4C2BB

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation in complex with high affinity gpib alpha
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
264
Chain Sequence
b'PICEVSKVASHLEVNCDKRRLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNRLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQVVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 60
structure length 264
sequence length 264
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4c2bB00
3G39A 3RIZA 1M0ZA 1DFJI 4R6GA 1OTNA 2WQWA 2XOTA 2ID5A 4LXSA 3C6OB 4WYKA 4R0AA 3RGZA 1K5GC 4NKHA 2Z63A 3ZYIA 4M7EC 4LSCA 1DCEA 2ELLA 2V9TB 2JQDA 4G8AA 1JL5A 2A0ZA 1QYYA 4HQ1A 4AY9X 3UN9A 1KOHA 4R6JA 4K17A 3RW7A 3RFEA 4Z61C 4U08A 2Z7XB 3ZYNA 5B0TA 3G3BA 4H09A 3WPGA 3G3AA 4CP6A 2O6SA 1XKUA 3SB4A 5GS0A 1O6VA 4BSSA 4CNMA 2WFHA 4Z64C 3WPFA 3OGLB 2P1OB 2ASSB 1W8AA 1FT8A 4R6AA 3E4GA 3M18A 4PEQB 1H6TA 4RCAB 3WPHA 4QBZA 4R5DA 4XGOA 2UZYA 4LSXA 2BNHA 4LI2A 3TSRE 3W3GA 1Z7XW 5HDHA 4OQTA 1PGVA 2Z64A 5HZLB 5GQRK 1OZNA 1OTMA 1XWDC 3FXIA 4FHOA 4PSJA 3UL8A 3WPIA 5GMGA 1A4YA 5AWAA 4Z94G 3GOZA 5B4PA 5IJCA 4LI1A 4MQWX 3JB9j 4LSXC 4BSUA 1XECA 3REZA 2O6QA 3W3JA 5GMHA 2Z66A 5AWBA 5GMFA 5AWDA 3UL9A 1P8VA 2Z62A 4RCWA 5D3IA 2Z81A 4UFRA 2P1QB 1YRGA 4RWTC 1K5DC 3O6NA 4FS7A 2RA8A 2FT3A 2P1PB 3BZ5A 4BV4R 3ULAA 3ZYJA 4LXRA 3PMHG 3W3KA 4FMZA 1M10B 4V2CA 4GT6A 4Q3IA 2CA6A 3C6NB 1OOKG 4EZGA 1FQVA 4MN8B 2JE1A 1KOOA 3KJ4A 2JE0A 4CNCA 4J0MA 2WQUA 3RFSA 2Y5QA 1U0ND 3OGKB 4R09A 4Z79A 4AW4A 1A9NA 2Z7XA 3E3ZA 4C2AB 4CC4A 2P1MB 1XEUA 4KT1A 4U09A 3W3LA 4PQ8A 5AWCA 4R58A 4Y61B 4CILA 3VQ1A 1WWLA 4NKGA 3RFJA 1O6SA 4FDWA 3ULUA 4J4LA 1IO0A 3CIGA 2Z82A 4P8SA 2OMZA 4Q3GA 3DZEA 3WPEA 4CC4C 3G06A 1GWBA 2XWTC 3WPBA 3C6PB 3WPCA 3WN4A 1M9SA 4XSQA 4C2BB 2Z65A 2RR6A 4ARNA 5B0NA 3OJAA 3O53A 3CVRA 3RJ0A 3W3MA 1H6UA 5IYXC 4I6JB 1P9AG 4PERA 5GS2B 1M9LA 4FD0A 3OGMB 2V9SA 3WPDA 4KXFB 4ARRA 4V2DA 4WP6A 4ECNA 4QC0A 5CMNA 1G9UA 1DS9A 4QXEA 3P72A 1FO1A 1OTOA 3CIYA 4LSAA 4YEBB 4R5CA 3ZYOA 2OMUA 4V2EA 2ASTB 4R07A 5AZ5A 1LTXA 4PKIG 4IM6A 3RGXA 1O6TA 4U06A 2OMTA 1ZIWA 4B8CD 1OGQA 2UZXA 2BEXA 3VQ2A 3ULVA 3A79B 5LFNA 4XOSA 4Z8GA 4FCGA 2OMYA 3E2JA 4R6FA 3RW6A 1XCDA 4TZHA 4R08A 4KNGA 1SQ0B 2OMXA 5IJDA 5IJBA 5FTTB 2V70A 4U7LA 2O6RA 3UL7A 5CMPA 3OJAB 4Q62A 4BSRA 4L3AA 2R9UA 3M19A 3E6JA 2IFGA 2OMWA 4GLPA 3G04C 1D0BA 4M7EA 4L3FA 1FS2A 2OMVA 1P8TA 3W3NA 5A5CA 4ECOA 2P1NB 2WQVA 2WQXA 4P91A 2Q4GW
chains in the Genus database with same CATH superfamily
3G39A 3RIZA 1M0ZA 1DFJI 4R6GA 1OTNA 2WQWA 2XOTA 2ID5A 4LXSA 3C6OB 4WYKA 4R0AA 3RGZA 1K5GC 4NKHA 2Z63A 3ZYIA 4M7EC 4LSCA 1DCEA 2ELLA 2V9TB 2JQDA 4G8AA 1JL5A 2A0ZA 1QYYA 4HQ1A 4AY9X 3UN9A 1KOHA 4R6JA 4K17A 3RW7A 3RFEA 4Z61C 4U08A 2Z7XB 3ZYNA 5B0TA 3G3BA 4H09A 3WPGA 3G3AA 4CP6A 2O6SA 1XKUA 3SB4A 5GS0A 1O6VA 4BSSA 4CNMA 2WFHA 4Z64C 3WPFA 3OGLB 2P1OB 2ASSB 1W8AA 1FT8A 4R6AA 3E4GA 3M18A 4PEQB 1H6TA 4RCAB 4NZTM 3WPHA 4QBZA 4R5DA 4XGOA 2UZYA 4LSXA 2BNHA 4LI2A 3TSRE 3W3GA 1Z7XW 5HDHA 4OQTA 1PGVA 2Z64A 5HZLB 5GQRK 1OZNA 1OTMA 1XWDC 3FXIA 4FHOA 4PSJA 3UL8A 3WPIA 5GMGA 1A4YA 5AWAA 4Z94G 3GOZA 5B4PA 5IJCA 4LI1A 4MQWX 3JB9j 4LSXC 4BSUA 1XECA 3REZA 2O6QA 3W3JA 5GMHA 2Z66A 5AWBA 5GMFA 5AWDA 3UL9A 1P8VA 2Z62A 4RCWA 5D3IA 2Z81A 4UFRA 2P1QB 1YRGA 4RWTC 1K5DC 3O6NA 4FS7A 2RA8A 2FT3A 2P1PB 3BZ5A 4BV4R 3ULAA 3ZYJA 4LXRA 3PMHG 3W3KA 4FMZA 1M10B 4V2CA 4GT6A 4Q3IA 2CA6A 3C6NB 1OOKG 4EZGA 1FQVA 4MN8B 2JE1A 1KOOA 3KJ4A 2JE0A 4CNCA 4J0MA 2WQUA 3RFSA 2Y5QA 1U0ND 3OGKB 4R09A 4Z79A 4AW4A 1A9NA 2Z7XA 3E3ZA 4C2AB 4CC4A 2P1MB 1XEUA 4KT1A 4U09A 3W3LA 4PQ8A 5AWCA 4R58A 4Y61B 4CILA 3VQ1A 1WWLA 4NKGA 3RFJA 1O6SA 4FDWA 3ULUA 4J4LA 1IO0A 3CIGA 2Z82A 4P8SA 2OMZA 4Q3GA 3DZEA 3WPEA 4CC4C 3G06A 1GWBA 2XWTC 3WPBA 3C6PB 3WPCA 3WN4A 1M9SA 4XSQA 4C2BB 2Z65A 2RR6A 4ARNA 5B0NA 3OJAA 3O53A 3CVRA 3RJ0A 3W3MA 1H6UA 5IYXC 4I6JB 1P9AG 4PERA 5GS2B 1M9LA 4FD0A 3OGMB 2V9SA 3WPDA 4KXFB 4ARRA 4V2DA 4WP6A 4ECNA 4QC0A 5CMNA 1G9UA 1DS9A 4QXEA 3P72A 1FO1A 1OTOA 3CIYA 4LSAA 4YEBB 4R5CA 3ZYOA 2OMUA 4V2EA 2ASTB 4R07A 5AZ5A 1LTXA 4PKIG 4IM6A 3RGXA 1O6TA 4U06A 2OMTA 1ZIWA 4B8CD 1OGQA 2UZXA 2BEXA 3VQ2A 3ULVA 3A79B 5LFNA 4XOSA 4Z8GA 4FCGA 2OMYA 3E2JA 4R6FA 3RW6A 1XCDA 4TZHA 4R08A 4KNGA 1SQ0B 2OMXA 5IJDA 5IJBA 5FTTB 2V70A 4U7LA 2O6RA 3UL7A 5CMPA 3OJAB 4Q62A 4BSRA 4L3AA 2R9UA 3M19A 3E6JA 2IFGA 2OMWA 4GLPA 3G04C 4NZRM 1D0BA 4M7EA 4L3FA 1FS2A 2OMVA 1P8TA 3W3NA 5A5CA 4ECOA 2P1NB 2WQVA 2WQXA 4P91A 2Q4GW
chains in the Genus database with same CATH topology
3G39A 3RIZA 1M0ZA 1DFJI 4R6GA 1OTNA 2WQWA 2XOTA 2ID5A 4LXSA 3C6OB 4WYKA 4R0AA 3RGZA 1K5GC 4NKHA 2Z63A 3ZYIA 4M7EC 4LSCA 1DCEA 2ELLA 2V9TB 2JQDA 4G8AA 1JL5A 2A0ZA 1QYYA 4HQ1A 4AY9X 3UN9A 1KOHA 4R6JA 4K17A 3RW7A 3RFEA 4Z61C 4U08A 2Z7XB 3ZYNA 5B0TA 3G3BA 4H09A 3WPGA 3G3AA 4CP6A 2O6SA 1XKUA 3SB4A 5GS0A 1O6VA 4BSSA 4CNMA 2WFHA 4Z64C 3WPFA 3OGLB 2P1OB 2ASSB 1W8AA 1FT8A 4R6AA 3E4GA 3M18A 4PEQB 1H6TA 4RCAB 3WPHA 4QBZA 4R5DA 4XGOA 2UZYA 4LSXA 2BNHA 4LI2A 3TSRE 3W3GA 1Z7XW 5HDHA 4OQTA 1PGVA 2Z64A 5HZLB 5GQRK 1OZNA 1OTMA 1XWDC 3FXIA 4FHOA 4PSJA 3UL8A 3WPIA 5GMGA 1A4YA 5AWAA 4Z94G 3GOZA 5B4PA 5IJCA 4LI1A 4MQWX 3JB9j 4LSXC 4BSUA 1XECA 3REZA 2O6QA 3W3JA 5GMHA 2Z66A 5AWBA 5GMFA 5AWDA 3UL9A 1P8VA 2Z62A 4RCWA 5D3IA 2Z81A 4UFRA 2P1QB 1YRGA 4RWTC 1K5DC 3O6NA 4FS7A 2RA8A 2FT3A 2P1PB 3BZ5A 4BV4R 3ULAA 3ZYJA 4LXRA 3PMHG 3W3KA 4FMZA 1M10B 4V2CA 4GT6A 4Q3IA 2CA6A 3C6NB 1OOKG 4EZGA 1FQVA 4MN8B 2JE1A 1KOOA 3KJ4A 2JE0A 4CNCA 4J0MA 2WQUA 3RFSA 2Y5QA 1U0ND 3OGKB 4R09A 4Z79A 4AW4A 1A9NA 2Z7XA 3E3ZA 4C2AB 4CC4A 2P1MB 1XEUA 4KT1A 4U09A 3W3LA 4PQ8A 5AWCA 4R58A 4Y61B 4CILA 3VQ1A 1WWLA 4NKGA 3RFJA 1O6SA 4FDWA 3ULUA 4J4LA 1IO0A 3CIGA 2Z82A 4P8SA 2OMZA 4Q3GA 3DZEA 3WPEA 4CC4C 3G06A 1GWBA 2XWTC 3WPBA 3C6PB 3WPCA 3WN4A 1M9SA 4XSQA 4C2BB 2Z65A 2RR6A 4ARNA 5B0NA 3OJAA 3O53A 3CVRA 3RJ0A 3W3MA 1H6UA 5IYXC 4I6JB 1P9AG 4PERA 5GS2B 1M9LA 4FD0A 3OGMB 2V9SA 3WPDA 4KXFB 4ARRA 4V2DA 4WP6A 4ECNA 4QC0A 5CMNA 1G9UA 1DS9A 4QXEA 3P72A 1FO1A 1OTOA 3CIYA 4LSAA 4YEBB 4R5CA 3ZYOA 2OMUA 4V2EA 2ASTB 4R07A 5AZ5A 1LTXA 4PKIG 4IM6A 3RGXA 1O6TA 4U06A 2OMTA 1ZIWA 4B8CD 1OGQA 2UZXA 2BEXA 3VQ2A 3ULVA 3A79B 5LFNA 4XOSA 4Z8GA 4FCGA 2OMYA 3E2JA 4R6FA 3RW6A 1XCDA 4TZHA 4R08A 4KNGA 1SQ0B 2OMXA 5IJDA 5IJBA 5FTTB 2V70A 4U7LA 2O6RA 3UL7A 5CMPA 3OJAB 4Q62A 4BSRA 4L3AA 2R9UA 3M19A 3E6JA 2IFGA 2OMWA 4GLPA 3G04C 1D0BA 4M7EA 4L3FA 1FS2A 2OMVA 1P8TA 3W3NA 5A5CA 4ECOA 2P1NB 2WQVA 2WQXA 4P91A 2Q4GW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G39 A;  3RIZ A;  1M0Z A;  1DFJ I;  4R6G A;  1OTN A;  2WQW A;  2XOT A;  2ID5 A;  4LXS A;  3C6O B;  4WYK A;  4R0A A;  3RGZ A;  1K5G C;  4NKH A;  2Z63 A;  3ZYI A;  4M7E C;  4LSC A;  1DCE A;  2ELL A;  2V9T B;  2JQD A;  4G8A A;  1JL5 A;  2A0Z A;  1QYY A;  4HQ1 A;  4AY9 X;  3UN9 A;  1KOH A;  4R6J A;  4K17 A;  3RW7 A;  3RFE A;  4Z61 C;  4U08 A;  2Z7X B;  3ZYN A;  5B0T A;  3G3B A;  4H09 A;  3WPG A;  3G3A A;  4CP6 A;  2O6S A;  1XKU A;  3SB4 A;  5GS0 A;  1O6V A;  4BSS A;  4CNM A;  2WFH A;  4Z64 C;  3WPF A;  3OGL B;  2P1O B;  2ASS B;  1W8A A;  1FT8 A;  4R6A A;  3E4G A;  3M18 A;  4PEQ B;  1H6T A;  4RCA B;  3WPH A;  4QBZ A;  4R5D A;  4XGO A;  2UZY A;  4LSX A;  2BNH A;  4LI2 A;  3TSR E;  3W3G A;  1Z7X W;  5HDH A;  4OQT A;  1PGV A;  2Z64 A;  5HZL B;  5GQR K;  1OZN A;  1OTM A;  1XWD C;  3FXI A;  4FHO A;  4PSJ A;  3UL8 A;  3WPI A;  5GMG A;  1A4Y A;  5AWA A;  4Z94 G;  3GOZ A;  5B4P A;  5IJC A;  4LI1 A;  4MQW X;  3JB9 j;  4LSX C;  4BSU A;  1XEC A;  3REZ A;  2O6Q A;  3W3J A;  5GMH A;  2Z66 A;  5AWB A;  5GMF A;  5AWD A;  3UL9 A;  1P8V A;  2Z62 A;  4RCW A;  5D3I A;  2Z81 A;  4UFR A;  2P1Q B;  1YRG A;  4RWT C;  1K5D C;  3O6N A;  4FS7 A;  2RA8 A;  2FT3 A;  2P1P B;  3BZ5 A;  4BV4 R;  3ULA A;  3ZYJ A;  4LXR A;  3PMH G;  3W3K A;  4FMZ A;  1M10 B;  4V2C A;  4GT6 A;  4Q3I A;  2CA6 A;  3C6N B;  1OOK G;  4EZG A;  1FQV A;  4MN8 B;  2JE1 A;  1KOO A;  3KJ4 A;  2JE0 A;  4CNC A;  4J0M A;  2WQU A;  3RFS A;  2Y5Q A;  1U0N D;  3OGK B;  4R09 A;  4Z79 A;  4AW4 A;  1A9N A;  2Z7X A;  3E3Z A;  4C2A B;  4CC4 A;  2P1M B;  1XEU A;  4KT1 A;  4U09 A;  3W3L A;  4PQ8 A;  5AWC A;  4R58 A;  4Y61 B;  4CIL A;  3VQ1 A;  1WWL A;  4NKG A;  3RFJ A;  1O6S A;  4FDW A;  3ULU A;  4J4L A;  1IO0 A;  3CIG A;  2Z82 A;  4P8S A;  2OMZ A;  4Q3G A;  3DZE A;  3WPE A;  4CC4 C;  3G06 A;  1GWB A;  2XWT C;  3WPB A;  3C6P B;  3WPC A;  3WN4 A;  1M9S A;  4XSQ A;  4C2B B;  2Z65 A;  2RR6 A;  4ARN A;  5B0N A;  3OJA A;  3O53 A;  3CVR A;  3RJ0 A;  3W3M A;  1H6U A;  5IYX C;  4I6J B;  1P9A G;  4PER A;  5GS2 B;  1M9L A;  4FD0 A;  3OGM B;  2V9S A;  3WPD A;  4KXF B;  4ARR A;  4V2D A;  4WP6 A;  4ECN A;  4QC0 A;  5CMN A;  1G9U A;  1DS9 A;  4QXE A;  3P72 A;  1FO1 A;  1OTO A;  3CIY A;  4LSA A;  4YEB B;  4R5C A;  3ZYO A;  2OMU A;  4V2E A;  2AST B;  4R07 A;  5AZ5 A;  1LTX A;  4PKI G;  4IM6 A;  3RGX A;  1O6T A;  4U06 A;  2OMT A;  1ZIW A;  4B8C D;  1OGQ A;  2UZX A;  2BEX A;  3VQ2 A;  3ULV A;  3A79 B;  5LFN A;  4XOS A;  4Z8G A;  4FCG A;  2OMY A;  3E2J A;  4R6F A;  3RW6 A;  1XCD A;  4TZH A;  4R08 A;  4KNG A;  1SQ0 B;  2OMX A;  5IJD A;  5IJB A;  5FTT B;  2V70 A;  4U7L A;  2O6R A;  3UL7 A;  5CMP A;  3OJA B;  4Q62 A;  4BSR A;  4L3A A;  2R9U A;  3M19 A;  3E6J A;  2IFG A;  2OMW A;  4GLP A;  3G04 C;  1D0B A;  4M7E A;  4L3F A;  1FS2 A;  2OMV A;  1P8T A;  3W3N A;  5A5C A;  4ECO A;  2P1N B;  2WQV A;  2WQX A;  4P91 A;  2Q4G W; 
#chains in the Genus database with same CATH topology
 3G39 A;  3RIZ A;  1M0Z A;  1DFJ I;  4R6G A;  1OTN A;  2WQW A;  2XOT A;  2ID5 A;  4LXS A;  3C6O B;  4WYK A;  4R0A A;  3RGZ A;  1K5G C;  4NKH A;  2Z63 A;  3ZYI A;  4M7E C;  4LSC A;  1DCE A;  2ELL A;  2V9T B;  2JQD A;  4G8A A;  1JL5 A;  2A0Z A;  1QYY A;  4HQ1 A;  4AY9 X;  3UN9 A;  1KOH A;  4R6J A;  4K17 A;  3RW7 A;  3RFE A;  4Z61 C;  4U08 A;  2Z7X B;  3ZYN A;  5B0T A;  3G3B A;  4H09 A;  3WPG A;  3G3A A;  4CP6 A;  2O6S A;  1XKU A;  3SB4 A;  5GS0 A;  1O6V A;  4BSS A;  4CNM A;  2WFH A;  4Z64 C;  3WPF A;  3OGL B;  2P1O B;  2ASS B;  1W8A A;  1FT8 A;  4R6A A;  3E4G A;  3M18 A;  4PEQ B;  1H6T A;  4RCA B;  4NZT M;  3WPH A;  4QBZ A;  4R5D A;  4XGO A;  2UZY A;  4LSX A;  2BNH A;  4LI2 A;  3TSR E;  3W3G A;  1Z7X W;  5HDH A;  4OQT A;  1PGV A;  2Z64 A;  5HZL B;  5GQR K;  1OZN A;  1OTM A;  1XWD C;  3FXI A;  4FHO A;  4PSJ A;  3UL8 A;  3WPI A;  5GMG A;  1A4Y A;  5AWA A;  4Z94 G;  3GOZ A;  5B4P A;  5IJC A;  4LI1 A;  4MQW X;  3JB9 j;  4LSX C;  4BSU A;  1XEC A;  3REZ A;  2O6Q A;  3W3J A;  5GMH A;  2Z66 A;  5AWB A;  5GMF A;  5AWD A;  3UL9 A;  1P8V A;  2Z62 A;  4RCW A;  5D3I A;  2Z81 A;  4UFR A;  2P1Q B;  1YRG A;  4RWT C;  1K5D C;  3O6N A;  4FS7 A;  2RA8 A;  2FT3 A;  2P1P B;  3BZ5 A;  4BV4 R;  3ULA A;  3ZYJ A;  4LXR A;  3PMH G;  3W3K A;  4FMZ A;  1M10 B;  4V2C A;  4GT6 A;  4Q3I A;  2CA6 A;  3C6N B;  1OOK G;  4EZG A;  1FQV A;  4MN8 B;  2JE1 A;  1KOO A;  3KJ4 A;  2JE0 A;  4CNC A;  4J0M A;  2WQU A;  3RFS A;  2Y5Q A;  1U0N D;  3OGK B;  4R09 A;  4Z79 A;  4AW4 A;  1A9N A;  2Z7X A;  3E3Z A;  4C2A B;  4CC4 A;  2P1M B;  1XEU A;  4KT1 A;  4U09 A;  3W3L A;  4PQ8 A;  5AWC A;  4R58 A;  4Y61 B;  4CIL A;  3VQ1 A;  1WWL A;  4NKG A;  3RFJ A;  1O6S A;  4FDW A;  3ULU A;  4J4L A;  1IO0 A;  3CIG A;  2Z82 A;  4P8S A;  2OMZ A;  4Q3G A;  3DZE A;  3WPE A;  4CC4 C;  3G06 A;  1GWB A;  2XWT C;  3WPB A;  3C6P B;  3WPC A;  3WN4 A;  1M9S A;  4XSQ A;  4C2B B;  2Z65 A;  2RR6 A;  4ARN A;  5B0N A;  3OJA A;  3O53 A;  3CVR A;  3RJ0 A;  3W3M A;  1H6U A;  5IYX C;  4I6J B;  1P9A G;  4PER A;  5GS2 B;  1M9L A;  4FD0 A;  3OGM B;  2V9S A;  3WPD A;  4KXF B;  4ARR A;  4V2D A;  4WP6 A;  4ECN A;  4QC0 A;  5CMN A;  1G9U A;  1DS9 A;  4QXE A;  3P72 A;  1FO1 A;  1OTO A;  3CIY A;  4LSA A;  4YEB B;  4R5C A;  3ZYO A;  2OMU A;  4V2E A;  2AST B;  4R07 A;  5AZ5 A;  1LTX A;  4PKI G;  4IM6 A;  3RGX A;  1O6T A;  4U06 A;  2OMT A;  1ZIW A;  4B8C D;  1OGQ A;  2UZX A;  2BEX A;  3VQ2 A;  3ULV A;  3A79 B;  5LFN A;  4XOS A;  4Z8G A;  4FCG A;  2OMY A;  3E2J A;  4R6F A;  3RW6 A;  1XCD A;  4TZH A;  4R08 A;  4KNG A;  1SQ0 B;  2OMX A;  5IJD A;  5IJB A;  5FTT B;  2V70 A;  4U7L A;  2O6R A;  3UL7 A;  5CMP A;  3OJA B;  4Q62 A;  4BSR A;  4L3A A;  2R9U A;  3M19 A;  3E6J A;  2IFG A;  2OMW A;  4GLP A;  3G04 C;  4NZR M;  1D0B A;  4M7E A;  4L3F A;  1FS2 A;  2OMV A;  1P8T A;  3W3N A;  5A5C A;  4ECO A;  2P1N B;  2WQV A;  2WQX A;  4P91 A;  2Q4G W; 
#chains in the Genus database with same CATH homology
 3G39 A;  3RIZ A;  1M0Z A;  1DFJ I;  4R6G A;  1OTN A;  2WQW A;  2XOT A;  2ID5 A;  4LXS A;  3C6O B;  4WYK A;  4R0A A;  3RGZ A;  1K5G C;  4NKH A;  2Z63 A;  3ZYI A;  4M7E C;  4LSC A;  1DCE A;  2ELL A;  2V9T B;  2JQD A;  4G8A A;  1JL5 A;  2A0Z A;  1QYY A;  4HQ1 A;  4AY9 X;  3UN9 A;  1KOH A;  4R6J A;  4K17 A;  3RW7 A;  3RFE A;  4Z61 C;  4U08 A;  2Z7X B;  3ZYN A;  5B0T A;  3G3B A;  4H09 A;  3WPG A;  3G3A A;  4CP6 A;  2O6S A;  1XKU A;  3SB4 A;  5GS0 A;  1O6V A;  4BSS A;  4CNM A;  2WFH A;  4Z64 C;  3WPF A;  3OGL B;  2P1O B;  2ASS B;  1W8A A;  1FT8 A;  4R6A A;  3E4G A;  3M18 A;  4PEQ B;  1H6T A;  4RCA B;  3WPH A;  4QBZ A;  4R5D A;  4XGO A;  2UZY A;  4LSX A;  2BNH A;  4LI2 A;  3TSR E;  3W3G A;  1Z7X W;  5HDH A;  4OQT A;  1PGV A;  2Z64 A;  5HZL B;  5GQR K;  1OZN A;  1OTM A;  1XWD C;  3FXI A;  4FHO A;  4PSJ A;  3UL8 A;  3WPI A;  5GMG A;  1A4Y A;  5AWA A;  4Z94 G;  3GOZ A;  5B4P A;  5IJC A;  4LI1 A;  4MQW X;  3JB9 j;  4LSX C;  4BSU A;  1XEC A;  3REZ A;  2O6Q A;  3W3J A;  5GMH A;  2Z66 A;  5AWB A;  5GMF A;  5AWD A;  3UL9 A;  1P8V A;  2Z62 A;  4RCW A;  5D3I A;  2Z81 A;  4UFR A;  2P1Q B;  1YRG A;  4RWT C;  1K5D C;  3O6N A;  4FS7 A;  2RA8 A;  2FT3 A;  2P1P B;  3BZ5 A;  4BV4 R;  3ULA A;  3ZYJ A;  4LXR A;  3PMH G;  3W3K A;  4FMZ A;  1M10 B;  4V2C A;  4GT6 A;  4Q3I A;  2CA6 A;  3C6N B;  1OOK G;  4EZG A;  1FQV A;  4MN8 B;  2JE1 A;  1KOO A;  3KJ4 A;  2JE0 A;  4CNC A;  4J0M A;  2WQU A;  3RFS A;  2Y5Q A;  1U0N D;  3OGK B;  4R09 A;  4Z79 A;  4AW4 A;  1A9N A;  2Z7X A;  3E3Z A;  4C2A B;  4CC4 A;  2P1M B;  1XEU A;  4KT1 A;  4U09 A;  3W3L A;  4PQ8 A;  5AWC A;  4R58 A;  4Y61 B;  4CIL A;  3VQ1 A;  1WWL A;  4NKG A;  3RFJ A;  1O6S A;  4FDW A;  3ULU A;  4J4L A;  1IO0 A;  3CIG A;  2Z82 A;  4P8S A;  2OMZ A;  4Q3G A;  3DZE A;  3WPE A;  4CC4 C;  3G06 A;  1GWB A;  2XWT C;  3WPB A;  3C6P B;  3WPC A;  3WN4 A;  1M9S A;  4XSQ A;  4C2B B;  2Z65 A;  2RR6 A;  4ARN A;  5B0N A;  3OJA A;  3O53 A;  3CVR A;  3RJ0 A;  3W3M A;  1H6U A;  5IYX C;  4I6J B;  1P9A G;  4PER A;  5GS2 B;  1M9L A;  4FD0 A;  3OGM B;  2V9S A;  3WPD A;  4KXF B;  4ARR A;  4V2D A;  4WP6 A;  4ECN A;  4QC0 A;  5CMN A;  1G9U A;  1DS9 A;  4QXE A;  3P72 A;  1FO1 A;  1OTO A;  3CIY A;  4LSA A;  4YEB B;  4R5C A;  3ZYO A;  2OMU A;  4V2E A;  2AST B;  4R07 A;  5AZ5 A;  1LTX A;  4PKI G;  4IM6 A;  3RGX A;  1O6T A;  4U06 A;  2OMT A;  1ZIW A;  4B8C D;  1OGQ A;  2UZX A;  2BEX A;  3VQ2 A;  3ULV A;  3A79 B;  5LFN A;  4XOS A;  4Z8G A;  4FCG A;  2OMY A;  3E2J A;  4R6F A;  3RW6 A;  1XCD A;  4TZH A;  4R08 A;  4KNG A;  1SQ0 B;  2OMX A;  5IJD A;  5IJB A;  5FTT B;  2V70 A;  4U7L A;  2O6R A;  3UL7 A;  5CMP A;  3OJA B;  4Q62 A;  4BSR A;  4L3A A;  2R9U A;  3M19 A;  3E6J A;  2IFG A;  2OMW A;  4GLP A;  3G04 C;  1D0B A;  4M7E A;  4L3F A;  1FS2 A;  2OMV A;  1P8T A;  3W3N A;  5A5C A;  4ECO A;  2P1N B;  2WQV A;  2WQX A;  4P91 A;  2Q4G W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...