4WYKA 2ASTB 4K17A 1FS2A 2Z7XB 4PKIG 1M9SA 1OTOA 4KT1A 4FHOA 4KNGA 4MN8B 4Q62A 3SB4A 1WWLA 1A4YA 4U06A 2V9SA 3RGZA 3RW7A 4CILA 4LXSA 3E4GA 2ID5A 1ZIWA 4ECNA 3UN9A 3UL7A 5GS0A 2Y5QA 1D0BA 2P1PB 3ZYNA 2WQWA 4XGOA 3WPIA 5GMFA 4CC4A 2P1MB 3C6OB 3RFSA 4HQ1A 1IO0A 1K5GC 4Z79A 2A0ZA 1XEUA 4NZTM 3REZA 4BV4R 3WPCA 3CIGA 4V2EA 3UL9A 5HZLB 2Z65A 3O6NA 3TSRE 4Y61B 2CA6A 3C6PB 4R6FA 3OJAA 4Z94G 4BSSA 2V70A 4U09A 3ZYJA 3G06A 5AWDA 3RW6A 2WQVA 4QC0A 4WP6A 3RFJA 4LXRA 1A9NA 2O6RA 1M0ZA 1DCEA 1K5DC 1H6TA 3PMHG 3ULVA 3W3LA 5IJDA 3ULUA 4V2DA 1OGQA 2WQXA 4R6JA 3C6NB 4IM6A 1Z7XW 3M18A 5B4PA 2BNHA 4PERA 2IFGA 3G04C 2Q4GW 4Q3IA 4CP6A 1KOHA 4Z61C 3VQ1A 2UZYA 3WN4A 3WPGA 2Z62A 4OQTA 1GWBA 4RCAB 2WFHA 4LI2A 3WPFA 2Z66A 4CC4C 3E2JA 4NKHA 4P8SA 2OMZA 4LSAA 4UFRA 4R09A 1DS9A 3OGMB 5GS2B 1O6VA 1FO1A 3GOZA 2OMVA 3ZYIA 1XKUA 2P1NB 5HDHA 4NKGA 4L3FA 3W3NA 4B8CD 5CMNA 4R6AA 4TZHA 2R9UA 1P8TA 4LSXC 4C2BB 3OJAB 2Z64A 4V2CA 3OGKB 4P91A 2JE1A 5B0TA 3G3AA 4Q3GA 5AWCA 5IYXC 1XCDA 2OMYA 3FXIA 4U08A 4AY9X 2Z81A 3A79B 4AW4A 5D3IA 2OMTA 4QBZA 4ECOA 4LSXA 4FCGA 1P8VA 3UL8A 1OZNA 3W3MA 4R0AA 3M19A 1G9UA 4MQWX 5GMGA 4PQ8A 4GT6A 5IJBA 4C2AB 1DFJI 1PGVA 3W3JA 3VQ2A 4Z8GA 4G8AA 2Z63A 4FS7A 4BSRA 2BEXA 1M10B 1M9LA 1OOKG 3G3BA 3BZ5A 2V9TB 4Z64C 3RGXA 4KXFB 4ARRA 2JQDA 2RA8A 4LI1A 3WPBA 4R58A 1XWDC 3W3KA 4J4LA 4FDWA 3KJ4A 5GMHA 4I6JB 4RCWA 1LTXA 2FT3A 2ELLA 3ZYOA 3W3GA 2Z7XA 1YRGA 2UZXA 3WPHA 2ASSB 5FTTB 2OMXA 4QXEA 5A5CA 3JB9j 3P72A 5AWBA 2O6SA 4U7LA 3RIZA 1U0ND 3CIYA 2P1QB 2XWTC 5AZ5A 2WQUA 4R6GA 5IJCA 1FQVA 4M7EC 1SQ0B 4FMZA 4EZGA 3WPDA 4CNCA 4NZRM 4ARNA 4CNMA 4L3AA 2O6QA 4R5DA 1O6SA 4R08A 3E3ZA 4YEBB 4PEQB 1KOOA 2JE0A 1H6UA 5LFNA 4LSCA 1P9AG 2Z82A 2RR6A 4J0MA 2OMWA 4M7EA 4XOSA
chains in the Genus database with same CATH topology
2OMUA 1FT8A 2P1OB 3RFEA 4XSQA 4R07A 5CMPA 1OTNA 1QYYA 4RWTC 3RJ0A 3CVRA 3ULAA 1O6TA 1OTMA 5AWAA 5GQRK 3O53A 3OGLB 4FD0A 3G39A 4H09A 3E6JA 2XOTA 4GLPA 4R5CA 4BSUA 5B0NA 1XECA 3DZEA 1W8AA 4PSJA 3WPEA 1JL5A 4WYKA 2ASTB 4K17A 1FS2A 2Z7XB 4PKIG 1M9SA 1OTOA 4KT1A 4FHOA 4KNGA 4MN8B 4Q62A 3SB4A 1WWLA 1A4YA 4U06A 2V9SA 3RGZA 3RW7A 4CILA 4LXSA 3E4GA 2ID5A 1ZIWA 4ECNA 3UN9A 3UL7A 5GS0A 2Y5QA 1D0BA 2P1PB 3ZYNA 2WQWA 4XGOA 3WPIA 5GMFA 4CC4A 2P1MB 3C6OB 3RFSA 4HQ1A 1IO0A 1K5GC 4Z79A 2A0ZA 1XEUA 3REZA 4BV4R 3WPCA 3CIGA 4V2EA 3UL9A 5HZLB 2Z65A 3O6NA 3TSRE 4Y61B 2CA6A 3C6PB 4R6FA 3OJAA 4Z94G 4BSSA 2V70A 4U09A 3ZYJA 3G06A 5AWDA 3RW6A 2WQVA 4QC0A 4WP6A 3RFJA 4LXRA 1A9NA 2O6RA 1M0ZA 1DCEA 1K5DC 1H6TA 3PMHG 3ULVA 3W3LA 5IJDA 3ULUA 4V2DA 1OGQA 2WQXA 4R6JA 3C6NB 4IM6A 1Z7XW 3M18A 5B4PA 2BNHA 4PERA 2IFGA 3G04C 2Q4GW 4Q3IA 4CP6A 1KOHA 4Z61C 3VQ1A 2UZYA 3WN4A 3WPGA 2Z62A 4OQTA 1GWBA 4RCAB 2WFHA 4LI2A 3WPFA 2Z66A 4CC4C 3E2JA 4NKHA 4P8SA 2OMZA 4LSAA 4UFRA 4R09A 1DS9A 3OGMB 5GS2B 1O6VA 1FO1A 3GOZA 2OMVA 3ZYIA 1XKUA 2P1NB 5HDHA 4NKGA 4L3FA 3W3NA 4B8CD 5CMNA 4R6AA 4TZHA 2R9UA 1P8TA 4LSXC 4C2BB 3OJAB 2Z64A 4V2CA 3OGKB 4P91A 2JE1A 5B0TA 3G3AA 4Q3GA 5AWCA 5IYXC 1XCDA 2OMYA 3FXIA 4U08A 4AY9X 2Z81A 3A79B 4AW4A 5D3IA 2OMTA 4QBZA 4ECOA 4LSXA 4FCGA 1P8VA 3UL8A 1OZNA 3W3MA 4R0AA 3M19A 1G9UA 4MQWX 5GMGA 4PQ8A 4GT6A 5IJBA 4C2AB 1DFJI 1PGVA 3W3JA 3VQ2A 4Z8GA 4G8AA 2Z63A 4FS7A 4BSRA 2BEXA 1M10B 1M9LA 1OOKG 3G3BA 3BZ5A 2V9TB 4Z64C 3RGXA 4KXFB 4ARRA 2JQDA 2RA8A 4LI1A 3WPBA 4R58A 1XWDC 3W3KA 4J4LA 4FDWA 3KJ4A 5GMHA 4I6JB 4RCWA 1LTXA 2FT3A 2ELLA 3ZYOA 3W3GA 2Z7XA 1YRGA 2UZXA 3WPHA 2ASSB 5FTTB 2OMXA 4QXEA 5A5CA 3JB9j 3P72A 5AWBA 2O6SA 4U7LA 3RIZA 1U0ND 3CIYA 2P1QB 2XWTC 5AZ5A 2WQUA 4R6GA 5IJCA 1FQVA 4M7EC 1SQ0B 4FMZA 4EZGA 3WPDA 4CNCA 4ARNA 4CNMA 4L3AA 2O6QA 4R5DA 1O6SA 4R08A 3E3ZA 4YEBB 4PEQB 1KOOA 2JE0A 1H6UA 5LFNA 4LSCA 1P9AG 2Z82A 2RR6A 4J0MA 2OMWA 4M7EA 4XOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMU A;  1FT8 A;  2P1O B;  3RFE A;  4XSQ A;  4R07 A;  5CMP A;  1OTN A;  1QYY A;  4RWT C;  3RJ0 A;  3CVR A;  3ULA A;  1O6T A;  1OTM A;  5AWA A;  5GQR K;  3O53 A;  3OGL B;  4FD0 A;  3G39 A;  4H09 A;  3E6J A;  2XOT A;  4GLP A;  4R5C A;  4BSU A;  5B0N A;  1XEC A;  3DZE A;  1W8A A;  4PSJ A;  3WPE A;  1JL5 A;  4WYK A;  2AST B;  4K17 A;  1FS2 A;  2Z7X B;  4PKI G;  1M9S A;  1OTO A;  4KT1 A;  4FHO A;  4KNG A;  4MN8 B;  4Q62 A;  3SB4 A;  1WWL A;  1A4Y A;  4U06 A;  2V9S A;  3RGZ A;  3RW7 A;  4CIL A;  4LXS A;  3E4G A;  2ID5 A;  1ZIW A;  4ECN A;  3UN9 A;  3UL7 A;  5GS0 A;  2Y5Q A;  1D0B A;  2P1P B;  3ZYN A;  2WQW A;  4XGO A;  3WPI A;  5GMF A;  4CC4 A;  2P1M B;  3C6O B;  3RFS A;  4HQ1 A;  1IO0 A;  1K5G C;  4Z79 A;  2A0Z A;  1XEU A;  3REZ A;  4BV4 R;  3WPC A;  3CIG A;  4V2E A;  3UL9 A;  5HZL B;  2Z65 A;  3O6N A;  3TSR E;  4Y61 B;  2CA6 A;  3C6P B;  4R6F A;  3OJA A;  4Z94 G;  4BSS A;  2V70 A;  4U09 A;  3ZYJ A;  3G06 A;  5AWD A;  3RW6 A;  2WQV A;  4QC0 A;  4WP6 A;  3RFJ A;  4LXR A;  1A9N A;  2O6R A;  1M0Z A;  1DCE A;  1K5D C;  1H6T A;  3PMH G;  3ULV A;  3W3L A;  5IJD A;  3ULU A;  4V2D A;  1OGQ A;  2WQX A;  4R6J A;  3C6N B;  4IM6 A;  1Z7X W;  3M18 A;  5B4P A;  2BNH A;  4PER A;  2IFG A;  3G04 C;  2Q4G W;  4Q3I A;  4CP6 A;  1KOH A;  4Z61 C;  3VQ1 A;  2UZY A;  3WN4 A;  3WPG A;  2Z62 A;  4OQT A;  1GWB A;  4RCA B;  2WFH A;  4LI2 A;  3WPF A;  2Z66 A;  4CC4 C;  3E2J A;  4NKH A;  4P8S A;  2OMZ A;  4LSA A;  4UFR A;  4R09 A;  1DS9 A;  3OGM B;  5GS2 B;  1O6V A;  1FO1 A;  3GOZ A;  2OMV A;  3ZYI A;  1XKU A;  2P1N B;  5HDH A;  4NKG A;  4L3F A;  3W3N A;  4B8C D;  5CMN A;  4R6A A;  4TZH A;  2R9U A;  1P8T A;  4LSX C;  4C2B B;  3OJA B;  2Z64 A;  4V2C A;  3OGK B;  4P91 A;  2JE1 A;  5B0T A;  3G3A A;  4Q3G A;  5AWC A;  5IYX C;  1XCD A;  2OMY A;  3FXI A;  4U08 A;  4AY9 X;  2Z81 A;  3A79 B;  4AW4 A;  5D3I A;  2OMT A;  4QBZ A;  4ECO A;  4LSX A;  4FCG A;  1P8V A;  3UL8 A;  1OZN A;  3W3M A;  4R0A A;  3M19 A;  1G9U A;  4MQW X;  5GMG A;  4PQ8 A;  4GT6 A;  5IJB A;  4C2A B;  1DFJ I;  1PGV A;  3W3J A;  3VQ2 A;  4Z8G A;  4G8A A;  2Z63 A;  4FS7 A;  4BSR A;  2BEX A;  1M10 B;  1M9L A;  1OOK G;  3G3B A;  3BZ5 A;  2V9T B;  4Z64 C;  3RGX A;  4KXF B;  4ARR A;  2JQD A;  2RA8 A;  4LI1 A;  3WPB A;  4R58 A;  1XWD C;  3W3K A;  4J4L A;  4FDW A;  3KJ4 A;  5GMH A;  4I6J B;  4RCW A;  1LTX A;  2FT3 A;  2ELL A;  3ZYO A;  3W3G A;  2Z7X A;  1YRG A;  2UZX A;  3WPH A;  2ASS B;  5FTT B;  2OMX A;  4QXE A;  5A5C A;  3JB9 j;  3P72 A;  5AWB A;  2O6S A;  4U7L A;  3RIZ A;  1U0N D;  3CIY A;  2P1Q B;  2XWT C;  5AZ5 A;  2WQU A;  4R6G A;  5IJC A;  1FQV A;  4M7E C;  1SQ0 B;  4FMZ A;  4EZG A;  3WPD A;  4CNC A;  4ARN A;  4CNM A;  4L3A A;  2O6Q A;  4R5D A;  1O6S A;  4R08 A;  3E3Z A;  4YEB B;  4PEQ B;  1KOO A;  2JE0 A;  1H6U A;  5LFN A;  4LSC A;  1P9A G;  2Z82 A;  2RR6 A;  4J0M A;  2OMW A;  4M7E A;  4XOS A; 
#chains in the Genus database with same CATH topology
 2OMU A;  1FT8 A;  2P1O B;  3RFE A;  4XSQ A;  4R07 A;  5CMP A;  1OTN A;  1QYY A;  4RWT C;  3RJ0 A;  3CVR A;  3ULA A;  1O6T A;  1OTM A;  5AWA A;  5GQR K;  3O53 A;  3OGL B;  4FD0 A;  3G39 A;  4H09 A;  3E6J A;  2XOT A;  4GLP A;  4R5C A;  4BSU A;  5B0N A;  1XEC A;  3DZE A;  1W8A A;  4PSJ A;  3WPE A;  1JL5 A;  4WYK A;  2AST B;  4K17 A;  1FS2 A;  2Z7X B;  4PKI G;  1M9S A;  1OTO A;  4KT1 A;  4FHO A;  4KNG A;  4MN8 B;  4Q62 A;  3SB4 A;  1WWL A;  1A4Y A;  4U06 A;  2V9S A;  3RGZ A;  3RW7 A;  4CIL A;  4LXS A;  3E4G A;  2ID5 A;  1ZIW A;  4ECN A;  3UN9 A;  3UL7 A;  5GS0 A;  2Y5Q A;  1D0B A;  2P1P B;  3ZYN A;  2WQW A;  4XGO A;  3WPI A;  5GMF A;  4CC4 A;  2P1M B;  3C6O B;  3RFS A;  4HQ1 A;  1IO0 A;  1K5G C;  4Z79 A;  2A0Z A;  1XEU A;  4NZT M;  3REZ A;  4BV4 R;  3WPC A;  3CIG A;  4V2E A;  3UL9 A;  5HZL B;  2Z65 A;  3O6N A;  3TSR E;  4Y61 B;  2CA6 A;  3C6P B;  4R6F A;  3OJA A;  4Z94 G;  4BSS A;  2V70 A;  4U09 A;  3ZYJ A;  3G06 A;  5AWD A;  3RW6 A;  2WQV A;  4QC0 A;  4WP6 A;  3RFJ A;  4LXR A;  1A9N A;  2O6R A;  1M0Z A;  1DCE A;  1K5D C;  1H6T A;  3PMH G;  3ULV A;  3W3L A;  5IJD A;  3ULU A;  4V2D A;  1OGQ A;  2WQX A;  4R6J A;  3C6N B;  4IM6 A;  1Z7X W;  3M18 A;  5B4P A;  2BNH A;  4PER A;  2IFG A;  3G04 C;  2Q4G W;  4Q3I A;  4CP6 A;  1KOH A;  4Z61 C;  3VQ1 A;  2UZY A;  3WN4 A;  3WPG A;  2Z62 A;  4OQT A;  1GWB A;  4RCA B;  2WFH A;  4LI2 A;  3WPF A;  2Z66 A;  4CC4 C;  3E2J A;  4NKH A;  4P8S A;  2OMZ A;  4LSA A;  4UFR A;  4R09 A;  1DS9 A;  3OGM B;  5GS2 B;  1O6V A;  1FO1 A;  3GOZ A;  2OMV A;  3ZYI A;  1XKU A;  2P1N B;  5HDH A;  4NKG A;  4L3F A;  3W3N A;  4B8C D;  5CMN A;  4R6A A;  4TZH A;  2R9U A;  1P8T A;  4LSX C;  4C2B B;  3OJA B;  2Z64 A;  4V2C A;  3OGK B;  4P91 A;  2JE1 A;  5B0T A;  3G3A A;  4Q3G A;  5AWC A;  5IYX C;  1XCD A;  2OMY A;  3FXI A;  4U08 A;  4AY9 X;  2Z81 A;  3A79 B;  4AW4 A;  5D3I A;  2OMT A;  4QBZ A;  4ECO A;  4LSX A;  4FCG A;  1P8V A;  3UL8 A;  1OZN A;  3W3M A;  4R0A A;  3M19 A;  1G9U A;  4MQW X;  5GMG A;  4PQ8 A;  4GT6 A;  5IJB A;  4C2A B;  1DFJ I;  1PGV A;  3W3J A;  3VQ2 A;  4Z8G A;  4G8A A;  2Z63 A;  4FS7 A;  4BSR A;  2BEX A;  1M10 B;  1M9L A;  1OOK G;  3G3B A;  3BZ5 A;  2V9T B;  4Z64 C;  3RGX A;  4KXF B;  4ARR A;  2JQD A;  2RA8 A;  4LI1 A;  3WPB A;  4R58 A;  1XWD C;  3W3K A;  4J4L A;  4FDW A;  3KJ4 A;  5GMH A;  4I6J B;  4RCW A;  1LTX A;  2FT3 A;  2ELL A;  3ZYO A;  3W3G A;  2Z7X A;  1YRG A;  2UZX A;  3WPH A;  2ASS B;  5FTT B;  2OMX A;  4QXE A;  5A5C A;  3JB9 j;  3P72 A;  5AWB A;  2O6S A;  4U7L A;  3RIZ A;  1U0N D;  3CIY A;  2P1Q B;  2XWT C;  5AZ5 A;  2WQU A;  4R6G A;  5IJC A;  1FQV A;  4M7E C;  1SQ0 B;  4FMZ A;  4EZG A;  3WPD A;  4CNC A;  4NZR M;  4ARN A;  4CNM A;  4L3A A;  2O6Q A;  4R5D A;  1O6S A;  4R08 A;  3E3Z A;  4YEB B;  4PEQ B;  1KOO A;  2JE0 A;  1H6U A;  5LFN A;  4LSC A;  1P9A G;  2Z82 A;  2RR6 A;  4J0M A;  2OMW A;  4M7E A;  4XOS A; 
#chains in the Genus database with same CATH homology
 2OMU A;  1FT8 A;  2P1O B;  3RFE A;  4XSQ A;  4R07 A;  5CMP A;  1OTN A;  1QYY A;  4RWT C;  3RJ0 A;  3CVR A;  3ULA A;  1O6T A;  1OTM A;  5AWA A;  5GQR K;  3O53 A;  3OGL B;  4FD0 A;  3G39 A;  4H09 A;  3E6J A;  2XOT A;  4GLP A;  4R5C A;  4BSU A;  5B0N A;  1XEC A;  3DZE A;  1W8A A;  4PSJ A;  3WPE A;  1JL5 A;  4WYK A;  2AST B;  4K17 A;  1FS2 A;  2Z7X B;  4PKI G;  1M9S A;  1OTO A;  4KT1 A;  4FHO A;  4KNG A;  4MN8 B;  4Q62 A;  3SB4 A;  1WWL A;  1A4Y A;  4U06 A;  2V9S A;  3RGZ A;  3RW7 A;  4CIL A;  4LXS A;  3E4G A;  2ID5 A;  1ZIW A;  4ECN A;  3UN9 A;  3UL7 A;  5GS0 A;  2Y5Q A;  1D0B A;  2P1P B;  3ZYN A;  2WQW A;  4XGO A;  3WPI A;  5GMF A;  4CC4 A;  2P1M B;  3C6O B;  3RFS A;  4HQ1 A;  1IO0 A;  1K5G C;  4Z79 A;  2A0Z A;  1XEU A;  3REZ A;  4BV4 R;  3WPC A;  3CIG A;  4V2E A;  3UL9 A;  5HZL B;  2Z65 A;  3O6N A;  3TSR E;  4Y61 B;  2CA6 A;  3C6P B;  4R6F A;  3OJA A;  4Z94 G;  4BSS A;  2V70 A;  4U09 A;  3ZYJ A;  3G06 A;  5AWD A;  3RW6 A;  2WQV A;  4QC0 A;  4WP6 A;  3RFJ A;  4LXR A;  1A9N A;  2O6R A;  1M0Z A;  1DCE A;  1K5D C;  1H6T A;  3PMH G;  3ULV A;  3W3L A;  5IJD A;  3ULU A;  4V2D A;  1OGQ A;  2WQX A;  4R6J A;  3C6N B;  4IM6 A;  1Z7X W;  3M18 A;  5B4P A;  2BNH A;  4PER A;  2IFG A;  3G04 C;  2Q4G W;  4Q3I A;  4CP6 A;  1KOH A;  4Z61 C;  3VQ1 A;  2UZY A;  3WN4 A;  3WPG A;  2Z62 A;  4OQT A;  1GWB A;  4RCA B;  2WFH A;  4LI2 A;  3WPF A;  2Z66 A;  4CC4 C;  3E2J A;  4NKH A;  4P8S A;  2OMZ A;  4LSA A;  4UFR A;  4R09 A;  1DS9 A;  3OGM B;  5GS2 B;  1O6V A;  1FO1 A;  3GOZ A;  2OMV A;  3ZYI A;  1XKU A;  2P1N B;  5HDH A;  4NKG A;  4L3F A;  3W3N A;  4B8C D;  5CMN A;  4R6A A;  4TZH A;  2R9U A;  1P8T A;  4LSX C;  4C2B B;  3OJA B;  2Z64 A;  4V2C A;  3OGK B;  4P91 A;  2JE1 A;  5B0T A;  3G3A A;  4Q3G A;  5AWC A;  5IYX C;  1XCD A;  2OMY A;  3FXI A;  4U08 A;  4AY9 X;  2Z81 A;  3A79 B;  4AW4 A;  5D3I A;  2OMT A;  4QBZ A;  4ECO A;  4LSX A;  4FCG A;  1P8V A;  3UL8 A;  1OZN A;  3W3M A;  4R0A A;  3M19 A;  1G9U A;  4MQW X;  5GMG A;  4PQ8 A;  4GT6 A;  5IJB A;  4C2A B;  1DFJ I;  1PGV A;  3W3J A;  3VQ2 A;  4Z8G A;  4G8A A;  2Z63 A;  4FS7 A;  4BSR A;  2BEX A;  1M10 B;  1M9L A;  1OOK G;  3G3B A;  3BZ5 A;  2V9T B;  4Z64 C;  3RGX A;  4KXF B;  4ARR A;  2JQD A;  2RA8 A;  4LI1 A;  3WPB A;  4R58 A;  1XWD C;  3W3K A;  4J4L A;  4FDW A;  3KJ4 A;  5GMH A;  4I6J B;  4RCW A;  1LTX A;  2FT3 A;  2ELL A;  3ZYO A;  3W3G A;  2Z7X A;  1YRG A;  2UZX A;  3WPH A;  2ASS B;  5FTT B;  2OMX A;  4QXE A;  5A5C A;  3JB9 j;  3P72 A;  5AWB A;  2O6S A;  4U7L A;  3RIZ A;  1U0N D;  3CIY A;  2P1Q B;  2XWT C;  5AZ5 A;  2WQU A;  4R6G A;  5IJC A;  1FQV A;  4M7E C;  1SQ0 B;  4FMZ A;  4EZG A;  3WPD A;  4CNC A;  4ARN A;  4CNM A;  4L3A A;  2O6Q A;  4R5D A;  1O6S A;  4R08 A;  3E3Z A;  4YEB B;  4PEQ B;  1KOO A;  2JE0 A;  1H6U A;  5LFN A;  4LSC A;  1P9A G;  2Z82 A;  2RR6 A;  4J0M A;  2OMW A;  4M7E A;  4XOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...