3M18A

Crystal structure of variable lymphocyte receptor vlra.r2.1 in complex with hen egg lysozyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
245
structure length
245
Chain Sequence
TCETVTGCTCNEGKKEVDCQGKSLDSVPSGIPADTEKLDLQSTGLATLSDATFRGLTKLTWLNLDYNQLQTLSAGVFDDLTELGTLGLANNQLASLPLGVFDHLTQLDKLYLGGNQLKSLPSGVFDRLTKLKELRLNTNQLQSIPAGAFDKLTNLQTLSLSTNQLQSVPHGAFDRLGKLQTITLFGNQFDCSRCETLYLSQWIRENSNKVKDGTGQNLHESPDGVTCSDGKVVRTVTNETLKYEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor A diversity region
publication title A structural basis for antigen recognition by the T cell-like lymphocytes of sea lamprey.
pubmed doi rcsb
source organism Petromyzon marinus
molecule tags Immune system
total genus 62
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3m18A00
3CIGA 5B0TA 4Y61B 4ARNA 3SB4A 4QBZA 1FT8A 2OMXA 4FD0A 5GMHA 5GQRK 5GMGA 3WPFA 3E2JA 4R6AA 3ZYOA 4CNCA 5FTTB 2ELLA 4WYKA 4P91A 4QXEA 3WPEA 3M19A 3W3LA 1XKUA 4FHOA 4C2AB 1ZIWA 4BSSA 3WPIA 4NKHA 3W3GA 2JE1A 1O6VA 2JE0A 5AWDA 4ECOA 4RCWA 4B8CD 1KOHA 2OMUA 2OMWA 2ASTB 4XSQA 3ULAA 2V9SA 4Z61C 2Y5QA 2V9TB 1FO1A 1JL5A 4LSCA 4IM6A 4Z94G 4QC0A 4BSRA 2WQUA 2A0ZA 1P8VA 3BZ5A 3RFSA 2Z63A 4V2DA 3M18A 3O53A 4ECNA 3WPGA 3G39A 4Q3IA 5CMPA 4R07A 1DCEA 5GS2B 4KT1A 1H6UA 1K5DC 1OTMA 3G3AA 3P72A 4H09A 3RFJA 4FCGA 4L3FA 1DS9A 2OMTA 4NKGA 3UL8A 2FT3A 3OGKB 4J4LA 4PEQB 3DZEA 2XOTA 1O6SA 4R5CA 2P1MB 2Q4GW 1A9NA 1FQVA 1LTXA 4R6FA 1GWBA 3E6JA 2OMZA 4EZGA 1OZNA 4AW4A 2V70A 4PERA 4I6JB 2JQDA 2P1OB 1U0ND 4UFRA 3KJ4A 2O6QA 5GMFA 1M10B 2RA8A 4ARRA 3CIYA 1KOOA 4LI1A 2O6RA 4Q3GA 4V2CA 4K17A 5D3IA 4U09A 3ULVA 3WN4A 4FS7A 4Z8GA 1DFJI 4P8SA 3WPCA 3OGLB 1IO0A 5B4PA 4BV4R 4U06A 4R6GA 2CA6A 3ZYIA 1OTNA 3W3NA 3VQ1A 2Z81A 4CC4C 2Z66A 1XCDA 5AWCA 4PKIG 3RW7A 3UN9A 3GOZA 2Z82A 3UL7A 4CILA 2RR6A 3FXIA 3WPHA 3G3BA 5CMNA 4R09A 3UL9A 4RWTC 1G9UA 1QYYA 3W3JA 3WPBA 3JB9j 4CC4A 2Z62A 3W3KA 4M7EA 4G8AA 4R5DA 3REZA 2R9UA 2IFGA 3OGMB 1OOKG 2UZYA 4LSXC 4TZHA 1XEUA 3WPDA 1Z7XW 3C6OB 3RFEA 4PQ8A 4FMZA 1XWDC 2P1PB 3W3MA 3RJ0A 3G06A 4HQ1A 4GT6A 3G04C 1OGQA 1WWLA 4CP6A 2UZXA 1M9LA 1FS2A 4FDWA 3TSRE 1H6TA 4LSXA 2BNHA 5AZ5A 4U7LA 5IYXC 1P8TA 4U08A 3ZYJA 5HDHA 5IJDA 2O6SA 3CVRA 2ID5A 4LXSA 4CNMA 4OQTA 1SQ0B 4XGOA 2Z65A 2ASSB 4YEBB 5IJCA 5GS0A 4MN8B 4R0AA 3O6NA 2P1NB 4R58A 5HZLB 1D0BA 2WFHA 2WQXA 4L3AA 4GLPA 4LXRA 2XWTC 4MQWX 4M7EC 1K5GC 2Z64A 3E3ZA 2P1QB 3OJAB 4LSAA 4Q62A 3OJAA 2OMVA 4LI2A 4V2EA 4RCAB 1W8AA 3RGXA 2Z7XB 1O6TA 3ZYNA 5B0NA 3E4GA 2Z7XA 3C6PB 5AWAA 4AY9X 3RIZA 1M9SA 3VQ2A 3PMHG 4Z64C 2WQVA 4Z79A 4C2BB 1PGVA 3A79B 4R6JA 5LFNA 5AWBA 3RW6A 1P9AG 5A5CA 4WP6A 4PSJA 4KNGA 4KXFB 4XOSA 3C6NB 3RGZA 2BEXA 1XECA 1M0ZA 3ULUA 2WQWA 5IJBA 1YRGA 1A4YA 4R08A 2OMYA 4J0MA 1OTOA 4BSUA
chains in the Genus database with same CATH superfamily
3CIGA 5B0TA 4Y61B 4ARNA 3SB4A 4QBZA 1FT8A 2OMXA 4FD0A 5GMHA 5GQRK 5GMGA 4NZRM 3WPFA 3E2JA 4R6AA 3ZYOA 4CNCA 5FTTB 2ELLA 4WYKA 4P91A 4QXEA 3WPEA 3M19A 3W3LA 1XKUA 4FHOA 4C2AB 1ZIWA 4BSSA 3WPIA 4NKHA 3W3GA 2JE1A 1O6VA 2JE0A 5AWDA 4ECOA 4RCWA 4B8CD 1KOHA 2OMUA 2OMWA 2ASTB 4XSQA 3ULAA 2V9SA 4Z61C 2Y5QA 2V9TB 1FO1A 1JL5A 4LSCA 4IM6A 4Z94G 4QC0A 4BSRA 2WQUA 2A0ZA 1P8VA 3BZ5A 3RFSA 2Z63A 4V2DA 3M18A 3O53A 4ECNA 3WPGA 3G39A 4Q3IA 5CMPA 4R07A 1DCEA 5GS2B 4KT1A 1H6UA 1K5DC 1OTMA 3G3AA 3P72A 4H09A 3RFJA 4FCGA 4L3FA 1DS9A 2OMTA 4NKGA 3UL8A 2FT3A 3OGKB 4J4LA 4PEQB 3DZEA 2XOTA 1O6SA 4R5CA 2P1MB 2Q4GW 1A9NA 1FQVA 1LTXA 4R6FA 1GWBA 3E6JA 2OMZA 4EZGA 1OZNA 4AW4A 2V70A 4PERA 4I6JB 2JQDA 2P1OB 1U0ND 4UFRA 3KJ4A 2O6QA 5GMFA 1M10B 2RA8A 4ARRA 3CIYA 1KOOA 4LI1A 2O6RA 4Q3GA 4V2CA 4K17A 5D3IA 4U09A 3ULVA 3WN4A 4FS7A 4Z8GA 1DFJI 4P8SA 3WPCA 3OGLB 1IO0A 5B4PA 4BV4R 4U06A 4R6GA 2CA6A 3ZYIA 1OTNA 3W3NA 3VQ1A 2Z81A 4CC4C 2Z66A 1XCDA 5AWCA 4PKIG 3RW7A 3UN9A 3GOZA 2Z82A 3UL7A 4CILA 2RR6A 3FXIA 3WPHA 3G3BA 5CMNA 4R09A 3UL9A 4RWTC 1G9UA 1QYYA 3W3JA 3WPBA 3JB9j 4CC4A 2Z62A 3W3KA 4NZTM 4M7EA 4G8AA 4R5DA 3REZA 2R9UA 2IFGA 3OGMB 1OOKG 2UZYA 4LSXC 4TZHA 1XEUA 3WPDA 1Z7XW 3C6OB 3RFEA 4PQ8A 4FMZA 1XWDC 2P1PB 3W3MA 3RJ0A 3G06A 4HQ1A 4GT6A 3G04C 1OGQA 1WWLA 4CP6A 2UZXA 1M9LA 1FS2A 4FDWA 3TSRE 1H6TA 4LSXA 2BNHA 5AZ5A 4U7LA 5IYXC 1P8TA 4U08A 3ZYJA 5HDHA 5IJDA 2O6SA 3CVRA 2ID5A 4LXSA 4CNMA 4OQTA 1SQ0B 4XGOA 2Z65A 2ASSB 4YEBB 5IJCA 5GS0A 4MN8B 4R0AA 3O6NA 2P1NB 4R58A 5HZLB 1D0BA 2WFHA 2WQXA 4L3AA 4GLPA 4LXRA 2XWTC 4MQWX 4M7EC 1K5GC 2Z64A 3E3ZA 2P1QB 3OJAB 4LSAA 4Q62A 3OJAA 2OMVA 4LI2A 4V2EA 4RCAB 1W8AA 3RGXA 2Z7XB 1O6TA 3ZYNA 5B0NA 3E4GA 2Z7XA 3C6PB 5AWAA 4AY9X 3RIZA 1M9SA 3VQ2A 3PMHG 4Z64C 2WQVA 4Z79A 4C2BB 1PGVA 3A79B 4R6JA 5LFNA 5AWBA 3RW6A 1P9AG 5A5CA 4WP6A 4PSJA 4KNGA 4KXFB 4XOSA 3C6NB 3RGZA 2BEXA 1XECA 1M0ZA 3ULUA 2WQWA 5IJBA 1YRGA 1A4YA 4R08A 2OMYA 4J0MA 1OTOA 4BSUA
chains in the Genus database with same CATH topology
3CIGA 5B0TA 4Y61B 4ARNA 3SB4A 4QBZA 1FT8A 2OMXA 4FD0A 5GMHA 5GQRK 5GMGA 3WPFA 3E2JA 4R6AA 3ZYOA 4CNCA 5FTTB 2ELLA 4WYKA 4P91A 4QXEA 3WPEA 3M19A 3W3LA 1XKUA 4FHOA 4C2AB 1ZIWA 4BSSA 3WPIA 4NKHA 3W3GA 2JE1A 1O6VA 2JE0A 5AWDA 4ECOA 4RCWA 4B8CD 1KOHA 2OMUA 2OMWA 2ASTB 4XSQA 3ULAA 2V9SA 4Z61C 2Y5QA 2V9TB 1FO1A 1JL5A 4LSCA 4IM6A 4Z94G 4QC0A 4BSRA 2WQUA 2A0ZA 1P8VA 3BZ5A 3RFSA 2Z63A 4V2DA 3M18A 3O53A 4ECNA 3WPGA 3G39A 4Q3IA 5CMPA 4R07A 1DCEA 5GS2B 4KT1A 1H6UA 1K5DC 1OTMA 3G3AA 3P72A 4H09A 3RFJA 4FCGA 4L3FA 1DS9A 2OMTA 4NKGA 3UL8A 2FT3A 3OGKB 4J4LA 4PEQB 3DZEA 2XOTA 1O6SA 4R5CA 2P1MB 2Q4GW 1A9NA 1FQVA 1LTXA 4R6FA 1GWBA 3E6JA 2OMZA 4EZGA 1OZNA 4AW4A 2V70A 4PERA 4I6JB 2JQDA 2P1OB 1U0ND 4UFRA 3KJ4A 2O6QA 5GMFA 1M10B 2RA8A 4ARRA 3CIYA 1KOOA 4LI1A 2O6RA 4Q3GA 4V2CA 4K17A 5D3IA 4U09A 3ULVA 3WN4A 4FS7A 4Z8GA 1DFJI 4P8SA 3WPCA 3OGLB 1IO0A 5B4PA 4BV4R 4U06A 4R6GA 2CA6A 3ZYIA 1OTNA 3W3NA 3VQ1A 2Z81A 4CC4C 2Z66A 1XCDA 5AWCA 4PKIG 3RW7A 3UN9A 3GOZA 2Z82A 3UL7A 4CILA 2RR6A 3FXIA 3WPHA 3G3BA 5CMNA 4R09A 3UL9A 4RWTC 1G9UA 1QYYA 3W3JA 3WPBA 3JB9j 4CC4A 2Z62A 3W3KA 4M7EA 4G8AA 4R5DA 3REZA 2R9UA 2IFGA 3OGMB 1OOKG 2UZYA 4LSXC 4TZHA 1XEUA 3WPDA 1Z7XW 3C6OB 3RFEA 4PQ8A 4FMZA 1XWDC 2P1PB 3W3MA 3RJ0A 3G06A 4HQ1A 4GT6A 3G04C 1OGQA 1WWLA 4CP6A 2UZXA 1M9LA 1FS2A 4FDWA 3TSRE 1H6TA 4LSXA 2BNHA 5AZ5A 4U7LA 5IYXC 1P8TA 4U08A 3ZYJA 5HDHA 5IJDA 2O6SA 3CVRA 2ID5A 4LXSA 4CNMA 4OQTA 1SQ0B 4XGOA 2Z65A 2ASSB 4YEBB 5IJCA 5GS0A 4MN8B 4R0AA 3O6NA 2P1NB 4R58A 5HZLB 1D0BA 2WFHA 2WQXA 4L3AA 4GLPA 4LXRA 2XWTC 4MQWX 4M7EC 1K5GC 2Z64A 3E3ZA 2P1QB 3OJAB 4LSAA 4Q62A 3OJAA 2OMVA 4LI2A 4V2EA 4RCAB 1W8AA 3RGXA 2Z7XB 1O6TA 3ZYNA 5B0NA 3E4GA 2Z7XA 3C6PB 5AWAA 4AY9X 3RIZA 1M9SA 3VQ2A 3PMHG 4Z64C 2WQVA 4Z79A 4C2BB 1PGVA 3A79B 4R6JA 5LFNA 5AWBA 3RW6A 1P9AG 5A5CA 4WP6A 4PSJA 4KNGA 4KXFB 4XOSA 3C6NB 3RGZA 2BEXA 1XECA 1M0ZA 3ULUA 2WQWA 5IJBA 1YRGA 1A4YA 4R08A 2OMYA 4J0MA 1OTOA 4BSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIG A;  5B0T A;  4Y61 B;  4ARN A;  3SB4 A;  4QBZ A;  1FT8 A;  2OMX A;  4FD0 A;  5GMH A;  5GQR K;  5GMG A;  3WPF A;  3E2J A;  4R6A A;  3ZYO A;  4CNC A;  5FTT B;  2ELL A;  4WYK A;  4P91 A;  4QXE A;  3WPE A;  3M19 A;  3W3L A;  1XKU A;  4FHO A;  4C2A B;  1ZIW A;  4BSS A;  3WPI A;  4NKH A;  3W3G A;  2JE1 A;  1O6V A;  2JE0 A;  5AWD A;  4ECO A;  4RCW A;  4B8C D;  1KOH A;  2OMU A;  2OMW A;  2AST B;  4XSQ A;  3ULA A;  2V9S A;  4Z61 C;  2Y5Q A;  2V9T B;  1FO1 A;  1JL5 A;  4LSC A;  4IM6 A;  4Z94 G;  4QC0 A;  4BSR A;  2WQU A;  2A0Z A;  1P8V A;  3BZ5 A;  3RFS A;  2Z63 A;  4V2D A;  3M18 A;  3O53 A;  4ECN A;  3WPG A;  3G39 A;  4Q3I A;  5CMP A;  4R07 A;  1DCE A;  5GS2 B;  4KT1 A;  1H6U A;  1K5D C;  1OTM A;  3G3A A;  3P72 A;  4H09 A;  3RFJ A;  4FCG A;  4L3F A;  1DS9 A;  2OMT A;  4NKG A;  3UL8 A;  2FT3 A;  3OGK B;  4J4L A;  4PEQ B;  3DZE A;  2XOT A;  1O6S A;  4R5C A;  2P1M B;  2Q4G W;  1A9N A;  1FQV A;  1LTX A;  4R6F A;  1GWB A;  3E6J A;  2OMZ A;  4EZG A;  1OZN A;  4AW4 A;  2V70 A;  4PER A;  4I6J B;  2JQD A;  2P1O B;  1U0N D;  4UFR A;  3KJ4 A;  2O6Q A;  5GMF A;  1M10 B;  2RA8 A;  4ARR A;  3CIY A;  1KOO A;  4LI1 A;  2O6R A;  4Q3G A;  4V2C A;  4K17 A;  5D3I A;  4U09 A;  3ULV A;  3WN4 A;  4FS7 A;  4Z8G A;  1DFJ I;  4P8S A;  3WPC A;  3OGL B;  1IO0 A;  5B4P A;  4BV4 R;  4U06 A;  4R6G A;  2CA6 A;  3ZYI A;  1OTN A;  3W3N A;  3VQ1 A;  2Z81 A;  4CC4 C;  2Z66 A;  1XCD A;  5AWC A;  4PKI G;  3RW7 A;  3UN9 A;  3GOZ A;  2Z82 A;  3UL7 A;  4CIL A;  2RR6 A;  3FXI A;  3WPH A;  3G3B A;  5CMN A;  4R09 A;  3UL9 A;  4RWT C;  1G9U A;  1QYY A;  3W3J A;  3WPB A;  3JB9 j;  4CC4 A;  2Z62 A;  3W3K A;  4M7E A;  4G8A A;  4R5D A;  3REZ A;  2R9U A;  2IFG A;  3OGM B;  1OOK G;  2UZY A;  4LSX C;  4TZH A;  1XEU A;  3WPD A;  1Z7X W;  3C6O B;  3RFE A;  4PQ8 A;  4FMZ A;  1XWD C;  2P1P B;  3W3M A;  3RJ0 A;  3G06 A;  4HQ1 A;  4GT6 A;  3G04 C;  1OGQ A;  1WWL A;  4CP6 A;  2UZX A;  1M9L A;  1FS2 A;  4FDW A;  3TSR E;  1H6T A;  4LSX A;  2BNH A;  5AZ5 A;  4U7L A;  5IYX C;  1P8T A;  4U08 A;  3ZYJ A;  5HDH A;  5IJD A;  2O6S A;  3CVR A;  2ID5 A;  4LXS A;  4CNM A;  4OQT A;  1SQ0 B;  4XGO A;  2Z65 A;  2ASS B;  4YEB B;  5IJC A;  5GS0 A;  4MN8 B;  4R0A A;  3O6N A;  2P1N B;  4R58 A;  5HZL B;  1D0B A;  2WFH A;  2WQX A;  4L3A A;  4GLP A;  4LXR A;  2XWT C;  4MQW X;  4M7E C;  1K5G C;  2Z64 A;  3E3Z A;  2P1Q B;  3OJA B;  4LSA A;  4Q62 A;  3OJA A;  2OMV A;  4LI2 A;  4V2E A;  4RCA B;  1W8A A;  3RGX A;  2Z7X B;  1O6T A;  3ZYN A;  5B0N A;  3E4G A;  2Z7X A;  3C6P B;  5AWA A;  4AY9 X;  3RIZ A;  1M9S A;  3VQ2 A;  3PMH G;  4Z64 C;  2WQV A;  4Z79 A;  4C2B B;  1PGV A;  3A79 B;  4R6J A;  5LFN A;  5AWB A;  3RW6 A;  1P9A G;  5A5C A;  4WP6 A;  4PSJ A;  4KNG A;  4KXF B;  4XOS A;  3C6N B;  3RGZ A;  2BEX A;  1XEC A;  1M0Z A;  3ULU A;  2WQW A;  5IJB A;  1YRG A;  1A4Y A;  4R08 A;  2OMY A;  4J0M A;  1OTO A;  4BSU A; 
#chains in the Genus database with same CATH topology
 3CIG A;  5B0T A;  4Y61 B;  4ARN A;  3SB4 A;  4QBZ A;  1FT8 A;  2OMX A;  4FD0 A;  5GMH A;  5GQR K;  5GMG A;  4NZR M;  3WPF A;  3E2J A;  4R6A A;  3ZYO A;  4CNC A;  5FTT B;  2ELL A;  4WYK A;  4P91 A;  4QXE A;  3WPE A;  3M19 A;  3W3L A;  1XKU A;  4FHO A;  4C2A B;  1ZIW A;  4BSS A;  3WPI A;  4NKH A;  3W3G A;  2JE1 A;  1O6V A;  2JE0 A;  5AWD A;  4ECO A;  4RCW A;  4B8C D;  1KOH A;  2OMU A;  2OMW A;  2AST B;  4XSQ A;  3ULA A;  2V9S A;  4Z61 C;  2Y5Q A;  2V9T B;  1FO1 A;  1JL5 A;  4LSC A;  4IM6 A;  4Z94 G;  4QC0 A;  4BSR A;  2WQU A;  2A0Z A;  1P8V A;  3BZ5 A;  3RFS A;  2Z63 A;  4V2D A;  3M18 A;  3O53 A;  4ECN A;  3WPG A;  3G39 A;  4Q3I A;  5CMP A;  4R07 A;  1DCE A;  5GS2 B;  4KT1 A;  1H6U A;  1K5D C;  1OTM A;  3G3A A;  3P72 A;  4H09 A;  3RFJ A;  4FCG A;  4L3F A;  1DS9 A;  2OMT A;  4NKG A;  3UL8 A;  2FT3 A;  3OGK B;  4J4L A;  4PEQ B;  3DZE A;  2XOT A;  1O6S A;  4R5C A;  2P1M B;  2Q4G W;  1A9N A;  1FQV A;  1LTX A;  4R6F A;  1GWB A;  3E6J A;  2OMZ A;  4EZG A;  1OZN A;  4AW4 A;  2V70 A;  4PER A;  4I6J B;  2JQD A;  2P1O B;  1U0N D;  4UFR A;  3KJ4 A;  2O6Q A;  5GMF A;  1M10 B;  2RA8 A;  4ARR A;  3CIY A;  1KOO A;  4LI1 A;  2O6R A;  4Q3G A;  4V2C A;  4K17 A;  5D3I A;  4U09 A;  3ULV A;  3WN4 A;  4FS7 A;  4Z8G A;  1DFJ I;  4P8S A;  3WPC A;  3OGL B;  1IO0 A;  5B4P A;  4BV4 R;  4U06 A;  4R6G A;  2CA6 A;  3ZYI A;  1OTN A;  3W3N A;  3VQ1 A;  2Z81 A;  4CC4 C;  2Z66 A;  1XCD A;  5AWC A;  4PKI G;  3RW7 A;  3UN9 A;  3GOZ A;  2Z82 A;  3UL7 A;  4CIL A;  2RR6 A;  3FXI A;  3WPH A;  3G3B A;  5CMN A;  4R09 A;  3UL9 A;  4RWT C;  1G9U A;  1QYY A;  3W3J A;  3WPB A;  3JB9 j;  4CC4 A;  2Z62 A;  3W3K A;  4NZT M;  4M7E A;  4G8A A;  4R5D A;  3REZ A;  2R9U A;  2IFG A;  3OGM B;  1OOK G;  2UZY A;  4LSX C;  4TZH A;  1XEU A;  3WPD A;  1Z7X W;  3C6O B;  3RFE A;  4PQ8 A;  4FMZ A;  1XWD C;  2P1P B;  3W3M A;  3RJ0 A;  3G06 A;  4HQ1 A;  4GT6 A;  3G04 C;  1OGQ A;  1WWL A;  4CP6 A;  2UZX A;  1M9L A;  1FS2 A;  4FDW A;  3TSR E;  1H6T A;  4LSX A;  2BNH A;  5AZ5 A;  4U7L A;  5IYX C;  1P8T A;  4U08 A;  3ZYJ A;  5HDH A;  5IJD A;  2O6S A;  3CVR A;  2ID5 A;  4LXS A;  4CNM A;  4OQT A;  1SQ0 B;  4XGO A;  2Z65 A;  2ASS B;  4YEB B;  5IJC A;  5GS0 A;  4MN8 B;  4R0A A;  3O6N A;  2P1N B;  4R58 A;  5HZL B;  1D0B A;  2WFH A;  2WQX A;  4L3A A;  4GLP A;  4LXR A;  2XWT C;  4MQW X;  4M7E C;  1K5G C;  2Z64 A;  3E3Z A;  2P1Q B;  3OJA B;  4LSA A;  4Q62 A;  3OJA A;  2OMV A;  4LI2 A;  4V2E A;  4RCA B;  1W8A A;  3RGX A;  2Z7X B;  1O6T A;  3ZYN A;  5B0N A;  3E4G A;  2Z7X A;  3C6P B;  5AWA A;  4AY9 X;  3RIZ A;  1M9S A;  3VQ2 A;  3PMH G;  4Z64 C;  2WQV A;  4Z79 A;  4C2B B;  1PGV A;  3A79 B;  4R6J A;  5LFN A;  5AWB A;  3RW6 A;  1P9A G;  5A5C A;  4WP6 A;  4PSJ A;  4KNG A;  4KXF B;  4XOS A;  3C6N B;  3RGZ A;  2BEX A;  1XEC A;  1M0Z A;  3ULU A;  2WQW A;  5IJB A;  1YRG A;  1A4Y A;  4R08 A;  2OMY A;  4J0M A;  1OTO A;  4BSU A; 
#chains in the Genus database with same CATH homology
 3CIG A;  5B0T A;  4Y61 B;  4ARN A;  3SB4 A;  4QBZ A;  1FT8 A;  2OMX A;  4FD0 A;  5GMH A;  5GQR K;  5GMG A;  3WPF A;  3E2J A;  4R6A A;  3ZYO A;  4CNC A;  5FTT B;  2ELL A;  4WYK A;  4P91 A;  4QXE A;  3WPE A;  3M19 A;  3W3L A;  1XKU A;  4FHO A;  4C2A B;  1ZIW A;  4BSS A;  3WPI A;  4NKH A;  3W3G A;  2JE1 A;  1O6V A;  2JE0 A;  5AWD A;  4ECO A;  4RCW A;  4B8C D;  1KOH A;  2OMU A;  2OMW A;  2AST B;  4XSQ A;  3ULA A;  2V9S A;  4Z61 C;  2Y5Q A;  2V9T B;  1FO1 A;  1JL5 A;  4LSC A;  4IM6 A;  4Z94 G;  4QC0 A;  4BSR A;  2WQU A;  2A0Z A;  1P8V A;  3BZ5 A;  3RFS A;  2Z63 A;  4V2D A;  3M18 A;  3O53 A;  4ECN A;  3WPG A;  3G39 A;  4Q3I A;  5CMP A;  4R07 A;  1DCE A;  5GS2 B;  4KT1 A;  1H6U A;  1K5D C;  1OTM A;  3G3A A;  3P72 A;  4H09 A;  3RFJ A;  4FCG A;  4L3F A;  1DS9 A;  2OMT A;  4NKG A;  3UL8 A;  2FT3 A;  3OGK B;  4J4L A;  4PEQ B;  3DZE A;  2XOT A;  1O6S A;  4R5C A;  2P1M B;  2Q4G W;  1A9N A;  1FQV A;  1LTX A;  4R6F A;  1GWB A;  3E6J A;  2OMZ A;  4EZG A;  1OZN A;  4AW4 A;  2V70 A;  4PER A;  4I6J B;  2JQD A;  2P1O B;  1U0N D;  4UFR A;  3KJ4 A;  2O6Q A;  5GMF A;  1M10 B;  2RA8 A;  4ARR A;  3CIY A;  1KOO A;  4LI1 A;  2O6R A;  4Q3G A;  4V2C A;  4K17 A;  5D3I A;  4U09 A;  3ULV A;  3WN4 A;  4FS7 A;  4Z8G A;  1DFJ I;  4P8S A;  3WPC A;  3OGL B;  1IO0 A;  5B4P A;  4BV4 R;  4U06 A;  4R6G A;  2CA6 A;  3ZYI A;  1OTN A;  3W3N A;  3VQ1 A;  2Z81 A;  4CC4 C;  2Z66 A;  1XCD A;  5AWC A;  4PKI G;  3RW7 A;  3UN9 A;  3GOZ A;  2Z82 A;  3UL7 A;  4CIL A;  2RR6 A;  3FXI A;  3WPH A;  3G3B A;  5CMN A;  4R09 A;  3UL9 A;  4RWT C;  1G9U A;  1QYY A;  3W3J A;  3WPB A;  3JB9 j;  4CC4 A;  2Z62 A;  3W3K A;  4M7E A;  4G8A A;  4R5D A;  3REZ A;  2R9U A;  2IFG A;  3OGM B;  1OOK G;  2UZY A;  4LSX C;  4TZH A;  1XEU A;  3WPD A;  1Z7X W;  3C6O B;  3RFE A;  4PQ8 A;  4FMZ A;  1XWD C;  2P1P B;  3W3M A;  3RJ0 A;  3G06 A;  4HQ1 A;  4GT6 A;  3G04 C;  1OGQ A;  1WWL A;  4CP6 A;  2UZX A;  1M9L A;  1FS2 A;  4FDW A;  3TSR E;  1H6T A;  4LSX A;  2BNH A;  5AZ5 A;  4U7L A;  5IYX C;  1P8T A;  4U08 A;  3ZYJ A;  5HDH A;  5IJD A;  2O6S A;  3CVR A;  2ID5 A;  4LXS A;  4CNM A;  4OQT A;  1SQ0 B;  4XGO A;  2Z65 A;  2ASS B;  4YEB B;  5IJC A;  5GS0 A;  4MN8 B;  4R0A A;  3O6N A;  2P1N B;  4R58 A;  5HZL B;  1D0B A;  2WFH A;  2WQX A;  4L3A A;  4GLP A;  4LXR A;  2XWT C;  4MQW X;  4M7E C;  1K5G C;  2Z64 A;  3E3Z A;  2P1Q B;  3OJA B;  4LSA A;  4Q62 A;  3OJA A;  2OMV A;  4LI2 A;  4V2E A;  4RCA B;  1W8A A;  3RGX A;  2Z7X B;  1O6T A;  3ZYN A;  5B0N A;  3E4G A;  2Z7X A;  3C6P B;  5AWA A;  4AY9 X;  3RIZ A;  1M9S A;  3VQ2 A;  3PMH G;  4Z64 C;  2WQV A;  4Z79 A;  4C2B B;  1PGV A;  3A79 B;  4R6J A;  5LFN A;  5AWB A;  3RW6 A;  1P9A G;  5A5C A;  4WP6 A;  4PSJ A;  4KNG A;  4KXF B;  4XOS A;  3C6N B;  3RGZ A;  2BEX A;  1XEC A;  1M0Z A;  3ULU A;  2WQW A;  5IJB A;  1YRG A;  1A4Y A;  4R08 A;  2OMY A;  4J0M A;  1OTO A;  4BSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...