4C2BB

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation in complex with high affinity gpib alpha
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
264
Chain Sequence
PICEVSKVASHLEVNCDKRRLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNRLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQVVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords VON WILLEBRAND FACTOR
total genus 60
structure length 264
sequence length 264
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4c2bB00
1WWLA 4AY9X 2O6SA 1A4YA 2XWTC 2Z7XA 1GWBA 4FHOA 2O6RA 4M7EC 1M10B 1LTXA 2P1PB 3E2JA 4KNGA 4LSXA 3ULVA 4YEBB 1Z7XW 2UZXA 4PEQB 2OMYA 5D3IA 1DFJI 2WQVA 4FD0A 4KXFB 4Z79A 1JL5A 1KOOA 5AZ5A 3OJAB 3W3JA 3OJAA 4PSJA 3WPFA 2RA8A 4L3AA 3W3MA 1H6TA 4XOSA 3WN4A 4I6JB 4ECNA 2Z64A 4RWTC 4UFRA 3WPCA 5FTTB 4TZHA 1P8TA 3E6JA 4GT6A 1OTNA 4WYKA 1FT8A 4FCGA 4R6AA 5GS0A 5HZLB 3RIZA 4CNMA 4LI2A 3WPDA 2ASTB 3UL8A 4BV4R 3A79B 4EZGA 3C6PB 3FXIA 2Z82A 3RGZA 3OGMB 1M9LA 3O53A 3PMHG 4BSSA 4CNCA 4P8SA 4P91A 1XCDA 1YRGA 2OMVA 2RR6A 4R58A 5CMNA 2V9SA 2WQUA 1OZNA 3RFSA 2P1NB 3RJ0A 1P9AG 4R0AA 3W3GA 5AWCA 3DZEA 4LSXC 2WFHA 1XEUA 2WQWA 5CMPA 5GMGA 2FT3A 1A9NA 4R09A 4KT1A 2WQXA 3O6NA 1OGQA 3WPGA 3WPHA 3GOZA 3RW7A 4R08A 2P1OB 1KOHA 2CA6A 4Q62A 4FS7A 1FO1A 1O6TA 5IJDA 4PKIG 1OOKG 4C2BB 4WP6A 4LSAA 3W3KA 2ELLA 4R6GA 3JB9j 3RFEA 4Z61C 4BSUA 2OMXA 5AWAA 2Y5QA 3C6OB 4NKHA 4ARNA 4CC4C 4H09A 1D0BA 5IYXC 4J4LA 4XGOA 5GQRK 2JE0A 2Z62A 2JE1A 2O6QA 3TSRE 5HDHA 3CVRA 4Q3GA 1M9SA 4QXEA 3G04C 3UL9A 4CILA 2IFGA 2A0ZA 3CIGA 4OQTA 4U06A 4Z8GA 3E3ZA 3M18A 4FDWA 2Z81A 3RFJA 3VQ1A 3W3NA 2R9UA 3C6NB 4BSRA 1XKUA 2BEXA 2Z7XB 3BZ5A 4NKGA 4U7LA 3VQ2A 3ZYOA 4AW4A 4R6JA 3WPIA 2Z65A 2BNHA 1QYYA 3W3LA 2XOTA 4R5CA 3ULUA 1DS9A 4B8CD 4Y61B 3ZYNA 5IJBA 1W8AA 4LXSA 1K5GC 4Q3IA 2V9TB 4HQ1A 3UN9A 5IJCA 1FS2A 4MQWX 1P8VA 5LFNA 3KJ4A 4U08A 3UL7A 1OTOA 3M19A 4MN8B 2P1QB 4QC0A 1H6UA 2Q4GW 4K17A 5B0TA 3G39A 2Z63A 1SQ0B 3RW6A 5B4PA 4QBZA 4GLPA 3E4GA 4R07A 2ID5A 3P72A 3ZYIA 3REZA 1G9UA 1PGVA 3ZYJA 5B0NA 2Z66A 4PERA 3G3BA 3CIYA 2ASSB 3OGKB 3SB4A 5GMFA 3WPEA 1K5DC 1O6VA 4XSQA 2OMZA 5GS2B 4U09A 4V2DA 4RCAB 2UZYA 4LXRA 4ECOA 5GMHA 2V70A 4RCWA 1DCEA 1M0ZA 5A5CA 4CP6A 1OTMA 3ULAA 1IO0A 1XECA 2OMUA 3OGLB 1U0ND 5AWBA 3G3AA 2P1MB 1FQVA 4V2CA 4R6FA 2JQDA 3G06A 4LI1A 4R5DA 4Z64C 2OMWA 4G8AA 4PQ8A 4CC4A 5AWDA 3WPBA 4Z94G 4V2EA 2OMTA 1ZIWA 4IM6A 4LSCA 4ARRA 1O6SA 4L3FA 3RGXA 4C2AB 4J0MA 4M7EA 4FMZA 1XWDC
chains in the Genus database with same CATH superfamily
1WWLA 4AY9X 2O6SA 1A4YA 2XWTC 2Z7XA 1GWBA 4FHOA 2O6RA 4M7EC 1M10B 1LTXA 2P1PB 3E2JA 4KNGA 4LSXA 3ULVA 4YEBB 1Z7XW 2UZXA 4PEQB 2OMYA 5D3IA 1DFJI 2WQVA 4FD0A 4KXFB 4Z79A 1JL5A 1KOOA 5AZ5A 3OJAB 3W3JA 3OJAA 4PSJA 3WPFA 2RA8A 4L3AA 3W3MA 1H6TA 4XOSA 3WN4A 4I6JB 4ECNA 2Z64A 4RWTC 4UFRA 3WPCA 5FTTB 4TZHA 1P8TA 3E6JA 4GT6A 1OTNA 4WYKA 1FT8A 4FCGA 4R6AA 5GS0A 5HZLB 3RIZA 4CNMA 4LI2A 3WPDA 2ASTB 3UL8A 4BV4R 3A79B 4EZGA 3C6PB 3FXIA 2Z82A 3RGZA 3OGMB 1M9LA 3O53A 3PMHG 4BSSA 4CNCA 4P8SA 4P91A 1XCDA 1YRGA 2OMVA 2RR6A 4R58A 5CMNA 2V9SA 2WQUA 1OZNA 3RFSA 2P1NB 3RJ0A 1P9AG 4R0AA 3W3GA 5AWCA 3DZEA 4LSXC 2WFHA 1XEUA 2WQWA 5CMPA 5GMGA 2FT3A 1A9NA 4R09A 4KT1A 2WQXA 3O6NA 1OGQA 3WPGA 3WPHA 3GOZA 3RW7A 4R08A 2P1OB 1KOHA 2CA6A 4Q62A 4FS7A 1FO1A 1O6TA 5IJDA 4PKIG 1OOKG 4C2BB 4WP6A 4LSAA 3W3KA 2ELLA 4R6GA 3JB9j 3RFEA 4Z61C 4BSUA 2OMXA 5AWAA 2Y5QA 3C6OB 4NKHA 4ARNA 4CC4C 4H09A 1D0BA 5IYXC 4J4LA 4XGOA 5GQRK 2JE0A 2Z62A 2JE1A 2O6QA 3TSRE 5HDHA 3CVRA 4Q3GA 1M9SA 4QXEA 3G04C 3UL9A 4CILA 2IFGA 2A0ZA 3CIGA 4OQTA 4U06A 4Z8GA 3E3ZA 3M18A 4FDWA 2Z81A 3RFJA 3VQ1A 3W3NA 2R9UA 3C6NB 4BSRA 1XKUA 2BEXA 2Z7XB 3BZ5A 4NKGA 4U7LA 3VQ2A 3ZYOA 4AW4A 4R6JA 3WPIA 2Z65A 2BNHA 1QYYA 3W3LA 2XOTA 4R5CA 3ULUA 1DS9A 4B8CD 4Y61B 3ZYNA 5IJBA 1W8AA 4LXSA 1K5GC 4Q3IA 2V9TB 4HQ1A 3UN9A 5IJCA 1FS2A 4MQWX 1P8VA 5LFNA 3KJ4A 4U08A 3UL7A 1OTOA 3M19A 4MN8B 2P1QB 4QC0A 1H6UA 2Q4GW 4K17A 5B0TA 3G39A 2Z63A 1SQ0B 3RW6A 5B4PA 4QBZA 4GLPA 3E4GA 4R07A 2ID5A 3P72A 3ZYIA 3REZA 1G9UA 1PGVA 3ZYJA 5B0NA 2Z66A 4PERA 3G3BA 3CIYA 2ASSB 3OGKB 3SB4A 5GMFA 3WPEA 4NZRM 1K5DC 1O6VA 4XSQA 2OMZA 5GS2B 4U09A 4V2DA 4RCAB 2UZYA 4LXRA 4ECOA 5GMHA 2V70A 4RCWA 1DCEA 1M0ZA 5A5CA 4CP6A 1OTMA 3ULAA 1IO0A 1XECA 2OMUA 3OGLB 1U0ND 5AWBA 3G3AA 2P1MB 1FQVA 4V2CA 4R6FA 2JQDA 3G06A 4LI1A 4R5DA 4Z64C 2OMWA 4G8AA 4PQ8A 4CC4A 5AWDA 3WPBA 4Z94G 4V2EA 2OMTA 1ZIWA 4IM6A 4LSCA 4ARRA 1O6SA 4L3FA 4NZTM 4C2AB 4J0MA 3RGXA 4M7EA 4FMZA 1XWDC
chains in the Genus database with same CATH topology
1WWLA 4AY9X 2O6SA 1A4YA 2XWTC 2Z7XA 1GWBA 4FHOA 2O6RA 4M7EC 1M10B 1LTXA 2P1PB 3E2JA 4KNGA 4LSXA 3ULVA 4YEBB 1Z7XW 2UZXA 4PEQB 2OMYA 5D3IA 1DFJI 2WQVA 4FD0A 4KXFB 4Z79A 1JL5A 1KOOA 5AZ5A 3OJAB 3W3JA 3OJAA 4PSJA 3WPFA 2RA8A 4L3AA 3W3MA 1H6TA 4XOSA 3WN4A 4I6JB 4ECNA 2Z64A 4RWTC 4UFRA 3WPCA 5FTTB 4TZHA 1P8TA 3E6JA 4GT6A 1OTNA 4WYKA 1FT8A 4FCGA 4R6AA 5GS0A 5HZLB 3RIZA 4CNMA 4LI2A 3WPDA 2ASTB 3UL8A 4BV4R 3A79B 4EZGA 3C6PB 3FXIA 2Z82A 3RGZA 3OGMB 1M9LA 3O53A 3PMHG 4BSSA 4CNCA 4P8SA 4P91A 1XCDA 1YRGA 2OMVA 2RR6A 4R58A 5CMNA 2V9SA 2WQUA 1OZNA 3RFSA 2P1NB 3RJ0A 1P9AG 4R0AA 3W3GA 5AWCA 3DZEA 4LSXC 2WFHA 1XEUA 2WQWA 5CMPA 5GMGA 2FT3A 1A9NA 4R09A 4KT1A 2WQXA 3O6NA 1OGQA 3WPGA 3WPHA 3GOZA 3RW7A 4R08A 2P1OB 1KOHA 2CA6A 4Q62A 4FS7A 1FO1A 1O6TA 5IJDA 4PKIG 1OOKG 4C2BB 4WP6A 4LSAA 3W3KA 2ELLA 4R6GA 3JB9j 3RFEA 4Z61C 4BSUA 2OMXA 5AWAA 2Y5QA 3C6OB 4NKHA 4ARNA 4CC4C 4H09A 1D0BA 5IYXC 4J4LA 4XGOA 5GQRK 2JE0A 2Z62A 2JE1A 2O6QA 3TSRE 5HDHA 3CVRA 4Q3GA 1M9SA 4QXEA 3G04C 3UL9A 4CILA 2IFGA 2A0ZA 3CIGA 4OQTA 4U06A 4Z8GA 3E3ZA 3M18A 4FDWA 2Z81A 3RFJA 3VQ1A 3W3NA 2R9UA 3C6NB 4BSRA 1XKUA 2BEXA 2Z7XB 3BZ5A 4NKGA 4U7LA 3VQ2A 3ZYOA 4AW4A 4R6JA 3WPIA 2Z65A 2BNHA 1QYYA 3W3LA 2XOTA 4R5CA 3ULUA 1DS9A 4B8CD 4Y61B 3ZYNA 5IJBA 1W8AA 4LXSA 1K5GC 4Q3IA 2V9TB 4HQ1A 3UN9A 5IJCA 1FS2A 4MQWX 1P8VA 5LFNA 3KJ4A 4U08A 3UL7A 1OTOA 3M19A 4MN8B 2P1QB 4QC0A 1H6UA 2Q4GW 4K17A 5B0TA 3G39A 2Z63A 1SQ0B 3RW6A 5B4PA 4QBZA 4GLPA 3E4GA 4R07A 2ID5A 3P72A 3ZYIA 3REZA 1G9UA 1PGVA 3ZYJA 5B0NA 2Z66A 4PERA 3G3BA 3CIYA 2ASSB 3OGKB 3SB4A 5GMFA 3WPEA 1K5DC 1O6VA 4XSQA 2OMZA 5GS2B 4U09A 4V2DA 4RCAB 2UZYA 4LXRA 4ECOA 5GMHA 2V70A 4RCWA 1DCEA 1M0ZA 5A5CA 4CP6A 1OTMA 3ULAA 1IO0A 1XECA 2OMUA 3OGLB 1U0ND 5AWBA 3G3AA 2P1MB 1FQVA 4V2CA 4R6FA 2JQDA 3G06A 4LI1A 4R5DA 4Z64C 2OMWA 4G8AA 4PQ8A 4CC4A 5AWDA 3WPBA 4Z94G 4V2EA 2OMTA 1ZIWA 4IM6A 4LSCA 4ARRA 1O6SA 4L3FA 3RGXA 4C2AB 4J0MA 4M7EA 4FMZA 1XWDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWL A;  4AY9 X;  2O6S A;  1A4Y A;  2XWT C;  2Z7X A;  1GWB A;  4FHO A;  2O6R A;  4M7E C;  1M10 B;  1LTX A;  2P1P B;  3E2J A;  4KNG A;  4LSX A;  3ULV A;  4YEB B;  1Z7X W;  2UZX A;  4PEQ B;  2OMY A;  5D3I A;  1DFJ I;  2WQV A;  4FD0 A;  4KXF B;  4Z79 A;  1JL5 A;  1KOO A;  5AZ5 A;  3OJA B;  3W3J A;  3OJA A;  4PSJ A;  3WPF A;  2RA8 A;  4L3A A;  3W3M A;  1H6T A;  4XOS A;  3WN4 A;  4I6J B;  4ECN A;  2Z64 A;  4RWT C;  4UFR A;  3WPC A;  5FTT B;  4TZH A;  1P8T A;  3E6J A;  4GT6 A;  1OTN A;  4WYK A;  1FT8 A;  4FCG A;  4R6A A;  5GS0 A;  5HZL B;  3RIZ A;  4CNM A;  4LI2 A;  3WPD A;  2AST B;  3UL8 A;  4BV4 R;  3A79 B;  4EZG A;  3C6P B;  3FXI A;  2Z82 A;  3RGZ A;  3OGM B;  1M9L A;  3O53 A;  3PMH G;  4BSS A;  4CNC A;  4P8S A;  4P91 A;  1XCD A;  1YRG A;  2OMV A;  2RR6 A;  4R58 A;  5CMN A;  2V9S A;  2WQU A;  1OZN A;  3RFS A;  2P1N B;  3RJ0 A;  1P9A G;  4R0A A;  3W3G A;  5AWC A;  3DZE A;  4LSX C;  2WFH A;  1XEU A;  2WQW A;  5CMP A;  5GMG A;  2FT3 A;  1A9N A;  4R09 A;  4KT1 A;  2WQX A;  3O6N A;  1OGQ A;  3WPG A;  3WPH A;  3GOZ A;  3RW7 A;  4R08 A;  2P1O B;  1KOH A;  2CA6 A;  4Q62 A;  4FS7 A;  1FO1 A;  1O6T A;  5IJD A;  4PKI G;  1OOK G;  4C2B B;  4WP6 A;  4LSA A;  3W3K A;  2ELL A;  4R6G A;  3JB9 j;  3RFE A;  4Z61 C;  4BSU A;  2OMX A;  5AWA A;  2Y5Q A;  3C6O B;  4NKH A;  4ARN A;  4CC4 C;  4H09 A;  1D0B A;  5IYX C;  4J4L A;  4XGO A;  5GQR K;  2JE0 A;  2Z62 A;  2JE1 A;  2O6Q A;  3TSR E;  5HDH A;  3CVR A;  4Q3G A;  1M9S A;  4QXE A;  3G04 C;  3UL9 A;  4CIL A;  2IFG A;  2A0Z A;  3CIG A;  4OQT A;  4U06 A;  4Z8G A;  3E3Z A;  3M18 A;  4FDW A;  2Z81 A;  3RFJ A;  3VQ1 A;  3W3N A;  2R9U A;  3C6N B;  4BSR A;  1XKU A;  2BEX A;  2Z7X B;  3BZ5 A;  4NKG A;  4U7L A;  3VQ2 A;  3ZYO A;  4AW4 A;  4R6J A;  3WPI A;  2Z65 A;  2BNH A;  1QYY A;  3W3L A;  2XOT A;  4R5C A;  3ULU A;  1DS9 A;  4B8C D;  4Y61 B;  3ZYN A;  5IJB A;  1W8A A;  4LXS A;  1K5G C;  4Q3I A;  2V9T B;  4HQ1 A;  3UN9 A;  5IJC A;  1FS2 A;  4MQW X;  1P8V A;  5LFN A;  3KJ4 A;  4U08 A;  3UL7 A;  1OTO A;  3M19 A;  4MN8 B;  2P1Q B;  4QC0 A;  1H6U A;  2Q4G W;  4K17 A;  5B0T A;  3G39 A;  2Z63 A;  1SQ0 B;  3RW6 A;  5B4P A;  4QBZ A;  4GLP A;  3E4G A;  4R07 A;  2ID5 A;  3P72 A;  3ZYI A;  3REZ A;  1G9U A;  1PGV A;  3ZYJ A;  5B0N A;  2Z66 A;  4PER A;  3G3B A;  3CIY A;  2ASS B;  3OGK B;  3SB4 A;  5GMF A;  3WPE A;  1K5D C;  1O6V A;  4XSQ A;  2OMZ A;  5GS2 B;  4U09 A;  4V2D A;  4RCA B;  2UZY A;  4LXR A;  4ECO A;  5GMH A;  2V70 A;  4RCW A;  1DCE A;  1M0Z A;  5A5C A;  4CP6 A;  1OTM A;  3ULA A;  1IO0 A;  1XEC A;  2OMU A;  3OGL B;  1U0N D;  5AWB A;  3G3A A;  2P1M B;  1FQV A;  4V2C A;  4R6F A;  2JQD A;  3G06 A;  4LI1 A;  4R5D A;  4Z64 C;  2OMW A;  4G8A A;  4PQ8 A;  4CC4 A;  5AWD A;  3WPB A;  4Z94 G;  4V2E A;  2OMT A;  1ZIW A;  4IM6 A;  4LSC A;  4ARR A;  1O6S A;  4L3F A;  3RGX A;  4C2A B;  4J0M A;  4M7E A;  4FMZ A;  1XWD C; 
#chains in the Genus database with same CATH topology
 1WWL A;  4AY9 X;  2O6S A;  1A4Y A;  2XWT C;  2Z7X A;  1GWB A;  4FHO A;  2O6R A;  4M7E C;  1M10 B;  1LTX A;  2P1P B;  3E2J A;  4KNG A;  4LSX A;  3ULV A;  4YEB B;  1Z7X W;  2UZX A;  4PEQ B;  2OMY A;  5D3I A;  1DFJ I;  2WQV A;  4FD0 A;  4KXF B;  4Z79 A;  1JL5 A;  1KOO A;  5AZ5 A;  3OJA B;  3W3J A;  3OJA A;  4PSJ A;  3WPF A;  2RA8 A;  4L3A A;  3W3M A;  1H6T A;  4XOS A;  3WN4 A;  4I6J B;  4ECN A;  2Z64 A;  4RWT C;  4UFR A;  3WPC A;  5FTT B;  4TZH A;  1P8T A;  3E6J A;  4GT6 A;  1OTN A;  4WYK A;  1FT8 A;  4FCG A;  4R6A A;  5GS0 A;  5HZL B;  3RIZ A;  4CNM A;  4LI2 A;  3WPD A;  2AST B;  3UL8 A;  4BV4 R;  3A79 B;  4EZG A;  3C6P B;  3FXI A;  2Z82 A;  3RGZ A;  3OGM B;  1M9L A;  3O53 A;  3PMH G;  4BSS A;  4CNC A;  4P8S A;  4P91 A;  1XCD A;  1YRG A;  2OMV A;  2RR6 A;  4R58 A;  5CMN A;  2V9S A;  2WQU A;  1OZN A;  3RFS A;  2P1N B;  3RJ0 A;  1P9A G;  4R0A A;  3W3G A;  5AWC A;  3DZE A;  4LSX C;  2WFH A;  1XEU A;  2WQW A;  5CMP A;  5GMG A;  2FT3 A;  1A9N A;  4R09 A;  4KT1 A;  2WQX A;  3O6N A;  1OGQ A;  3WPG A;  3WPH A;  3GOZ A;  3RW7 A;  4R08 A;  2P1O B;  1KOH A;  2CA6 A;  4Q62 A;  4FS7 A;  1FO1 A;  1O6T A;  5IJD A;  4PKI G;  1OOK G;  4C2B B;  4WP6 A;  4LSA A;  3W3K A;  2ELL A;  4R6G A;  3JB9 j;  3RFE A;  4Z61 C;  4BSU A;  2OMX A;  5AWA A;  2Y5Q A;  3C6O B;  4NKH A;  4ARN A;  4CC4 C;  4H09 A;  1D0B A;  5IYX C;  4J4L A;  4XGO A;  5GQR K;  2JE0 A;  2Z62 A;  2JE1 A;  2O6Q A;  3TSR E;  5HDH A;  3CVR A;  4Q3G A;  1M9S A;  4QXE A;  3G04 C;  3UL9 A;  4CIL A;  2IFG A;  2A0Z A;  3CIG A;  4OQT A;  4U06 A;  4Z8G A;  3E3Z A;  3M18 A;  4FDW A;  2Z81 A;  3RFJ A;  3VQ1 A;  3W3N A;  2R9U A;  3C6N B;  4BSR A;  1XKU A;  2BEX A;  2Z7X B;  3BZ5 A;  4NKG A;  4U7L A;  3VQ2 A;  3ZYO A;  4AW4 A;  4R6J A;  3WPI A;  2Z65 A;  2BNH A;  1QYY A;  3W3L A;  2XOT A;  4R5C A;  3ULU A;  1DS9 A;  4B8C D;  4Y61 B;  3ZYN A;  5IJB A;  1W8A A;  4LXS A;  1K5G C;  4Q3I A;  2V9T B;  4HQ1 A;  3UN9 A;  5IJC A;  1FS2 A;  4MQW X;  1P8V A;  5LFN A;  3KJ4 A;  4U08 A;  3UL7 A;  1OTO A;  3M19 A;  4MN8 B;  2P1Q B;  4QC0 A;  1H6U A;  2Q4G W;  4K17 A;  5B0T A;  3G39 A;  2Z63 A;  1SQ0 B;  3RW6 A;  5B4P A;  4QBZ A;  4GLP A;  3E4G A;  4R07 A;  2ID5 A;  3P72 A;  3ZYI A;  3REZ A;  1G9U A;  1PGV A;  3ZYJ A;  5B0N A;  2Z66 A;  4PER A;  3G3B A;  3CIY A;  2ASS B;  3OGK B;  3SB4 A;  5GMF A;  3WPE A;  4NZR M;  1K5D C;  1O6V A;  4XSQ A;  2OMZ A;  5GS2 B;  4U09 A;  4V2D A;  4RCA B;  2UZY A;  4LXR A;  4ECO A;  5GMH A;  2V70 A;  4RCW A;  1DCE A;  1M0Z A;  5A5C A;  4CP6 A;  1OTM A;  3ULA A;  1IO0 A;  1XEC A;  2OMU A;  3OGL B;  1U0N D;  5AWB A;  3G3A A;  2P1M B;  1FQV A;  4V2C A;  4R6F A;  2JQD A;  3G06 A;  4LI1 A;  4R5D A;  4Z64 C;  2OMW A;  4G8A A;  4PQ8 A;  4CC4 A;  5AWD A;  3WPB A;  4Z94 G;  4V2E A;  2OMT A;  1ZIW A;  4IM6 A;  4LSC A;  4ARR A;  1O6S A;  4L3F A;  4NZT M;  4C2A B;  4J0M A;  3RGX A;  4M7E A;  4FMZ A;  1XWD C; 
#chains in the Genus database with same CATH homology
 1WWL A;  4AY9 X;  2O6S A;  1A4Y A;  2XWT C;  2Z7X A;  1GWB A;  4FHO A;  2O6R A;  4M7E C;  1M10 B;  1LTX A;  2P1P B;  3E2J A;  4KNG A;  4LSX A;  3ULV A;  4YEB B;  1Z7X W;  2UZX A;  4PEQ B;  2OMY A;  5D3I A;  1DFJ I;  2WQV A;  4FD0 A;  4KXF B;  4Z79 A;  1JL5 A;  1KOO A;  5AZ5 A;  3OJA B;  3W3J A;  3OJA A;  4PSJ A;  3WPF A;  2RA8 A;  4L3A A;  3W3M A;  1H6T A;  4XOS A;  3WN4 A;  4I6J B;  4ECN A;  2Z64 A;  4RWT C;  4UFR A;  3WPC A;  5FTT B;  4TZH A;  1P8T A;  3E6J A;  4GT6 A;  1OTN A;  4WYK A;  1FT8 A;  4FCG A;  4R6A A;  5GS0 A;  5HZL B;  3RIZ A;  4CNM A;  4LI2 A;  3WPD A;  2AST B;  3UL8 A;  4BV4 R;  3A79 B;  4EZG A;  3C6P B;  3FXI A;  2Z82 A;  3RGZ A;  3OGM B;  1M9L A;  3O53 A;  3PMH G;  4BSS A;  4CNC A;  4P8S A;  4P91 A;  1XCD A;  1YRG A;  2OMV A;  2RR6 A;  4R58 A;  5CMN A;  2V9S A;  2WQU A;  1OZN A;  3RFS A;  2P1N B;  3RJ0 A;  1P9A G;  4R0A A;  3W3G A;  5AWC A;  3DZE A;  4LSX C;  2WFH A;  1XEU A;  2WQW A;  5CMP A;  5GMG A;  2FT3 A;  1A9N A;  4R09 A;  4KT1 A;  2WQX A;  3O6N A;  1OGQ A;  3WPG A;  3WPH A;  3GOZ A;  3RW7 A;  4R08 A;  2P1O B;  1KOH A;  2CA6 A;  4Q62 A;  4FS7 A;  1FO1 A;  1O6T A;  5IJD A;  4PKI G;  1OOK G;  4C2B B;  4WP6 A;  4LSA A;  3W3K A;  2ELL A;  4R6G A;  3JB9 j;  3RFE A;  4Z61 C;  4BSU A;  2OMX A;  5AWA A;  2Y5Q A;  3C6O B;  4NKH A;  4ARN A;  4CC4 C;  4H09 A;  1D0B A;  5IYX C;  4J4L A;  4XGO A;  5GQR K;  2JE0 A;  2Z62 A;  2JE1 A;  2O6Q A;  3TSR E;  5HDH A;  3CVR A;  4Q3G A;  1M9S A;  4QXE A;  3G04 C;  3UL9 A;  4CIL A;  2IFG A;  2A0Z A;  3CIG A;  4OQT A;  4U06 A;  4Z8G A;  3E3Z A;  3M18 A;  4FDW A;  2Z81 A;  3RFJ A;  3VQ1 A;  3W3N A;  2R9U A;  3C6N B;  4BSR A;  1XKU A;  2BEX A;  2Z7X B;  3BZ5 A;  4NKG A;  4U7L A;  3VQ2 A;  3ZYO A;  4AW4 A;  4R6J A;  3WPI A;  2Z65 A;  2BNH A;  1QYY A;  3W3L A;  2XOT A;  4R5C A;  3ULU A;  1DS9 A;  4B8C D;  4Y61 B;  3ZYN A;  5IJB A;  1W8A A;  4LXS A;  1K5G C;  4Q3I A;  2V9T B;  4HQ1 A;  3UN9 A;  5IJC A;  1FS2 A;  4MQW X;  1P8V A;  5LFN A;  3KJ4 A;  4U08 A;  3UL7 A;  1OTO A;  3M19 A;  4MN8 B;  2P1Q B;  4QC0 A;  1H6U A;  2Q4G W;  4K17 A;  5B0T A;  3G39 A;  2Z63 A;  1SQ0 B;  3RW6 A;  5B4P A;  4QBZ A;  4GLP A;  3E4G A;  4R07 A;  2ID5 A;  3P72 A;  3ZYI A;  3REZ A;  1G9U A;  1PGV A;  3ZYJ A;  5B0N A;  2Z66 A;  4PER A;  3G3B A;  3CIY A;  2ASS B;  3OGK B;  3SB4 A;  5GMF A;  3WPE A;  1K5D C;  1O6V A;  4XSQ A;  2OMZ A;  5GS2 B;  4U09 A;  4V2D A;  4RCA B;  2UZY A;  4LXR A;  4ECO A;  5GMH A;  2V70 A;  4RCW A;  1DCE A;  1M0Z A;  5A5C A;  4CP6 A;  1OTM A;  3ULA A;  1IO0 A;  1XEC A;  2OMU A;  3OGL B;  1U0N D;  5AWB A;  3G3A A;  2P1M B;  1FQV A;  4V2C A;  4R6F A;  2JQD A;  3G06 A;  4LI1 A;  4R5D A;  4Z64 C;  2OMW A;  4G8A A;  4PQ8 A;  4CC4 A;  5AWD A;  3WPB A;  4Z94 G;  4V2E A;  2OMT A;  1ZIW A;  4IM6 A;  4LSC A;  4ARR A;  1O6S A;  4L3F A;  3RGX A;  4C2A B;  4J0M A;  4M7E A;  4FMZ A;  1XWD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...