3O53A

Crystal structure of lrim1 leucine-rich repeat domain
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
316
structure length
316
Chain Sequence
IHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWNVKELDLSGNPLSQISAADLAPFTKLELLNLSSNVLYETLDLESLSTLRTLDLNNNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANNKITMLRDLDEGCRSRVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPEFQSAAGVTWISLRNNKLVLIEKALRFSQNLEHFDLRGNGFHCGTLRDFFSKNQRVQTVAKQTVKKLTGQNEEECTVPTLGHYGAYCCEDLPAPFADRLIALGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein LRIM1
publication title A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 123
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00560 LRR_1 Leucine Rich Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3o53A00
5GMGA 1DCEA 3A79B 3W3KA 4V2EA 4R6JA 2WFHA 1DFJI 3OGMB 3RGZA 3OJAA 2OMXA 1FS2A 4TZHA 2Z63A 2Z82A 4YEBB 4P8SA 2JQDA 2OMUA 4MQWX 4LSCA 2O6QA 2RA8A 3P72A 4BSUA 4ARRA 4R09A 3ZYOA 3E2JA 4XSQA 2Z64A 3M18A 5AWAA 2ELLA 5GS2B 4B8CD 4QC0A 1OTNA 2O6RA 1P9AG 2O6SA 5AZ5A 1XCDA 5AWBA 4R0AA 3W3MA 1GWBA 4C2AB 4Z64C 1XECA 1O6TA 3WPFA 1FO1A 3WPCA 5IJCA 4FDWA 4Q62A 1M10B 1Z7XW 4AY9X 4PSJA 2UZXA 3W3NA 4M7EC 2V9TB 4Y61B 3E4GA 4LI1A 4CC4A 3ULUA 4PERA 4CILA 3O6NA 5HZLB 3G06A 2IFGA 2XOTA 4R6AA 3W3JA 2OMZA 4R58A 3OJAB 1OTMA 2ASSB 2WQXA 5A5CA 3OGLB 2R9UA 4CNCA 3RFJA 2Z62A 4RWTC 4LI2A 3ZYIA 1XWDC 4EZGA 4CNMA 2UZYA 1XEUA 2FT3A 3M19A 4U7LA 5HDHA 2OMTA 1OTOA 2WQWA 5FTTB 3FXIA 4V2CA 1O6SA 3VQ2A 4V2DA 3RW6A 5GQRK 4Z79A 3E6JA 4MN8B 4L3FA 2ASTB 3RFEA 4LSXA 4U06A 3OGKB 3WN4A 4J4LA 4I6JB 3ZYNA 4R08A 1H6TA 2P1PB 1DS9A 4P91A 3G3BA 2Z81A 3G39A 5AWCA 3KJ4A 1A9NA 4KNGA 3O53A 3GOZA 4G8AA 2OMVA 3WPBA 4R5CA 4H09A 5GS0A 1QYYA 4GT6A 4J0MA 5IJBA 2P1MB 1OZNA 1K5GC 3VQ1A 4NKHA 4XOSA 4KXFB 5CMPA 4Q3GA 3REZA 3DZEA 4K17A 4FHOA 4XGOA 4U08A 3RIZA 4FCGA 1KOOA 1A4YA 2A0ZA 4IM6A 4BSSA 3RW7A 1FT8A 2Z65A 2JE1A 1YRGA 4ECNA 3G3AA 4R07A 4KT1A 4FD0A 5AWDA 1K5DC 2Y5QA 3WPEA 3PMHG 2Q4GW 3WPIA 4ARNA 5GMFA 4Z61C 4CC4C 2JE0A 3SB4A 3UL8A 1M0ZA 4C2BB 5B0NA 1SQ0B 2P1NB 2WQVA 3RGXA 5B0TA 3ULAA 5IYXC 1U0ND 2CA6A 3BZ5A 1P8VA 1H6UA 4R6FA 5LFNA 2BEXA 1JL5A 4PKIG 4Z8GA 3W3LA 3W3GA 4Q3IA 3WPHA 5IJDA 1O6VA 2XWTC 3C6OB 4PQ8A 1D0BA 2Z7XA 3WPGA 3CIGA 4CP6A 4OQTA 4FMZA 3TSRE 2RR6A 4RCWA 3ULVA 2P1QB 1XKUA 3E3ZA 1M9SA 4FS7A 1KOHA 4LSXC 4WYKA 3RJ0A 4LSAA 4QBZA 2WQUA 3C6PB 4NKGA 2V70A 1IO0A 3UL9A 3JB9j 3G04C 1P8TA 4BSRA 3UL7A 4M7EA 4LXSA 4PEQB 3WPDA 1OOKG 4WP6A 4LXRA 3CIYA 4QXEA 4GLPA 4HQ1A 3ZYJA 1WWLA 2V9SA 2ID5A 2P1OB 4Z94G 5CMNA 1OGQA 2BNHA 1LTXA 3CVRA 5GMHA 2OMWA 3RFSA 5D3IA 4RCAB 4AW4A 1M9LA 2Z66A 4BV4R 2OMYA 1W8AA 3UN9A 1PGVA 4R5DA 2Z7XB 1ZIWA 4R6GA 5B4PA 4U09A 4L3AA 1FQVA 1G9UA 4ECOA 3C6NB 4UFRA
chains in the Genus database with same CATH superfamily
5GMGA 1DCEA 3A79B 3W3KA 4V2EA 4R6JA 2WFHA 1DFJI 3OGMB 3RGZA 3OJAA 2OMXA 1FS2A 4TZHA 2Z63A 2Z82A 4YEBB 4P8SA 2JQDA 2OMUA 4MQWX 4LSCA 2O6QA 2RA8A 3P72A 4BSUA 4ARRA 4R09A 3ZYOA 3E2JA 4XSQA 2Z64A 3M18A 5AWAA 2ELLA 5GS2B 4B8CD 4QC0A 1OTNA 2O6RA 1P9AG 2O6SA 5AZ5A 1XCDA 5AWBA 4R0AA 3W3MA 1GWBA 4C2AB 4Z64C 1XECA 1O6TA 3WPFA 1FO1A 3WPCA 5IJCA 4FDWA 4Q62A 1M10B 1Z7XW 4AY9X 4PSJA 2UZXA 3W3NA 4M7EC 2V9TB 4Y61B 3E4GA 4LI1A 4CC4A 3ULUA 4PERA 4CILA 3O6NA 4NZTM 3G06A 5HZLB 2IFGA 2XOTA 4R6AA 3W3JA 2OMZA 4R58A 3OJAB 1OTMA 2ASSB 2WQXA 5A5CA 3OGLB 2R9UA 4CNCA 3RFJA 2Z62A 4RWTC 4LI2A 3ZYIA 1XWDC 4EZGA 4CNMA 2UZYA 1XEUA 2FT3A 3M19A 4U7LA 5HDHA 2OMTA 1OTOA 2WQWA 5FTTB 3FXIA 4V2CA 1O6SA 3VQ2A 4V2DA 3RW6A 5GQRK 4Z79A 3E6JA 4MN8B 4L3FA 2ASTB 3RFEA 4NZRM 4LSXA 4U06A 3OGKB 3WN4A 4J4LA 4I6JB 3ZYNA 4R08A 1H6TA 2P1PB 1DS9A 4P91A 3G3BA 2Z81A 3G39A 5AWCA 3KJ4A 1A9NA 4KNGA 3O53A 3GOZA 4G8AA 2OMVA 3WPBA 4R5CA 4H09A 5GS0A 1QYYA 4GT6A 4J0MA 5IJBA 2P1MB 1OZNA 1K5GC 3VQ1A 4NKHA 4XOSA 4KXFB 5CMPA 4Q3GA 3REZA 3DZEA 4K17A 4FHOA 4XGOA 4U08A 3RIZA 4FCGA 1KOOA 1A4YA 2A0ZA 4IM6A 4BSSA 3RW7A 1FT8A 2Z65A 2JE1A 1YRGA 4ECNA 3G3AA 4R07A 4KT1A 4FD0A 5AWDA 1K5DC 2Y5QA 3WPEA 3PMHG 2Q4GW 3WPIA 4ARNA 5GMFA 4Z61C 4CC4C 2JE0A 3SB4A 3UL8A 1M0ZA 4C2BB 5B0NA 1SQ0B 2P1NB 2WQVA 3RGXA 5B0TA 3ULAA 5IYXC 1U0ND 2CA6A 3BZ5A 1P8VA 1H6UA 4R6FA 5LFNA 2BEXA 1JL5A 4PKIG 4Z8GA 3W3LA 3W3GA 4Q3IA 3WPHA 5IJDA 1O6VA 2XWTC 3C6OB 4PQ8A 1D0BA 2Z7XA 3WPGA 3CIGA 4CP6A 4OQTA 4FMZA 3TSRE 2RR6A 4RCWA 3ULVA 2P1QB 1XKUA 3E3ZA 1M9SA 4FS7A 1KOHA 4LSXC 4WYKA 3RJ0A 4LSAA 4QBZA 2WQUA 3C6PB 4NKGA 2V70A 1IO0A 3UL9A 3JB9j 3G04C 1P8TA 4BSRA 3UL7A 4M7EA 4LXSA 4PEQB 3WPDA 1OOKG 4WP6A 4LXRA 3CIYA 4QXEA 4GLPA 4HQ1A 3ZYJA 1WWLA 2V9SA 2ID5A 2P1OB 4Z94G 5CMNA 1OGQA 2BNHA 1LTXA 3CVRA 5GMHA 2OMWA 3RFSA 5D3IA 4RCAB 4AW4A 1M9LA 2Z66A 4BV4R 2OMYA 1W8AA 3UN9A 1PGVA 4R5DA 2Z7XB 1ZIWA 4R6GA 5B4PA 4U09A 4L3AA 1FQVA 1G9UA 4ECOA 3C6NB 4UFRA
chains in the Genus database with same CATH topology
5GMGA 1DCEA 3A79B 3W3KA 4V2EA 4R6JA 2WFHA 1DFJI 3OGMB 3RGZA 3OJAA 2OMXA 1FS2A 4TZHA 2Z63A 2Z82A 4YEBB 4P8SA 2JQDA 2OMUA 4MQWX 4LSCA 2O6QA 2RA8A 3P72A 4BSUA 4ARRA 4R09A 3ZYOA 3E2JA 4XSQA 2Z64A 3M18A 5AWAA 2ELLA 5GS2B 4B8CD 4QC0A 1OTNA 2O6RA 1P9AG 2O6SA 5AZ5A 1XCDA 5AWBA 4R0AA 3W3MA 1GWBA 4C2AB 4Z64C 1XECA 1O6TA 3WPFA 1FO1A 3WPCA 5IJCA 4FDWA 4Q62A 1M10B 1Z7XW 4AY9X 4PSJA 2UZXA 3W3NA 4M7EC 2V9TB 4Y61B 3E4GA 4LI1A 4CC4A 3ULUA 4PERA 4CILA 3O6NA 5HZLB 3G06A 2IFGA 2XOTA 4R6AA 3W3JA 2OMZA 4R58A 3OJAB 1OTMA 2ASSB 2WQXA 5A5CA 3OGLB 2R9UA 4CNCA 3RFJA 2Z62A 4RWTC 4LI2A 3ZYIA 1XWDC 4EZGA 4CNMA 2UZYA 1XEUA 2FT3A 3M19A 4U7LA 5HDHA 2OMTA 1OTOA 2WQWA 5FTTB 3FXIA 4V2CA 1O6SA 3VQ2A 4V2DA 3RW6A 5GQRK 4Z79A 3E6JA 4MN8B 4L3FA 2ASTB 3RFEA 4LSXA 4U06A 3OGKB 3WN4A 4J4LA 4I6JB 3ZYNA 4R08A 1H6TA 2P1PB 1DS9A 4P91A 3G3BA 2Z81A 3G39A 5AWCA 3KJ4A 1A9NA 4KNGA 3O53A 3GOZA 4G8AA 2OMVA 3WPBA 4R5CA 4H09A 5GS0A 1QYYA 4GT6A 4J0MA 5IJBA 2P1MB 1OZNA 1K5GC 3VQ1A 4NKHA 4XOSA 4KXFB 5CMPA 4Q3GA 3REZA 3DZEA 4K17A 4FHOA 4XGOA 4U08A 3RIZA 4FCGA 1KOOA 1A4YA 2A0ZA 4IM6A 4BSSA 3RW7A 1FT8A 2Z65A 2JE1A 1YRGA 4ECNA 3G3AA 4R07A 4KT1A 4FD0A 5AWDA 1K5DC 2Y5QA 3WPEA 3PMHG 2Q4GW 3WPIA 4ARNA 5GMFA 4Z61C 4CC4C 2JE0A 3SB4A 3UL8A 1M0ZA 4C2BB 5B0NA 1SQ0B 2P1NB 2WQVA 3RGXA 5B0TA 3ULAA 5IYXC 1U0ND 2CA6A 3BZ5A 1P8VA 1H6UA 4R6FA 5LFNA 2BEXA 1JL5A 4PKIG 4Z8GA 3W3LA 3W3GA 4Q3IA 3WPHA 5IJDA 1O6VA 2XWTC 3C6OB 4PQ8A 1D0BA 2Z7XA 3WPGA 3CIGA 4CP6A 4OQTA 4FMZA 3TSRE 2RR6A 4RCWA 3ULVA 2P1QB 1XKUA 3E3ZA 1M9SA 4FS7A 1KOHA 4LSXC 4WYKA 3RJ0A 4LSAA 4QBZA 2WQUA 3C6PB 4NKGA 2V70A 1IO0A 3UL9A 3JB9j 3G04C 1P8TA 4BSRA 3UL7A 4M7EA 4LXSA 4PEQB 3WPDA 1OOKG 4WP6A 4LXRA 3CIYA 4QXEA 4GLPA 4HQ1A 3ZYJA 1WWLA 2V9SA 2ID5A 2P1OB 4Z94G 5CMNA 1OGQA 2BNHA 1LTXA 3CVRA 5GMHA 2OMWA 3RFSA 5D3IA 4RCAB 4AW4A 1M9LA 2Z66A 4BV4R 2OMYA 1W8AA 3UN9A 1PGVA 4R5DA 2Z7XB 1ZIWA 4R6GA 5B4PA 4U09A 4L3AA 1FQVA 1G9UA 4ECOA 3C6NB 4UFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMG A;  1DCE A;  3A79 B;  3W3K A;  4V2E A;  4R6J A;  2WFH A;  1DFJ I;  3OGM B;  3RGZ A;  3OJA A;  2OMX A;  1FS2 A;  4TZH A;  2Z63 A;  2Z82 A;  4YEB B;  4P8S A;  2JQD A;  2OMU A;  4MQW X;  4LSC A;  2O6Q A;  2RA8 A;  3P72 A;  4BSU A;  4ARR A;  4R09 A;  3ZYO A;  3E2J A;  4XSQ A;  2Z64 A;  3M18 A;  5AWA A;  2ELL A;  5GS2 B;  4B8C D;  4QC0 A;  1OTN A;  2O6R A;  1P9A G;  2O6S A;  5AZ5 A;  1XCD A;  5AWB A;  4R0A A;  3W3M A;  1GWB A;  4C2A B;  4Z64 C;  1XEC A;  1O6T A;  3WPF A;  1FO1 A;  3WPC A;  5IJC A;  4FDW A;  4Q62 A;  1M10 B;  1Z7X W;  4AY9 X;  4PSJ A;  2UZX A;  3W3N A;  4M7E C;  2V9T B;  4Y61 B;  3E4G A;  4LI1 A;  4CC4 A;  3ULU A;  4PER A;  4CIL A;  3O6N A;  5HZL B;  3G06 A;  2IFG A;  2XOT A;  4R6A A;  3W3J A;  2OMZ A;  4R58 A;  3OJA B;  1OTM A;  2ASS B;  2WQX A;  5A5C A;  3OGL B;  2R9U A;  4CNC A;  3RFJ A;  2Z62 A;  4RWT C;  4LI2 A;  3ZYI A;  1XWD C;  4EZG A;  4CNM A;  2UZY A;  1XEU A;  2FT3 A;  3M19 A;  4U7L A;  5HDH A;  2OMT A;  1OTO A;  2WQW A;  5FTT B;  3FXI A;  4V2C A;  1O6S A;  3VQ2 A;  4V2D A;  3RW6 A;  5GQR K;  4Z79 A;  3E6J A;  4MN8 B;  4L3F A;  2AST B;  3RFE A;  4LSX A;  4U06 A;  3OGK B;  3WN4 A;  4J4L A;  4I6J B;  3ZYN A;  4R08 A;  1H6T A;  2P1P B;  1DS9 A;  4P91 A;  3G3B A;  2Z81 A;  3G39 A;  5AWC A;  3KJ4 A;  1A9N A;  4KNG A;  3O53 A;  3GOZ A;  4G8A A;  2OMV A;  3WPB A;  4R5C A;  4H09 A;  5GS0 A;  1QYY A;  4GT6 A;  4J0M A;  5IJB A;  2P1M B;  1OZN A;  1K5G C;  3VQ1 A;  4NKH A;  4XOS A;  4KXF B;  5CMP A;  4Q3G A;  3REZ A;  3DZE A;  4K17 A;  4FHO A;  4XGO A;  4U08 A;  3RIZ A;  4FCG A;  1KOO A;  1A4Y A;  2A0Z A;  4IM6 A;  4BSS A;  3RW7 A;  1FT8 A;  2Z65 A;  2JE1 A;  1YRG A;  4ECN A;  3G3A A;  4R07 A;  4KT1 A;  4FD0 A;  5AWD A;  1K5D C;  2Y5Q A;  3WPE A;  3PMH G;  2Q4G W;  3WPI A;  4ARN A;  5GMF A;  4Z61 C;  4CC4 C;  2JE0 A;  3SB4 A;  3UL8 A;  1M0Z A;  4C2B B;  5B0N A;  1SQ0 B;  2P1N B;  2WQV A;  3RGX A;  5B0T A;  3ULA A;  5IYX C;  1U0N D;  2CA6 A;  3BZ5 A;  1P8V A;  1H6U A;  4R6F A;  5LFN A;  2BEX A;  1JL5 A;  4PKI G;  4Z8G A;  3W3L A;  3W3G A;  4Q3I A;  3WPH A;  5IJD A;  1O6V A;  2XWT C;  3C6O B;  4PQ8 A;  1D0B A;  2Z7X A;  3WPG A;  3CIG A;  4CP6 A;  4OQT A;  4FMZ A;  3TSR E;  2RR6 A;  4RCW A;  3ULV A;  2P1Q B;  1XKU A;  3E3Z A;  1M9S A;  4FS7 A;  1KOH A;  4LSX C;  4WYK A;  3RJ0 A;  4LSA A;  4QBZ A;  2WQU A;  3C6P B;  4NKG A;  2V70 A;  1IO0 A;  3UL9 A;  3JB9 j;  3G04 C;  1P8T A;  4BSR A;  3UL7 A;  4M7E A;  4LXS A;  4PEQ B;  3WPD A;  1OOK G;  4WP6 A;  4LXR A;  3CIY A;  4QXE A;  4GLP A;  4HQ1 A;  3ZYJ A;  1WWL A;  2V9S A;  2ID5 A;  2P1O B;  4Z94 G;  5CMN A;  1OGQ A;  2BNH A;  1LTX A;  3CVR A;  5GMH A;  2OMW A;  3RFS A;  5D3I A;  4RCA B;  4AW4 A;  1M9L A;  2Z66 A;  4BV4 R;  2OMY A;  1W8A A;  3UN9 A;  1PGV A;  4R5D A;  2Z7X B;  1ZIW A;  4R6G A;  5B4P A;  4U09 A;  4L3A A;  1FQV A;  1G9U A;  4ECO A;  3C6N B;  4UFR A; 
#chains in the Genus database with same CATH topology
 5GMG A;  1DCE A;  3A79 B;  3W3K A;  4V2E A;  4R6J A;  2WFH A;  1DFJ I;  3OGM B;  3RGZ A;  3OJA A;  2OMX A;  1FS2 A;  4TZH A;  2Z63 A;  2Z82 A;  4YEB B;  4P8S A;  2JQD A;  2OMU A;  4MQW X;  4LSC A;  2O6Q A;  2RA8 A;  3P72 A;  4BSU A;  4ARR A;  4R09 A;  3ZYO A;  3E2J A;  4XSQ A;  2Z64 A;  3M18 A;  5AWA A;  2ELL A;  5GS2 B;  4B8C D;  4QC0 A;  1OTN A;  2O6R A;  1P9A G;  2O6S A;  5AZ5 A;  1XCD A;  5AWB A;  4R0A A;  3W3M A;  1GWB A;  4C2A B;  4Z64 C;  1XEC A;  1O6T A;  3WPF A;  1FO1 A;  3WPC A;  5IJC A;  4FDW A;  4Q62 A;  1M10 B;  1Z7X W;  4AY9 X;  4PSJ A;  2UZX A;  3W3N A;  4M7E C;  2V9T B;  4Y61 B;  3E4G A;  4LI1 A;  4CC4 A;  3ULU A;  4PER A;  4CIL A;  3O6N A;  4NZT M;  3G06 A;  5HZL B;  2IFG A;  2XOT A;  4R6A A;  3W3J A;  2OMZ A;  4R58 A;  3OJA B;  1OTM A;  2ASS B;  2WQX A;  5A5C A;  3OGL B;  2R9U A;  4CNC A;  3RFJ A;  2Z62 A;  4RWT C;  4LI2 A;  3ZYI A;  1XWD C;  4EZG A;  4CNM A;  2UZY A;  1XEU A;  2FT3 A;  3M19 A;  4U7L A;  5HDH A;  2OMT A;  1OTO A;  2WQW A;  5FTT B;  3FXI A;  4V2C A;  1O6S A;  3VQ2 A;  4V2D A;  3RW6 A;  5GQR K;  4Z79 A;  3E6J A;  4MN8 B;  4L3F A;  2AST B;  3RFE A;  4NZR M;  4LSX A;  4U06 A;  3OGK B;  3WN4 A;  4J4L A;  4I6J B;  3ZYN A;  4R08 A;  1H6T A;  2P1P B;  1DS9 A;  4P91 A;  3G3B A;  2Z81 A;  3G39 A;  5AWC A;  3KJ4 A;  1A9N A;  4KNG A;  3O53 A;  3GOZ A;  4G8A A;  2OMV A;  3WPB A;  4R5C A;  4H09 A;  5GS0 A;  1QYY A;  4GT6 A;  4J0M A;  5IJB A;  2P1M B;  1OZN A;  1K5G C;  3VQ1 A;  4NKH A;  4XOS A;  4KXF B;  5CMP A;  4Q3G A;  3REZ A;  3DZE A;  4K17 A;  4FHO A;  4XGO A;  4U08 A;  3RIZ A;  4FCG A;  1KOO A;  1A4Y A;  2A0Z A;  4IM6 A;  4BSS A;  3RW7 A;  1FT8 A;  2Z65 A;  2JE1 A;  1YRG A;  4ECN A;  3G3A A;  4R07 A;  4KT1 A;  4FD0 A;  5AWD A;  1K5D C;  2Y5Q A;  3WPE A;  3PMH G;  2Q4G W;  3WPI A;  4ARN A;  5GMF A;  4Z61 C;  4CC4 C;  2JE0 A;  3SB4 A;  3UL8 A;  1M0Z A;  4C2B B;  5B0N A;  1SQ0 B;  2P1N B;  2WQV A;  3RGX A;  5B0T A;  3ULA A;  5IYX C;  1U0N D;  2CA6 A;  3BZ5 A;  1P8V A;  1H6U A;  4R6F A;  5LFN A;  2BEX A;  1JL5 A;  4PKI G;  4Z8G A;  3W3L A;  3W3G A;  4Q3I A;  3WPH A;  5IJD A;  1O6V A;  2XWT C;  3C6O B;  4PQ8 A;  1D0B A;  2Z7X A;  3WPG A;  3CIG A;  4CP6 A;  4OQT A;  4FMZ A;  3TSR E;  2RR6 A;  4RCW A;  3ULV A;  2P1Q B;  1XKU A;  3E3Z A;  1M9S A;  4FS7 A;  1KOH A;  4LSX C;  4WYK A;  3RJ0 A;  4LSA A;  4QBZ A;  2WQU A;  3C6P B;  4NKG A;  2V70 A;  1IO0 A;  3UL9 A;  3JB9 j;  3G04 C;  1P8T A;  4BSR A;  3UL7 A;  4M7E A;  4LXS A;  4PEQ B;  3WPD A;  1OOK G;  4WP6 A;  4LXR A;  3CIY A;  4QXE A;  4GLP A;  4HQ1 A;  3ZYJ A;  1WWL A;  2V9S A;  2ID5 A;  2P1O B;  4Z94 G;  5CMN A;  1OGQ A;  2BNH A;  1LTX A;  3CVR A;  5GMH A;  2OMW A;  3RFS A;  5D3I A;  4RCA B;  4AW4 A;  1M9L A;  2Z66 A;  4BV4 R;  2OMY A;  1W8A A;  3UN9 A;  1PGV A;  4R5D A;  2Z7X B;  1ZIW A;  4R6G A;  5B4P A;  4U09 A;  4L3A A;  1FQV A;  1G9U A;  4ECO A;  3C6N B;  4UFR A; 
#chains in the Genus database with same CATH homology
 5GMG A;  1DCE A;  3A79 B;  3W3K A;  4V2E A;  4R6J A;  2WFH A;  1DFJ I;  3OGM B;  3RGZ A;  3OJA A;  2OMX A;  1FS2 A;  4TZH A;  2Z63 A;  2Z82 A;  4YEB B;  4P8S A;  2JQD A;  2OMU A;  4MQW X;  4LSC A;  2O6Q A;  2RA8 A;  3P72 A;  4BSU A;  4ARR A;  4R09 A;  3ZYO A;  3E2J A;  4XSQ A;  2Z64 A;  3M18 A;  5AWA A;  2ELL A;  5GS2 B;  4B8C D;  4QC0 A;  1OTN A;  2O6R A;  1P9A G;  2O6S A;  5AZ5 A;  1XCD A;  5AWB A;  4R0A A;  3W3M A;  1GWB A;  4C2A B;  4Z64 C;  1XEC A;  1O6T A;  3WPF A;  1FO1 A;  3WPC A;  5IJC A;  4FDW A;  4Q62 A;  1M10 B;  1Z7X W;  4AY9 X;  4PSJ A;  2UZX A;  3W3N A;  4M7E C;  2V9T B;  4Y61 B;  3E4G A;  4LI1 A;  4CC4 A;  3ULU A;  4PER A;  4CIL A;  3O6N A;  5HZL B;  3G06 A;  2IFG A;  2XOT A;  4R6A A;  3W3J A;  2OMZ A;  4R58 A;  3OJA B;  1OTM A;  2ASS B;  2WQX A;  5A5C A;  3OGL B;  2R9U A;  4CNC A;  3RFJ A;  2Z62 A;  4RWT C;  4LI2 A;  3ZYI A;  1XWD C;  4EZG A;  4CNM A;  2UZY A;  1XEU A;  2FT3 A;  3M19 A;  4U7L A;  5HDH A;  2OMT A;  1OTO A;  2WQW A;  5FTT B;  3FXI A;  4V2C A;  1O6S A;  3VQ2 A;  4V2D A;  3RW6 A;  5GQR K;  4Z79 A;  3E6J A;  4MN8 B;  4L3F A;  2AST B;  3RFE A;  4LSX A;  4U06 A;  3OGK B;  3WN4 A;  4J4L A;  4I6J B;  3ZYN A;  4R08 A;  1H6T A;  2P1P B;  1DS9 A;  4P91 A;  3G3B A;  2Z81 A;  3G39 A;  5AWC A;  3KJ4 A;  1A9N A;  4KNG A;  3O53 A;  3GOZ A;  4G8A A;  2OMV A;  3WPB A;  4R5C A;  4H09 A;  5GS0 A;  1QYY A;  4GT6 A;  4J0M A;  5IJB A;  2P1M B;  1OZN A;  1K5G C;  3VQ1 A;  4NKH A;  4XOS A;  4KXF B;  5CMP A;  4Q3G A;  3REZ A;  3DZE A;  4K17 A;  4FHO A;  4XGO A;  4U08 A;  3RIZ A;  4FCG A;  1KOO A;  1A4Y A;  2A0Z A;  4IM6 A;  4BSS A;  3RW7 A;  1FT8 A;  2Z65 A;  2JE1 A;  1YRG A;  4ECN A;  3G3A A;  4R07 A;  4KT1 A;  4FD0 A;  5AWD A;  1K5D C;  2Y5Q A;  3WPE A;  3PMH G;  2Q4G W;  3WPI A;  4ARN A;  5GMF A;  4Z61 C;  4CC4 C;  2JE0 A;  3SB4 A;  3UL8 A;  1M0Z A;  4C2B B;  5B0N A;  1SQ0 B;  2P1N B;  2WQV A;  3RGX A;  5B0T A;  3ULA A;  5IYX C;  1U0N D;  2CA6 A;  3BZ5 A;  1P8V A;  1H6U A;  4R6F A;  5LFN A;  2BEX A;  1JL5 A;  4PKI G;  4Z8G A;  3W3L A;  3W3G A;  4Q3I A;  3WPH A;  5IJD A;  1O6V A;  2XWT C;  3C6O B;  4PQ8 A;  1D0B A;  2Z7X A;  3WPG A;  3CIG A;  4CP6 A;  4OQT A;  4FMZ A;  3TSR E;  2RR6 A;  4RCW A;  3ULV A;  2P1Q B;  1XKU A;  3E3Z A;  1M9S A;  4FS7 A;  1KOH A;  4LSX C;  4WYK A;  3RJ0 A;  4LSA A;  4QBZ A;  2WQU A;  3C6P B;  4NKG A;  2V70 A;  1IO0 A;  3UL9 A;  3JB9 j;  3G04 C;  1P8T A;  4BSR A;  3UL7 A;  4M7E A;  4LXS A;  4PEQ B;  3WPD A;  1OOK G;  4WP6 A;  4LXR A;  3CIY A;  4QXE A;  4GLP A;  4HQ1 A;  3ZYJ A;  1WWL A;  2V9S A;  2ID5 A;  2P1O B;  4Z94 G;  5CMN A;  1OGQ A;  2BNH A;  1LTX A;  3CVR A;  5GMH A;  2OMW A;  3RFS A;  5D3I A;  4RCA B;  4AW4 A;  1M9L A;  2Z66 A;  4BV4 R;  2OMY A;  1W8A A;  3UN9 A;  1PGV A;  4R5D A;  2Z7X B;  1ZIW A;  4R6G A;  5B4P A;  4U09 A;  4L3A A;  1FQV A;  1G9U A;  4ECO A;  3C6N B;  4UFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...