4C2BB

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation in complex with high affinity gpib alpha
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
264
Chain Sequence
PICEVSKVASHLEVNCDKRRLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNRLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQVVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 264
sequence length 264
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4c2bB00
2ASTB 1K5DC 2O6RA 1O6VA 3ULUA 3ZYIA 5B4PA 4R09A 4Z8GA 3E3ZA 1KOHA 4R6FA 4XSQA 4BSRA 4ECNA 4ARNA 3G04C 4C2AB 5B0NA 4B8CD 2OMZA 4P8SA 1M9LA 4LSXA 1OZNA 2OMTA 3G3AA 4U7LA 5AWCA 1DS9A 4KXFB 4UFRA 3WPCA 3ZYNA 3C6NB 2XWTC 2Z64A 4RCWA 2RA8A 3UL7A 3ZYOA 3CIGA 1P9AG 4CNCA 1Z7XW 3ULAA 2O6SA 4J0MA 4GT6A 3WN4A 4Z64C 3TSRE 4FCGA 4KT1A 5IYXC 2Z65A 4U06A 4NKGA 3OGKB 2Z81A 3G39A 1O6SA 4TZHA 4LSCA 3P72A 3ULVA 2CA6A 4FHOA 3WPEA 1H6TA 1M10B 2BNHA 4R58A 2Z62A 1G9UA 1ZIWA 3PMHG 1LTXA 4GLPA 4KNGA 4U09A 1GWBA 3DZEA 2WQUA 4BSSA 1XEUA 3W3LA 1YRGA 5LFNA 1FT8A 5IJCA 3WPHA 4LI1A 3WPBA 4XOSA 2ASSB 2JQDA 2WFHA 3RFJA 4LI2A 4PQ8A 2Z66A 5HDHA 4Q3IA 1SQ0B 4V2EA 3RW6A 2P1QB 3RFSA 5AWAA 1DCEA 4Q62A 5GMFA 2V9TB 3VQ1A 3GOZA 1U0ND 4LXRA 5FTTB 3WPGA 2OMWA 4P91A 3M19A 2Z63A 2WQVA 4BV4R 2Q4GW 3OJAA 2OMXA 3RFEA 1FQVA 5HZLB 1KOOA 3BZ5A 1DFJI 4J4LA 2UZXA 4R6JA 4AY9X 2ELLA 3VQ2A 4LSXC 1OTNA 4PERA 1OTOA 4M7EC 4OQTA 1M0ZA 4FD0A 3UN9A 3REZA 3RIZA 2JE1A 2OMUA 4I6JB 3WPDA 4QXEA 4CC4A 3C6PB 2XOTA 2JE0A 1M9SA 4H09A 1FS2A 5CMPA 5GMHA 3W3KA 1P8TA 2IFGA 2Y5QA 5GQRK 2FT3A 4ARRA 1XKUA 2BEXA 4C2BB 2OMVA 2UZYA 5AWDA 2ID5A 3RGXA 3A79B 3M18A 5GMGA 5GS2B 3E6JA 4R08A 5AWBA 3C6OB 4V2CA 4CILA 2Z7XA 4L3FA 5D3IA 4R0AA 1A9NA 4IM6A 3FXIA 4R5DA 1P8VA 4R6GA 3OGLB 2P1OB 3OJAB 4NKHA 4Z61C 4Q3GA 3E2JA 3WPIA 4WP6A 3RJ0A 3CIYA 4CP6A 1JL5A 4R6AA 1D0BA 1H6UA 4K17A 4EZGA 4R5CA 1K5GC 1OTMA 1WWLA 4XGOA 4WYKA 2OMYA 5CMNA 4Z94G 4R07A 3W3GA 1XWDC 3CVRA 2P1NB 1W8AA 3W3JA 4QBZA 3E4GA 4FMZA 3UL8A 1OOKG 4M7EA 1A4YA 3KJ4A 3RW7A 4L3AA 4MQWX 4FS7A 3RGZA 3O53A 4HQ1A 3OGMB 3G06A 1XECA 4LXSA 5IJDA 4BSUA 1XCDA 2O6QA 4PEQB 2P1MB 4RCAB 1IO0A 4FDWA 4V2DA 4AW4A 4ECOA 4PKIG 4G8AA 1PGVA 4YEBB 5GS0A 4MN8B 2RR6A 1QYYA 4CNMA 4RWTC 2WQXA 5AZ5A 3UL9A 2A0ZA 4Y61B 1OGQA 2V70A 3SB4A 2WQWA 2V9SA 2Z82A 3W3MA 4Z79A 3W3NA 5IJBA 2Z7XB 2R9UA 5A5CA 1O6TA 4CC4C 3G3BA 4U08A 4QC0A 3ZYJA 3O6NA 4PSJA 2P1PB 1FO1A 3JB9j 5B0TA 4LSAA 3WPFA
chains in the Genus database with same CATH superfamily
2ASTB 1K5DC 2O6RA 1O6VA 3ULUA 3ZYIA 5B4PA 4R09A 4Z8GA 3E3ZA 1KOHA 4R6FA 4XSQA 4BSRA 4ECNA 4ARNA 3G04C 4C2AB 5B0NA 4B8CD 2OMZA 4P8SA 1M9LA 4LSXA 1OZNA 2OMTA 3G3AA 4U7LA 5AWCA 1DS9A 4KXFB 4UFRA 3WPCA 3ZYNA 3C6NB 2XWTC 2Z64A 4RCWA 2RA8A 3UL7A 3ZYOA 3CIGA 1P9AG 4CNCA 1Z7XW 3ULAA 2O6SA 4J0MA 4GT6A 3WN4A 4Z64C 4NZRM 3TSRE 4FCGA 4KT1A 5IYXC 2Z65A 4U06A 4NKGA 3OGKB 2Z81A 3G39A 1O6SA 4TZHA 4LSCA 3P72A 3ULVA 2CA6A 4FHOA 3WPEA 1H6TA 1M10B 2BNHA 4R58A 2Z62A 1G9UA 1ZIWA 3PMHG 1LTXA 4GLPA 4KNGA 4U09A 1GWBA 3DZEA 2WQUA 4BSSA 1XEUA 3W3LA 1YRGA 5LFNA 1FT8A 5IJCA 3WPHA 4LI1A 3WPBA 4XOSA 2ASSB 2JQDA 2WFHA 3RFJA 4LI2A 4PQ8A 2Z66A 5HDHA 4Q3IA 1SQ0B 4V2EA 3RW6A 2P1QB 3RFSA 5AWAA 1DCEA 4Q62A 5GMFA 2V9TB 3VQ1A 3GOZA 1U0ND 4LXRA 5FTTB 3WPGA 2OMWA 4P91A 3M19A 2Z63A 2WQVA 4BV4R 2Q4GW 3OJAA 2OMXA 3RFEA 1FQVA 5HZLB 1KOOA 3BZ5A 1DFJI 4J4LA 2UZXA 4R6JA 4AY9X 2ELLA 3VQ2A 4LSXC 1OTNA 4PERA 1OTOA 4M7EC 4OQTA 1M0ZA 4FD0A 3UN9A 3REZA 3RIZA 2JE1A 2OMUA 4I6JB 3WPDA 4QXEA 4CC4A 3C6PB 2XOTA 2JE0A 1M9SA 4H09A 1FS2A 5CMPA 5GMHA 3W3KA 1P8TA 2IFGA 2Y5QA 5GQRK 2FT3A 4ARRA 1XKUA 2BEXA 4C2BB 2OMVA 2UZYA 5AWDA 2ID5A 3RGXA 3A79B 3M18A 5GMGA 5GS2B 3E6JA 4R08A 5AWBA 3C6OB 4V2CA 4CILA 2Z7XA 4L3FA 5D3IA 4R0AA 1A9NA 4IM6A 3FXIA 4R5DA 1P8VA 4R6GA 3OGLB 2P1OB 3OJAB 4NKHA 4Z61C 4Q3GA 3E2JA 3WPIA 4WP6A 3RJ0A 3CIYA 4CP6A 1JL5A 4R6AA 1D0BA 1H6UA 4K17A 4EZGA 4R5CA 1K5GC 1OTMA 1WWLA 4XGOA 4WYKA 2OMYA 5CMNA 4Z94G 4R07A 3W3GA 1XWDC 3CVRA 2P1NB 1W8AA 4NZTM 3W3JA 4QBZA 3E4GA 4FMZA 3UL8A 1OOKG 4M7EA 1A4YA 3KJ4A 3RW7A 4L3AA 4MQWX 4FS7A 3RGZA 3O53A 4HQ1A 3OGMB 3G06A 1XECA 4LXSA 5IJDA 4BSUA 1XCDA 2O6QA 4PEQB 2P1MB 4RCAB 1IO0A 4FDWA 4V2DA 4AW4A 4ECOA 4PKIG 4G8AA 1PGVA 4YEBB 5GS0A 4MN8B 2RR6A 1QYYA 4CNMA 4RWTC 2WQXA 5AZ5A 3UL9A 2A0ZA 4Y61B 1OGQA 2V70A 3SB4A 2WQWA 2V9SA 2Z82A 3W3MA 4Z79A 3W3NA 5IJBA 2Z7XB 2R9UA 5A5CA 1O6TA 4CC4C 3G3BA 4U08A 4QC0A 3ZYJA 3O6NA 4PSJA 2P1PB 1FO1A 3JB9j 5B0TA 4LSAA 3WPFA
chains in the Genus database with same CATH topology
2ASTB 1K5DC 2O6RA 1O6VA 3ULUA 3ZYIA 5B4PA 4R09A 4Z8GA 3E3ZA 1KOHA 4R6FA 4XSQA 4BSRA 4ECNA 4ARNA 3G04C 4C2AB 5B0NA 4B8CD 2OMZA 4P8SA 1M9LA 4LSXA 1OZNA 2OMTA 3G3AA 4U7LA 5AWCA 1DS9A 4KXFB 4UFRA 3WPCA 3ZYNA 3C6NB 2XWTC 2Z64A 4RCWA 2RA8A 3UL7A 3ZYOA 3CIGA 1P9AG 4CNCA 1Z7XW 3ULAA 2O6SA 4J0MA 4GT6A 3WN4A 4Z64C 3TSRE 4FCGA 4KT1A 5IYXC 2Z65A 4U06A 4NKGA 3OGKB 2Z81A 3G39A 1O6SA 4TZHA 4LSCA 3P72A 3ULVA 2CA6A 4FHOA 3WPEA 1H6TA 1M10B 2BNHA 4R58A 2Z62A 1G9UA 1ZIWA 3PMHG 1LTXA 4GLPA 4KNGA 4U09A 1GWBA 3DZEA 2WQUA 4BSSA 1XEUA 3W3LA 1YRGA 5LFNA 1FT8A 5IJCA 3WPHA 4LI1A 3WPBA 4XOSA 2ASSB 2JQDA 2WFHA 3RFJA 4LI2A 4PQ8A 2Z66A 5HDHA 4Q3IA 1SQ0B 4V2EA 3RW6A 2P1QB 3RFSA 5AWAA 1DCEA 4Q62A 5GMFA 2V9TB 3VQ1A 3GOZA 1U0ND 4LXRA 5FTTB 3WPGA 2OMWA 4P91A 3M19A 2Z63A 2WQVA 4BV4R 2Q4GW 3OJAA 2OMXA 3RFEA 1FQVA 5HZLB 1KOOA 3BZ5A 1DFJI 4J4LA 2UZXA 4R6JA 4AY9X 2ELLA 3VQ2A 4LSXC 1OTNA 4PERA 1OTOA 4M7EC 4OQTA 1M0ZA 4FD0A 3UN9A 3REZA 3RIZA 2JE1A 2OMUA 4I6JB 3WPDA 4QXEA 4CC4A 3C6PB 2XOTA 2JE0A 1M9SA 4H09A 1FS2A 5CMPA 5GMHA 3W3KA 1P8TA 2IFGA 2Y5QA 5GQRK 2FT3A 4ARRA 1XKUA 2BEXA 4C2BB 2OMVA 2UZYA 5AWDA 2ID5A 3RGXA 3A79B 3M18A 5GMGA 5GS2B 3E6JA 4R08A 5AWBA 3C6OB 4V2CA 4CILA 2Z7XA 4L3FA 5D3IA 4R0AA 1A9NA 4IM6A 3FXIA 4R5DA 1P8VA 4R6GA 3OGLB 2P1OB 3OJAB 4NKHA 4Z61C 4Q3GA 3E2JA 3WPIA 4WP6A 3RJ0A 3CIYA 4CP6A 1JL5A 4R6AA 1D0BA 1H6UA 4K17A 4EZGA 4R5CA 1K5GC 1OTMA 1WWLA 4XGOA 4WYKA 2OMYA 5CMNA 4Z94G 4R07A 3W3GA 1XWDC 3CVRA 2P1NB 1W8AA 3W3JA 4QBZA 3E4GA 4FMZA 3UL8A 1OOKG 4M7EA 1A4YA 3KJ4A 3RW7A 4L3AA 4MQWX 4FS7A 3RGZA 3O53A 4HQ1A 3OGMB 3G06A 1XECA 4LXSA 5IJDA 4BSUA 1XCDA 2O6QA 4PEQB 2P1MB 4RCAB 1IO0A 4FDWA 4V2DA 4AW4A 4ECOA 4PKIG 4G8AA 1PGVA 4YEBB 5GS0A 4MN8B 2RR6A 1QYYA 4CNMA 4RWTC 2WQXA 5AZ5A 3UL9A 2A0ZA 4Y61B 1OGQA 2V70A 3SB4A 2WQWA 2V9SA 2Z82A 3W3MA 4Z79A 3W3NA 5IJBA 2Z7XB 2R9UA 5A5CA 1O6TA 4CC4C 3G3BA 4U08A 4QC0A 3ZYJA 3O6NA 4PSJA 2P1PB 1FO1A 3JB9j 5B0TA 4LSAA 3WPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AST B;  1K5D C;  2O6R A;  1O6V A;  3ULU A;  3ZYI A;  5B4P A;  4R09 A;  4Z8G A;  3E3Z A;  1KOH A;  4R6F A;  4XSQ A;  4BSR A;  4ECN A;  4ARN A;  3G04 C;  4C2A B;  5B0N A;  4B8C D;  2OMZ A;  4P8S A;  1M9L A;  4LSX A;  1OZN A;  2OMT A;  3G3A A;  4U7L A;  5AWC A;  1DS9 A;  4KXF B;  4UFR A;  3WPC A;  3ZYN A;  3C6N B;  2XWT C;  2Z64 A;  4RCW A;  2RA8 A;  3UL7 A;  3ZYO A;  3CIG A;  1P9A G;  4CNC A;  1Z7X W;  3ULA A;  2O6S A;  4J0M A;  4GT6 A;  3WN4 A;  4Z64 C;  3TSR E;  4FCG A;  4KT1 A;  5IYX C;  2Z65 A;  4U06 A;  4NKG A;  3OGK B;  2Z81 A;  3G39 A;  1O6S A;  4TZH A;  4LSC A;  3P72 A;  3ULV A;  2CA6 A;  4FHO A;  3WPE A;  1H6T A;  1M10 B;  2BNH A;  4R58 A;  2Z62 A;  1G9U A;  1ZIW A;  3PMH G;  1LTX A;  4GLP A;  4KNG A;  4U09 A;  1GWB A;  3DZE A;  2WQU A;  4BSS A;  1XEU A;  3W3L A;  1YRG A;  5LFN A;  1FT8 A;  5IJC A;  3WPH A;  4LI1 A;  3WPB A;  4XOS A;  2ASS B;  2JQD A;  2WFH A;  3RFJ A;  4LI2 A;  4PQ8 A;  2Z66 A;  5HDH A;  4Q3I A;  1SQ0 B;  4V2E A;  3RW6 A;  2P1Q B;  3RFS A;  5AWA A;  1DCE A;  4Q62 A;  5GMF A;  2V9T B;  3VQ1 A;  3GOZ A;  1U0N D;  4LXR A;  5FTT B;  3WPG A;  2OMW A;  4P91 A;  3M19 A;  2Z63 A;  2WQV A;  4BV4 R;  2Q4G W;  3OJA A;  2OMX A;  3RFE A;  1FQV A;  5HZL B;  1KOO A;  3BZ5 A;  1DFJ I;  4J4L A;  2UZX A;  4R6J A;  4AY9 X;  2ELL A;  3VQ2 A;  4LSX C;  1OTN A;  4PER A;  1OTO A;  4M7E C;  4OQT A;  1M0Z A;  4FD0 A;  3UN9 A;  3REZ A;  3RIZ A;  2JE1 A;  2OMU A;  4I6J B;  3WPD A;  4QXE A;  4CC4 A;  3C6P B;  2XOT A;  2JE0 A;  1M9S A;  4H09 A;  1FS2 A;  5CMP A;  5GMH A;  3W3K A;  1P8T A;  2IFG A;  2Y5Q A;  5GQR K;  2FT3 A;  4ARR A;  1XKU A;  2BEX A;  4C2B B;  2OMV A;  2UZY A;  5AWD A;  2ID5 A;  3RGX A;  3A79 B;  3M18 A;  5GMG A;  5GS2 B;  3E6J A;  4R08 A;  5AWB A;  3C6O B;  4V2C A;  4CIL A;  2Z7X A;  4L3F A;  5D3I A;  4R0A A;  1A9N A;  4IM6 A;  3FXI A;  4R5D A;  1P8V A;  4R6G A;  3OGL B;  2P1O B;  3OJA B;  4NKH A;  4Z61 C;  4Q3G A;  3E2J A;  3WPI A;  4WP6 A;  3RJ0 A;  3CIY A;  4CP6 A;  1JL5 A;  4R6A A;  1D0B A;  1H6U A;  4K17 A;  4EZG A;  4R5C A;  1K5G C;  1OTM A;  1WWL A;  4XGO A;  4WYK A;  2OMY A;  5CMN A;  4Z94 G;  4R07 A;  3W3G A;  1XWD C;  3CVR A;  2P1N B;  1W8A A;  3W3J A;  4QBZ A;  3E4G A;  4FMZ A;  3UL8 A;  1OOK G;  4M7E A;  1A4Y A;  3KJ4 A;  3RW7 A;  4L3A A;  4MQW X;  4FS7 A;  3RGZ A;  3O53 A;  4HQ1 A;  3OGM B;  3G06 A;  1XEC A;  4LXS A;  5IJD A;  4BSU A;  1XCD A;  2O6Q A;  4PEQ B;  2P1M B;  4RCA B;  1IO0 A;  4FDW A;  4V2D A;  4AW4 A;  4ECO A;  4PKI G;  4G8A A;  1PGV A;  4YEB B;  5GS0 A;  4MN8 B;  2RR6 A;  1QYY A;  4CNM A;  4RWT C;  2WQX A;  5AZ5 A;  3UL9 A;  2A0Z A;  4Y61 B;  1OGQ A;  2V70 A;  3SB4 A;  2WQW A;  2V9S A;  2Z82 A;  3W3M A;  4Z79 A;  3W3N A;  5IJB A;  2Z7X B;  2R9U A;  5A5C A;  1O6T A;  4CC4 C;  3G3B A;  4U08 A;  4QC0 A;  3ZYJ A;  3O6N A;  4PSJ A;  2P1P B;  1FO1 A;  3JB9 j;  5B0T A;  4LSA A;  3WPF A; 
#chains in the Genus database with same CATH topology
 2AST B;  1K5D C;  2O6R A;  1O6V A;  3ULU A;  3ZYI A;  5B4P A;  4R09 A;  4Z8G A;  3E3Z A;  1KOH A;  4R6F A;  4XSQ A;  4BSR A;  4ECN A;  4ARN A;  3G04 C;  4C2A B;  5B0N A;  4B8C D;  2OMZ A;  4P8S A;  1M9L A;  4LSX A;  1OZN A;  2OMT A;  3G3A A;  4U7L A;  5AWC A;  1DS9 A;  4KXF B;  4UFR A;  3WPC A;  3ZYN A;  3C6N B;  2XWT C;  2Z64 A;  4RCW A;  2RA8 A;  3UL7 A;  3ZYO A;  3CIG A;  1P9A G;  4CNC A;  1Z7X W;  3ULA A;  2O6S A;  4J0M A;  4GT6 A;  3WN4 A;  4Z64 C;  4NZR M;  3TSR E;  4FCG A;  4KT1 A;  5IYX C;  2Z65 A;  4U06 A;  4NKG A;  3OGK B;  2Z81 A;  3G39 A;  1O6S A;  4TZH A;  4LSC A;  3P72 A;  3ULV A;  2CA6 A;  4FHO A;  3WPE A;  1H6T A;  1M10 B;  2BNH A;  4R58 A;  2Z62 A;  1G9U A;  1ZIW A;  3PMH G;  1LTX A;  4GLP A;  4KNG A;  4U09 A;  1GWB A;  3DZE A;  2WQU A;  4BSS A;  1XEU A;  3W3L A;  1YRG A;  5LFN A;  1FT8 A;  5IJC A;  3WPH A;  4LI1 A;  3WPB A;  4XOS A;  2ASS B;  2JQD A;  2WFH A;  3RFJ A;  4LI2 A;  4PQ8 A;  2Z66 A;  5HDH A;  4Q3I A;  1SQ0 B;  4V2E A;  3RW6 A;  2P1Q B;  3RFS A;  5AWA A;  1DCE A;  4Q62 A;  5GMF A;  2V9T B;  3VQ1 A;  3GOZ A;  1U0N D;  4LXR A;  5FTT B;  3WPG A;  2OMW A;  4P91 A;  3M19 A;  2Z63 A;  2WQV A;  4BV4 R;  2Q4G W;  3OJA A;  2OMX A;  3RFE A;  1FQV A;  5HZL B;  1KOO A;  3BZ5 A;  1DFJ I;  4J4L A;  2UZX A;  4R6J A;  4AY9 X;  2ELL A;  3VQ2 A;  4LSX C;  1OTN A;  4PER A;  1OTO A;  4M7E C;  4OQT A;  1M0Z A;  4FD0 A;  3UN9 A;  3REZ A;  3RIZ A;  2JE1 A;  2OMU A;  4I6J B;  3WPD A;  4QXE A;  4CC4 A;  3C6P B;  2XOT A;  2JE0 A;  1M9S A;  4H09 A;  1FS2 A;  5CMP A;  5GMH A;  3W3K A;  1P8T A;  2IFG A;  2Y5Q A;  5GQR K;  2FT3 A;  4ARR A;  1XKU A;  2BEX A;  4C2B B;  2OMV A;  2UZY A;  5AWD A;  2ID5 A;  3RGX A;  3A79 B;  3M18 A;  5GMG A;  5GS2 B;  3E6J A;  4R08 A;  5AWB A;  3C6O B;  4V2C A;  4CIL A;  2Z7X A;  4L3F A;  5D3I A;  4R0A A;  1A9N A;  4IM6 A;  3FXI A;  4R5D A;  1P8V A;  4R6G A;  3OGL B;  2P1O B;  3OJA B;  4NKH A;  4Z61 C;  4Q3G A;  3E2J A;  3WPI A;  4WP6 A;  3RJ0 A;  3CIY A;  4CP6 A;  1JL5 A;  4R6A A;  1D0B A;  1H6U A;  4K17 A;  4EZG A;  4R5C A;  1K5G C;  1OTM A;  1WWL A;  4XGO A;  4WYK A;  2OMY A;  5CMN A;  4Z94 G;  4R07 A;  3W3G A;  1XWD C;  3CVR A;  2P1N B;  1W8A A;  4NZT M;  3W3J A;  4QBZ A;  3E4G A;  4FMZ A;  3UL8 A;  1OOK G;  4M7E A;  1A4Y A;  3KJ4 A;  3RW7 A;  4L3A A;  4MQW X;  4FS7 A;  3RGZ A;  3O53 A;  4HQ1 A;  3OGM B;  3G06 A;  1XEC A;  4LXS A;  5IJD A;  4BSU A;  1XCD A;  2O6Q A;  4PEQ B;  2P1M B;  4RCA B;  1IO0 A;  4FDW A;  4V2D A;  4AW4 A;  4ECO A;  4PKI G;  4G8A A;  1PGV A;  4YEB B;  5GS0 A;  4MN8 B;  2RR6 A;  1QYY A;  4CNM A;  4RWT C;  2WQX A;  5AZ5 A;  3UL9 A;  2A0Z A;  4Y61 B;  1OGQ A;  2V70 A;  3SB4 A;  2WQW A;  2V9S A;  2Z82 A;  3W3M A;  4Z79 A;  3W3N A;  5IJB A;  2Z7X B;  2R9U A;  5A5C A;  1O6T A;  4CC4 C;  3G3B A;  4U08 A;  4QC0 A;  3ZYJ A;  3O6N A;  4PSJ A;  2P1P B;  1FO1 A;  3JB9 j;  5B0T A;  4LSA A;  3WPF A; 
#chains in the Genus database with same CATH homology
 2AST B;  1K5D C;  2O6R A;  1O6V A;  3ULU A;  3ZYI A;  5B4P A;  4R09 A;  4Z8G A;  3E3Z A;  1KOH A;  4R6F A;  4XSQ A;  4BSR A;  4ECN A;  4ARN A;  3G04 C;  4C2A B;  5B0N A;  4B8C D;  2OMZ A;  4P8S A;  1M9L A;  4LSX A;  1OZN A;  2OMT A;  3G3A A;  4U7L A;  5AWC A;  1DS9 A;  4KXF B;  4UFR A;  3WPC A;  3ZYN A;  3C6N B;  2XWT C;  2Z64 A;  4RCW A;  2RA8 A;  3UL7 A;  3ZYO A;  3CIG A;  1P9A G;  4CNC A;  1Z7X W;  3ULA A;  2O6S A;  4J0M A;  4GT6 A;  3WN4 A;  4Z64 C;  3TSR E;  4FCG A;  4KT1 A;  5IYX C;  2Z65 A;  4U06 A;  4NKG A;  3OGK B;  2Z81 A;  3G39 A;  1O6S A;  4TZH A;  4LSC A;  3P72 A;  3ULV A;  2CA6 A;  4FHO A;  3WPE A;  1H6T A;  1M10 B;  2BNH A;  4R58 A;  2Z62 A;  1G9U A;  1ZIW A;  3PMH G;  1LTX A;  4GLP A;  4KNG A;  4U09 A;  1GWB A;  3DZE A;  2WQU A;  4BSS A;  1XEU A;  3W3L A;  1YRG A;  5LFN A;  1FT8 A;  5IJC A;  3WPH A;  4LI1 A;  3WPB A;  4XOS A;  2ASS B;  2JQD A;  2WFH A;  3RFJ A;  4LI2 A;  4PQ8 A;  2Z66 A;  5HDH A;  4Q3I A;  1SQ0 B;  4V2E A;  3RW6 A;  2P1Q B;  3RFS A;  5AWA A;  1DCE A;  4Q62 A;  5GMF A;  2V9T B;  3VQ1 A;  3GOZ A;  1U0N D;  4LXR A;  5FTT B;  3WPG A;  2OMW A;  4P91 A;  3M19 A;  2Z63 A;  2WQV A;  4BV4 R;  2Q4G W;  3OJA A;  2OMX A;  3RFE A;  1FQV A;  5HZL B;  1KOO A;  3BZ5 A;  1DFJ I;  4J4L A;  2UZX A;  4R6J A;  4AY9 X;  2ELL A;  3VQ2 A;  4LSX C;  1OTN A;  4PER A;  1OTO A;  4M7E C;  4OQT A;  1M0Z A;  4FD0 A;  3UN9 A;  3REZ A;  3RIZ A;  2JE1 A;  2OMU A;  4I6J B;  3WPD A;  4QXE A;  4CC4 A;  3C6P B;  2XOT A;  2JE0 A;  1M9S A;  4H09 A;  1FS2 A;  5CMP A;  5GMH A;  3W3K A;  1P8T A;  2IFG A;  2Y5Q A;  5GQR K;  2FT3 A;  4ARR A;  1XKU A;  2BEX A;  4C2B B;  2OMV A;  2UZY A;  5AWD A;  2ID5 A;  3RGX A;  3A79 B;  3M18 A;  5GMG A;  5GS2 B;  3E6J A;  4R08 A;  5AWB A;  3C6O B;  4V2C A;  4CIL A;  2Z7X A;  4L3F A;  5D3I A;  4R0A A;  1A9N A;  4IM6 A;  3FXI A;  4R5D A;  1P8V A;  4R6G A;  3OGL B;  2P1O B;  3OJA B;  4NKH A;  4Z61 C;  4Q3G A;  3E2J A;  3WPI A;  4WP6 A;  3RJ0 A;  3CIY A;  4CP6 A;  1JL5 A;  4R6A A;  1D0B A;  1H6U A;  4K17 A;  4EZG A;  4R5C A;  1K5G C;  1OTM A;  1WWL A;  4XGO A;  4WYK A;  2OMY A;  5CMN A;  4Z94 G;  4R07 A;  3W3G A;  1XWD C;  3CVR A;  2P1N B;  1W8A A;  3W3J A;  4QBZ A;  3E4G A;  4FMZ A;  3UL8 A;  1OOK G;  4M7E A;  1A4Y A;  3KJ4 A;  3RW7 A;  4L3A A;  4MQW X;  4FS7 A;  3RGZ A;  3O53 A;  4HQ1 A;  3OGM B;  3G06 A;  1XEC A;  4LXS A;  5IJD A;  4BSU A;  1XCD A;  2O6Q A;  4PEQ B;  2P1M B;  4RCA B;  1IO0 A;  4FDW A;  4V2D A;  4AW4 A;  4ECO A;  4PKI G;  4G8A A;  1PGV A;  4YEB B;  5GS0 A;  4MN8 B;  2RR6 A;  1QYY A;  4CNM A;  4RWT C;  2WQX A;  5AZ5 A;  3UL9 A;  2A0Z A;  4Y61 B;  1OGQ A;  2V70 A;  3SB4 A;  2WQW A;  2V9S A;  2Z82 A;  3W3M A;  4Z79 A;  3W3N A;  5IJB A;  2Z7X B;  2R9U A;  5A5C A;  1O6T A;  4CC4 C;  3G3B A;  4U08 A;  4QC0 A;  3ZYJ A;  3O6N A;  4PSJ A;  2P1P B;  1FO1 A;  3JB9 j;  5B0T A;  4LSA A;  3WPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...