3M18A

Crystal structure of variable lymphocyte receptor vlra.r2.1 in complex with hen egg lysozyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
245
structure length
245
Chain Sequence
TCETVTGCTCNEGKKEVDCQGKSLDSVPSGIPADTEKLDLQSTGLATLSDATFRGLTKLTWLNLDYNQLQTLSAGVFDDLTELGTLGLANNQLASLPLGVFDHLTQLDKLYLGGNQLKSLPSGVFDRLTKLKELRLNTNQLQSIPAGAFDKLTNLQTLSLSTNQLQSVPHGAFDRLGKLQTITLFGNQFDCSRCETLYLSQWIRENSNKVKDGTGQNLHESPDGVTCSDGKVVRTVTNETLKYEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Variable lymphocyte receptor A diversity region
publication title A structural basis for antigen recognition by the T cell-like lymphocytes of sea lamprey.
pubmed doi rcsb
source organism Petromyzon marinus
total genus 62
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3m18A00
1O6VA 4V2DA 2RA8A 4P91A 5IJBA 4OQTA 5LFNA 1LTXA 4K17A 3RGXA 1ZIWA 4R6FA 1DCEA 4R6AA 2P1NB 4PEQB 1OTOA 2WQVA 4TZHA 3ULUA 3OGKB 3ULAA 4RCAB 3G06A 2Z7XA 2Z66A 1OOKG 1DFJI 2R9UA 3SB4A 3W3NA 2OMUA 4FMZA 3WPEA 3W3LA 3UN9A 5GQRK 4Z79A 3OGLB 5GMFA 3CIYA 4R5CA 1KOHA 2XWTC 1XWDC 4GT6A 3M18A 5B0NA 2Z82A 4EZGA 4ECOA 5GMHA 2ASSB 1FS2A 4AW4A 4H09A 2Z65A 4RWTC 4PKIG 2Z7XB 3A79B 4AY9X 4Z8GA 4C2AB 2BEXA 4V2CA 3ULVA 1FO1A 1OZNA 4B8CD 2Y5QA 3G04C 3ZYJA 3W3KA 2OMVA 4LSAA 4ARRA 1OTNA 4Q3IA 2P1MB 2P1PB 1P9AG 1O6SA 4U09A 1DS9A 4I6JB 1FQVA 3UL7A 4CILA 4R58A 4YEBB 5HDHA 1XECA 2ASTB 3E6JA 5B0TA 2JE1A 1H6UA 2BNHA 1QYYA 1IO0A 2P1OB 4R6GA 3M19A 5AWDA 5IJDA 4XOSA 2RR6A 3RFJA 4PQ8A 4BSRA 3CVRA 4UFRA 2V9SA 2UZXA 4R6JA 1FT8A 3OGMB 4R0AA 3DZEA 4G8AA 4R08A 2IFGA 3KJ4A 4U06A 4R07A 1A4YA 1PGVA 1XKUA 5CMNA 5HZLB 4L3FA 4WP6A 3E2JA 4J0MA 3WPDA 4LI1A 3G39A 5B4PA 4M7EC 1P8VA 4V2EA 4FHOA 4LSXC 4LXSA 4J4LA 3ZYOA 5AWCA 4Z94G 1WWLA 3WPBA 4U7LA 3BZ5A 3O6NA 4FDWA 3WPFA 4ARNA 3WPCA 2OMXA 5CMPA 1A9NA 2JQDA 3TSRE 4LXRA 5IYXC 1H6TA 4U08A 2JE0A 2WQXA 4CC4A 3RJ0A 4Z61C 3WPIA 3RIZA 2O6QA 1M0ZA 4Q62A 5FTTB 2Z63A 4FCGA 1YRGA 2Z81A 4FS7A 3VQ1A 1O6TA 4CNMA 1Z7XW 3RFEA 2O6SA 4NKHA 1K5GC 4XGOA 4KXFB 2V70A 1U0ND 1M10B 4CNCA 1JL5A 1OGQA 3ZYIA 4RCWA 4CC4C 4M7EA 3P72A 4LSCA 5A5CA 3CIGA 3O53A 5AZ5A 4LSXA 1XEUA 2O6RA 3VQ2A 3C6PB 3E3ZA 3FXIA 2Q4GW 4FD0A 4MN8B 4WYKA 4BV4R 2OMWA 3WPHA 1P8TA 4PSJA 4MQWX 4C2BB 3RW6A 1OTMA 3RW7A 4HQ1A 4Q3GA 1W8AA 5D3IA 2Z62A 4L3AA 3W3GA 4CP6A 3E4GA 2OMTA 2WQUA 4BSSA 1G9UA 4ECNA 5GS2B 3OJAA 2OMYA 1D0BA 3W3MA 2WQWA 3UL8A 4IM6A 3W3JA 1SQ0B 2FT3A 5AWAA 3UL9A 2Z64A 3PMHG 3WPGA 4Y61B 2XOTA 3ZYNA 2P1QB 3C6NB 2WFHA 4QBZA 3RGZA 1M9SA 4R09A 1GWBA 3WN4A 2UZYA 5IJCA 4XSQA 1K5DC 4KNGA 3RFSA 2ELLA 5GS0A 3REZA 4R5DA 2CA6A 3JB9j 2ID5A 4KT1A 3OJAB 3C6OB 2A0ZA 4Z64C 4GLPA 1M9LA 5GMGA 1KOOA 3G3AA 1XCDA 3GOZA 4P8SA 4QXEA 3G3BA 4QC0A 2V9TB 5AWBA 4BSUA 2OMZA 4NKGA 4LI2A 4PERA
chains in the Genus database with same CATH superfamily
1O6VA 4V2DA 2RA8A 4P91A 5IJBA 4OQTA 5LFNA 1LTXA 4K17A 3RGXA 1ZIWA 4R6FA 1DCEA 4R6AA 2P1NB 4PEQB 1OTOA 2WQVA 4TZHA 3ULUA 3OGKB 3ULAA 4RCAB 3G06A 2Z7XA 2Z66A 1OOKG 1DFJI 2R9UA 3SB4A 3W3NA 2OMUA 4FMZA 3WPEA 3W3LA 3UN9A 5GQRK 4Z79A 3OGLB 5GMFA 3CIYA 4R5CA 1KOHA 2XWTC 1XWDC 4GT6A 3M18A 5B0NA 2Z82A 4EZGA 4NZRM 4ECOA 5GMHA 2ASSB 1FS2A 4AW4A 4H09A 2Z65A 4RWTC 4PKIG 2Z7XB 3A79B 4AY9X 4Z8GA 4C2AB 2BEXA 4V2CA 3ULVA 1FO1A 1OZNA 4B8CD 2Y5QA 3G04C 3ZYJA 3W3KA 2OMVA 4LSAA 4ARRA 1OTNA 4Q3IA 2P1MB 2P1PB 1P9AG 1O6SA 4U09A 1DS9A 4I6JB 1FQVA 3UL7A 4CILA 4R58A 4YEBB 5HDHA 1XECA 2ASTB 3E6JA 5B0TA 2JE1A 1H6UA 2BNHA 1QYYA 1IO0A 2P1OB 4R6GA 3M19A 5AWDA 5IJDA 4XOSA 2RR6A 3RFJA 4PQ8A 4BSRA 3CVRA 4UFRA 2V9SA 2UZXA 4R6JA 1FT8A 3OGMB 4R0AA 3DZEA 4G8AA 4R08A 2IFGA 3KJ4A 4U06A 4R07A 1A4YA 1PGVA 1XKUA 5CMNA 5HZLB 4L3FA 4WP6A 3E2JA 4J0MA 3WPDA 4LI1A 3G39A 5B4PA 4M7EC 1P8VA 4V2EA 4FHOA 4LSXC 4LXSA 4J4LA 3ZYOA 5AWCA 4Z94G 1WWLA 3WPBA 4U7LA 3BZ5A 3O6NA 4FDWA 3WPFA 4ARNA 3WPCA 2OMXA 5CMPA 1A9NA 2JQDA 3TSRE 4LXRA 5IYXC 1H6TA 4U08A 2JE0A 2WQXA 4CC4A 3RJ0A 4Z61C 3WPIA 3RIZA 2O6QA 1M0ZA 4Q62A 5FTTB 2Z63A 4FCGA 1YRGA 2Z81A 4FS7A 3VQ1A 1O6TA 4CNMA 1Z7XW 3RFEA 2O6SA 4NKHA 1K5GC 4XGOA 4KXFB 2V70A 1U0ND 1M10B 4CNCA 1JL5A 1OGQA 3ZYIA 4RCWA 4CC4C 4M7EA 3P72A 4LSCA 5A5CA 3CIGA 3O53A 5AZ5A 4LSXA 1XEUA 2O6RA 3VQ2A 3C6PB 3E3ZA 3FXIA 2Q4GW 4FD0A 4MN8B 4WYKA 4BV4R 2OMWA 3WPHA 1P8TA 4PSJA 4MQWX 4C2BB 3RW6A 1OTMA 3RW7A 4HQ1A 4Q3GA 1W8AA 5D3IA 2Z62A 4L3AA 3W3GA 4CP6A 3E4GA 2OMTA 2WQUA 4BSSA 1G9UA 4ECNA 5GS2B 3OJAA 2OMYA 1D0BA 3W3MA 2WQWA 3UL8A 4IM6A 4NZTM 1SQ0B 3W3JA 2FT3A 5AWAA 3UL9A 2Z64A 3PMHG 3WPGA 4Y61B 2XOTA 3ZYNA 2P1QB 3C6NB 2WFHA 4QBZA 3RGZA 1M9SA 4R09A 1GWBA 3WN4A 2UZYA 5IJCA 4XSQA 1K5DC 4KNGA 3RFSA 2ELLA 5GS0A 3REZA 4R5DA 2CA6A 3JB9j 2ID5A 4KT1A 3OJAB 3C6OB 2A0ZA 4Z64C 4GLPA 1M9LA 5GMGA 1KOOA 3G3AA 1XCDA 3GOZA 4P8SA 4QXEA 3G3BA 4QC0A 2V9TB 5AWBA 4BSUA 2OMZA 4NKGA 4LI2A 4PERA
chains in the Genus database with same CATH topology
1O6VA 4V2DA 2RA8A 4P91A 5IJBA 4OQTA 5LFNA 1LTXA 4K17A 3RGXA 1ZIWA 4R6FA 1DCEA 4R6AA 2P1NB 4PEQB 1OTOA 2WQVA 4TZHA 3ULUA 3OGKB 3ULAA 4RCAB 3G06A 2Z7XA 2Z66A 1OOKG 1DFJI 2R9UA 3SB4A 3W3NA 2OMUA 4FMZA 3WPEA 3W3LA 3UN9A 5GQRK 4Z79A 3OGLB 5GMFA 3CIYA 4R5CA 1KOHA 2XWTC 1XWDC 4GT6A 3M18A 5B0NA 2Z82A 4EZGA 4ECOA 5GMHA 2ASSB 1FS2A 4AW4A 4H09A 2Z65A 4RWTC 4PKIG 2Z7XB 3A79B 4AY9X 4Z8GA 4C2AB 2BEXA 4V2CA 3ULVA 1FO1A 1OZNA 4B8CD 2Y5QA 3G04C 3ZYJA 3W3KA 2OMVA 4LSAA 4ARRA 1OTNA 4Q3IA 2P1MB 2P1PB 1P9AG 1O6SA 4U09A 1DS9A 4I6JB 1FQVA 3UL7A 4CILA 4R58A 4YEBB 5HDHA 1XECA 2ASTB 3E6JA 5B0TA 2JE1A 1H6UA 2BNHA 1QYYA 1IO0A 2P1OB 4R6GA 3M19A 5AWDA 5IJDA 4XOSA 2RR6A 3RFJA 4PQ8A 4BSRA 3CVRA 4UFRA 2V9SA 2UZXA 4R6JA 1FT8A 3OGMB 4R0AA 3DZEA 4G8AA 4R08A 2IFGA 3KJ4A 4U06A 4R07A 1A4YA 1PGVA 1XKUA 5CMNA 5HZLB 4L3FA 4WP6A 3E2JA 4J0MA 3WPDA 4LI1A 3G39A 5B4PA 4M7EC 1P8VA 4V2EA 4FHOA 4LSXC 4LXSA 4J4LA 3ZYOA 5AWCA 4Z94G 1WWLA 3WPBA 4U7LA 3BZ5A 3O6NA 4FDWA 3WPFA 4ARNA 3WPCA 2OMXA 5CMPA 1A9NA 2JQDA 3TSRE 4LXRA 5IYXC 1H6TA 4U08A 2JE0A 2WQXA 4CC4A 3RJ0A 4Z61C 3WPIA 3RIZA 2O6QA 1M0ZA 4Q62A 5FTTB 2Z63A 4FCGA 1YRGA 2Z81A 4FS7A 3VQ1A 1O6TA 4CNMA 1Z7XW 3RFEA 2O6SA 4NKHA 1K5GC 4XGOA 4KXFB 2V70A 1U0ND 1M10B 4CNCA 1JL5A 1OGQA 3ZYIA 4RCWA 4CC4C 4M7EA 3P72A 4LSCA 5A5CA 3CIGA 3O53A 5AZ5A 4LSXA 1XEUA 2O6RA 3VQ2A 3C6PB 3E3ZA 3FXIA 2Q4GW 4FD0A 4MN8B 4WYKA 4BV4R 2OMWA 3WPHA 1P8TA 4PSJA 4MQWX 4C2BB 3RW6A 1OTMA 3RW7A 4HQ1A 4Q3GA 1W8AA 5D3IA 2Z62A 4L3AA 3W3GA 4CP6A 3E4GA 2OMTA 2WQUA 4BSSA 1G9UA 4ECNA 5GS2B 3OJAA 2OMYA 1D0BA 3W3MA 2WQWA 3UL8A 4IM6A 3W3JA 1SQ0B 2FT3A 5AWAA 3UL9A 2Z64A 3PMHG 3WPGA 4Y61B 2XOTA 3ZYNA 2P1QB 3C6NB 2WFHA 4QBZA 3RGZA 1M9SA 4R09A 1GWBA 3WN4A 2UZYA 5IJCA 4XSQA 1K5DC 4KNGA 3RFSA 2ELLA 5GS0A 3REZA 4R5DA 2CA6A 3JB9j 2ID5A 4KT1A 3OJAB 3C6OB 2A0ZA 4Z64C 4GLPA 1M9LA 5GMGA 1KOOA 3G3AA 1XCDA 3GOZA 4P8SA 4QXEA 3G3BA 4QC0A 2V9TB 5AWBA 4BSUA 2OMZA 4NKGA 4LI2A 4PERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6V A;  4V2D A;  2RA8 A;  4P91 A;  5IJB A;  4OQT A;  5LFN A;  1LTX A;  4K17 A;  3RGX A;  1ZIW A;  4R6F A;  1DCE A;  4R6A A;  2P1N B;  4PEQ B;  1OTO A;  2WQV A;  4TZH A;  3ULU A;  3OGK B;  3ULA A;  4RCA B;  3G06 A;  2Z7X A;  2Z66 A;  1OOK G;  1DFJ I;  2R9U A;  3SB4 A;  3W3N A;  2OMU A;  4FMZ A;  3WPE A;  3W3L A;  3UN9 A;  5GQR K;  4Z79 A;  3OGL B;  5GMF A;  3CIY A;  4R5C A;  1KOH A;  2XWT C;  1XWD C;  4GT6 A;  3M18 A;  5B0N A;  2Z82 A;  4EZG A;  4ECO A;  5GMH A;  2ASS B;  1FS2 A;  4AW4 A;  4H09 A;  2Z65 A;  4RWT C;  4PKI G;  2Z7X B;  3A79 B;  4AY9 X;  4Z8G A;  4C2A B;  2BEX A;  4V2C A;  3ULV A;  1FO1 A;  1OZN A;  4B8C D;  2Y5Q A;  3G04 C;  3ZYJ A;  3W3K A;  2OMV A;  4LSA A;  4ARR A;  1OTN A;  4Q3I A;  2P1M B;  2P1P B;  1P9A G;  1O6S A;  4U09 A;  1DS9 A;  4I6J B;  1FQV A;  3UL7 A;  4CIL A;  4R58 A;  4YEB B;  5HDH A;  1XEC A;  2AST B;  3E6J A;  5B0T A;  2JE1 A;  1H6U A;  2BNH A;  1QYY A;  1IO0 A;  2P1O B;  4R6G A;  3M19 A;  5AWD A;  5IJD A;  4XOS A;  2RR6 A;  3RFJ A;  4PQ8 A;  4BSR A;  3CVR A;  4UFR A;  2V9S A;  2UZX A;  4R6J A;  1FT8 A;  3OGM B;  4R0A A;  3DZE A;  4G8A A;  4R08 A;  2IFG A;  3KJ4 A;  4U06 A;  4R07 A;  1A4Y A;  1PGV A;  1XKU A;  5CMN A;  5HZL B;  4L3F A;  4WP6 A;  3E2J A;  4J0M A;  3WPD A;  4LI1 A;  3G39 A;  5B4P A;  4M7E C;  1P8V A;  4V2E A;  4FHO A;  4LSX C;  4LXS A;  4J4L A;  3ZYO A;  5AWC A;  4Z94 G;  1WWL A;  3WPB A;  4U7L A;  3BZ5 A;  3O6N A;  4FDW A;  3WPF A;  4ARN A;  3WPC A;  2OMX A;  5CMP A;  1A9N A;  2JQD A;  3TSR E;  4LXR A;  5IYX C;  1H6T A;  4U08 A;  2JE0 A;  2WQX A;  4CC4 A;  3RJ0 A;  4Z61 C;  3WPI A;  3RIZ A;  2O6Q A;  1M0Z A;  4Q62 A;  5FTT B;  2Z63 A;  4FCG A;  1YRG A;  2Z81 A;  4FS7 A;  3VQ1 A;  1O6T A;  4CNM A;  1Z7X W;  3RFE A;  2O6S A;  4NKH A;  1K5G C;  4XGO A;  4KXF B;  2V70 A;  1U0N D;  1M10 B;  4CNC A;  1JL5 A;  1OGQ A;  3ZYI A;  4RCW A;  4CC4 C;  4M7E A;  3P72 A;  4LSC A;  5A5C A;  3CIG A;  3O53 A;  5AZ5 A;  4LSX A;  1XEU A;  2O6R A;  3VQ2 A;  3C6P B;  3E3Z A;  3FXI A;  2Q4G W;  4FD0 A;  4MN8 B;  4WYK A;  4BV4 R;  2OMW A;  3WPH A;  1P8T A;  4PSJ A;  4MQW X;  4C2B B;  3RW6 A;  1OTM A;  3RW7 A;  4HQ1 A;  4Q3G A;  1W8A A;  5D3I A;  2Z62 A;  4L3A A;  3W3G A;  4CP6 A;  3E4G A;  2OMT A;  2WQU A;  4BSS A;  1G9U A;  4ECN A;  5GS2 B;  3OJA A;  2OMY A;  1D0B A;  3W3M A;  2WQW A;  3UL8 A;  4IM6 A;  3W3J A;  1SQ0 B;  2FT3 A;  5AWA A;  3UL9 A;  2Z64 A;  3PMH G;  3WPG A;  4Y61 B;  2XOT A;  3ZYN A;  2P1Q B;  3C6N B;  2WFH A;  4QBZ A;  3RGZ A;  1M9S A;  4R09 A;  1GWB A;  3WN4 A;  2UZY A;  5IJC A;  4XSQ A;  1K5D C;  4KNG A;  3RFS A;  2ELL A;  5GS0 A;  3REZ A;  4R5D A;  2CA6 A;  3JB9 j;  2ID5 A;  4KT1 A;  3OJA B;  3C6O B;  2A0Z A;  4Z64 C;  4GLP A;  1M9L A;  5GMG A;  1KOO A;  3G3A A;  1XCD A;  3GOZ A;  4P8S A;  4QXE A;  3G3B A;  4QC0 A;  2V9T B;  5AWB A;  4BSU A;  2OMZ A;  4NKG A;  4LI2 A;  4PER A; 
#chains in the Genus database with same CATH topology
 1O6V A;  4V2D A;  2RA8 A;  4P91 A;  5IJB A;  4OQT A;  5LFN A;  1LTX A;  4K17 A;  3RGX A;  1ZIW A;  4R6F A;  1DCE A;  4R6A A;  2P1N B;  4PEQ B;  1OTO A;  2WQV A;  4TZH A;  3ULU A;  3OGK B;  3ULA A;  4RCA B;  3G06 A;  2Z7X A;  2Z66 A;  1OOK G;  1DFJ I;  2R9U A;  3SB4 A;  3W3N A;  2OMU A;  4FMZ A;  3WPE A;  3W3L A;  3UN9 A;  5GQR K;  4Z79 A;  3OGL B;  5GMF A;  3CIY A;  4R5C A;  1KOH A;  2XWT C;  1XWD C;  4GT6 A;  3M18 A;  5B0N A;  2Z82 A;  4EZG A;  4NZR M;  4ECO A;  5GMH A;  2ASS B;  1FS2 A;  4AW4 A;  4H09 A;  2Z65 A;  4RWT C;  4PKI G;  2Z7X B;  3A79 B;  4AY9 X;  4Z8G A;  4C2A B;  2BEX A;  4V2C A;  3ULV A;  1FO1 A;  1OZN A;  4B8C D;  2Y5Q A;  3G04 C;  3ZYJ A;  3W3K A;  2OMV A;  4LSA A;  4ARR A;  1OTN A;  4Q3I A;  2P1M B;  2P1P B;  1P9A G;  1O6S A;  4U09 A;  1DS9 A;  4I6J B;  1FQV A;  3UL7 A;  4CIL A;  4R58 A;  4YEB B;  5HDH A;  1XEC A;  2AST B;  3E6J A;  5B0T A;  2JE1 A;  1H6U A;  2BNH A;  1QYY A;  1IO0 A;  2P1O B;  4R6G A;  3M19 A;  5AWD A;  5IJD A;  4XOS A;  2RR6 A;  3RFJ A;  4PQ8 A;  4BSR A;  3CVR A;  4UFR A;  2V9S A;  2UZX A;  4R6J A;  1FT8 A;  3OGM B;  4R0A A;  3DZE A;  4G8A A;  4R08 A;  2IFG A;  3KJ4 A;  4U06 A;  4R07 A;  1A4Y A;  1PGV A;  1XKU A;  5CMN A;  5HZL B;  4L3F A;  4WP6 A;  3E2J A;  4J0M A;  3WPD A;  4LI1 A;  3G39 A;  5B4P A;  4M7E C;  1P8V A;  4V2E A;  4FHO A;  4LSX C;  4LXS A;  4J4L A;  3ZYO A;  5AWC A;  4Z94 G;  1WWL A;  3WPB A;  4U7L A;  3BZ5 A;  3O6N A;  4FDW A;  3WPF A;  4ARN A;  3WPC A;  2OMX A;  5CMP A;  1A9N A;  2JQD A;  3TSR E;  4LXR A;  5IYX C;  1H6T A;  4U08 A;  2JE0 A;  2WQX A;  4CC4 A;  3RJ0 A;  4Z61 C;  3WPI A;  3RIZ A;  2O6Q A;  1M0Z A;  4Q62 A;  5FTT B;  2Z63 A;  4FCG A;  1YRG A;  2Z81 A;  4FS7 A;  3VQ1 A;  1O6T A;  4CNM A;  1Z7X W;  3RFE A;  2O6S A;  4NKH A;  1K5G C;  4XGO A;  4KXF B;  2V70 A;  1U0N D;  1M10 B;  4CNC A;  1JL5 A;  1OGQ A;  3ZYI A;  4RCW A;  4CC4 C;  4M7E A;  3P72 A;  4LSC A;  5A5C A;  3CIG A;  3O53 A;  5AZ5 A;  4LSX A;  1XEU A;  2O6R A;  3VQ2 A;  3C6P B;  3E3Z A;  3FXI A;  2Q4G W;  4FD0 A;  4MN8 B;  4WYK A;  4BV4 R;  2OMW A;  3WPH A;  1P8T A;  4PSJ A;  4MQW X;  4C2B B;  3RW6 A;  1OTM A;  3RW7 A;  4HQ1 A;  4Q3G A;  1W8A A;  5D3I A;  2Z62 A;  4L3A A;  3W3G A;  4CP6 A;  3E4G A;  2OMT A;  2WQU A;  4BSS A;  1G9U A;  4ECN A;  5GS2 B;  3OJA A;  2OMY A;  1D0B A;  3W3M A;  2WQW A;  3UL8 A;  4IM6 A;  4NZT M;  1SQ0 B;  3W3J A;  2FT3 A;  5AWA A;  3UL9 A;  2Z64 A;  3PMH G;  3WPG A;  4Y61 B;  2XOT A;  3ZYN A;  2P1Q B;  3C6N B;  2WFH A;  4QBZ A;  3RGZ A;  1M9S A;  4R09 A;  1GWB A;  3WN4 A;  2UZY A;  5IJC A;  4XSQ A;  1K5D C;  4KNG A;  3RFS A;  2ELL A;  5GS0 A;  3REZ A;  4R5D A;  2CA6 A;  3JB9 j;  2ID5 A;  4KT1 A;  3OJA B;  3C6O B;  2A0Z A;  4Z64 C;  4GLP A;  1M9L A;  5GMG A;  1KOO A;  3G3A A;  1XCD A;  3GOZ A;  4P8S A;  4QXE A;  3G3B A;  4QC0 A;  2V9T B;  5AWB A;  4BSU A;  2OMZ A;  4NKG A;  4LI2 A;  4PER A; 
#chains in the Genus database with same CATH homology
 1O6V A;  4V2D A;  2RA8 A;  4P91 A;  5IJB A;  4OQT A;  5LFN A;  1LTX A;  4K17 A;  3RGX A;  1ZIW A;  4R6F A;  1DCE A;  4R6A A;  2P1N B;  4PEQ B;  1OTO A;  2WQV A;  4TZH A;  3ULU A;  3OGK B;  3ULA A;  4RCA B;  3G06 A;  2Z7X A;  2Z66 A;  1OOK G;  1DFJ I;  2R9U A;  3SB4 A;  3W3N A;  2OMU A;  4FMZ A;  3WPE A;  3W3L A;  3UN9 A;  5GQR K;  4Z79 A;  3OGL B;  5GMF A;  3CIY A;  4R5C A;  1KOH A;  2XWT C;  1XWD C;  4GT6 A;  3M18 A;  5B0N A;  2Z82 A;  4EZG A;  4ECO A;  5GMH A;  2ASS B;  1FS2 A;  4AW4 A;  4H09 A;  2Z65 A;  4RWT C;  4PKI G;  2Z7X B;  3A79 B;  4AY9 X;  4Z8G A;  4C2A B;  2BEX A;  4V2C A;  3ULV A;  1FO1 A;  1OZN A;  4B8C D;  2Y5Q A;  3G04 C;  3ZYJ A;  3W3K A;  2OMV A;  4LSA A;  4ARR A;  1OTN A;  4Q3I A;  2P1M B;  2P1P B;  1P9A G;  1O6S A;  4U09 A;  1DS9 A;  4I6J B;  1FQV A;  3UL7 A;  4CIL A;  4R58 A;  4YEB B;  5HDH A;  1XEC A;  2AST B;  3E6J A;  5B0T A;  2JE1 A;  1H6U A;  2BNH A;  1QYY A;  1IO0 A;  2P1O B;  4R6G A;  3M19 A;  5AWD A;  5IJD A;  4XOS A;  2RR6 A;  3RFJ A;  4PQ8 A;  4BSR A;  3CVR A;  4UFR A;  2V9S A;  2UZX A;  4R6J A;  1FT8 A;  3OGM B;  4R0A A;  3DZE A;  4G8A A;  4R08 A;  2IFG A;  3KJ4 A;  4U06 A;  4R07 A;  1A4Y A;  1PGV A;  1XKU A;  5CMN A;  5HZL B;  4L3F A;  4WP6 A;  3E2J A;  4J0M A;  3WPD A;  4LI1 A;  3G39 A;  5B4P A;  4M7E C;  1P8V A;  4V2E A;  4FHO A;  4LSX C;  4LXS A;  4J4L A;  3ZYO A;  5AWC A;  4Z94 G;  1WWL A;  3WPB A;  4U7L A;  3BZ5 A;  3O6N A;  4FDW A;  3WPF A;  4ARN A;  3WPC A;  2OMX A;  5CMP A;  1A9N A;  2JQD A;  3TSR E;  4LXR A;  5IYX C;  1H6T A;  4U08 A;  2JE0 A;  2WQX A;  4CC4 A;  3RJ0 A;  4Z61 C;  3WPI A;  3RIZ A;  2O6Q A;  1M0Z A;  4Q62 A;  5FTT B;  2Z63 A;  4FCG A;  1YRG A;  2Z81 A;  4FS7 A;  3VQ1 A;  1O6T A;  4CNM A;  1Z7X W;  3RFE A;  2O6S A;  4NKH A;  1K5G C;  4XGO A;  4KXF B;  2V70 A;  1U0N D;  1M10 B;  4CNC A;  1JL5 A;  1OGQ A;  3ZYI A;  4RCW A;  4CC4 C;  4M7E A;  3P72 A;  4LSC A;  5A5C A;  3CIG A;  3O53 A;  5AZ5 A;  4LSX A;  1XEU A;  2O6R A;  3VQ2 A;  3C6P B;  3E3Z A;  3FXI A;  2Q4G W;  4FD0 A;  4MN8 B;  4WYK A;  4BV4 R;  2OMW A;  3WPH A;  1P8T A;  4PSJ A;  4MQW X;  4C2B B;  3RW6 A;  1OTM A;  3RW7 A;  4HQ1 A;  4Q3G A;  1W8A A;  5D3I A;  2Z62 A;  4L3A A;  3W3G A;  4CP6 A;  3E4G A;  2OMT A;  2WQU A;  4BSS A;  1G9U A;  4ECN A;  5GS2 B;  3OJA A;  2OMY A;  1D0B A;  3W3M A;  2WQW A;  3UL8 A;  4IM6 A;  3W3J A;  1SQ0 B;  2FT3 A;  5AWA A;  3UL9 A;  2Z64 A;  3PMH G;  3WPG A;  4Y61 B;  2XOT A;  3ZYN A;  2P1Q B;  3C6N B;  2WFH A;  4QBZ A;  3RGZ A;  1M9S A;  4R09 A;  1GWB A;  3WN4 A;  2UZY A;  5IJC A;  4XSQ A;  1K5D C;  4KNG A;  3RFS A;  2ELL A;  5GS0 A;  3REZ A;  4R5D A;  2CA6 A;  3JB9 j;  2ID5 A;  4KT1 A;  3OJA B;  3C6O B;  2A0Z A;  4Z64 C;  4GLP A;  1M9L A;  5GMG A;  1KOO A;  3G3A A;  1XCD A;  3GOZ A;  4P8S A;  4QXE A;  3G3B A;  4QC0 A;  2V9T B;  5AWB A;  4BSU A;  2OMZ A;  4NKG A;  4LI2 A;  4PER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...