3O53A

Crystal structure of lrim1 leucine-rich repeat domain
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
316
structure length
316
Chain Sequence
b'IHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWNVKELDLSGNPLSQISAADLAPFTKLELLNLSSNVLYETLDLESLSTLRTLDLNNNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANNKITMLRDLDEGCRSRVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPEFQSAAGVTWISLRNNKLVLIEKALRFSQNLEHFDLRGNGFHCGTLRDFFSKNQRVQTVAKQTVKKLTGQNEEECTVPTLGHYGAYCCEDLPAPFADRLIALGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein LRIM1
publication title A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Protein binding
total genus 123
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00560 LRR_1 Leucine Rich Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3o53A00
2IFGA 4YEBB 4FS7A 3UL8A 1D0BA 3RW7A 1XEUA 3W3NA 3WPBA 4U06A 3WPHA 3W3MA 2O6SA 4PQ8A 3ZYOA 1A4YA 2UZXA 4U08A 2P1MB 2Z65A 2V9SA 2FT3A 1H6TA 1W8AA 4WP6A 4PKIG 1XWDC 5CMPA 3CIYA 4Z61C 4GLPA 5GMFA 1DFJI 1DCEA 1SQ0B 1FT8A 4PERA 2RA8A 1M9SA 4LI2A 3WPDA 4LSCA 5B0TA 3VQ1A 4PEQB 1OOKG 4Q62A 4H09A 1FO1A 2UZYA 1OTNA 3ULVA 3TSRE 3ULAA 4KT1A 1H6UA 2Z63A 1G9UA 5HDHA 4XOSA 5IJCA 2P1OB 1O6VA 4U7LA 1QYYA 5A5CA 1XECA 4L3FA 4FDWA 2R9UA 3RJ0A 1P8VA 4GT6A 4KNGA 1OGQA 3O53A 3WPGA 2WQUA 1U0ND 4R5DA 3WPFA 3G3BA 1WWLA 3W3KA 1M10B 4Z79A 4CNMA 5AWBA 1PGVA 1KOOA 2OMWA 2P1PB 1P8TA 2ASTB 5AZ5A 3UL9A 3M18A 5GQRK 2Z66A 5CMNA 5IJDA 4EZGA 4WYKA 4ECOA 2P1QB 4Z64C 2V9TB 1OZNA 3GOZA 5GS2B 3OGMB 4BSSA 4BSRA 3RIZA 4R09A 4R0AA 3W3LA 1FS2A 3ZYJA 5HZLB 4LSXC 4ARRA 4UFRA 4CC4A 5IJBA 4AY9X 5AWCA 4G8AA 3VQ2A 1LTXA 3RW6A 5GS0A 4RCAB 4LI1A 3C6PB 3WPCA 4R6JA 3DZEA 1XCDA 2ID5A 3O6NA 4QXEA 3OGKB 1M0ZA 3CIGA 1YRGA 1K5GC 2XWTC 3E6JA 1GWBA 1M9LA 2Z7XB 4R58A 3OJAA 4V2EA 1OTOA 1FQVA 4M7EA 4LSAA 3C6OB 2O6RA 4K17A 3RGXA 3G06A 4NKGA 3ULUA 1DS9A 2OMZA 5D3IA 4R6FA 4B8CD 2OMVA 5B0NA 4CC4C 4QBZA 1Z7XW 4FMZA 4MN8B 4PSJA 4R5CA 2OMXA 4MQWX 4L3AA 3REZA 4R07A 4IM6A 4TZHA 4BSUA 5AWAA 4ARNA 2WQWA 2OMYA 4V2DA 3G39A 5B4PA 3FXIA 2OMTA 3PMHG 4AW4A 3RGZA 4Q3IA 3WPIA 4J4LA 3CVRA 1XKUA 4FD0A 4Z94G 4M7EC 3RFJA 4P8SA 3WN4A 2JE0A 2WQXA 2Z82A 4OQTA 4CNCA 4ECNA 2RR6A 4R6AA 4R08A 4KXFB 3A79B 2BEXA 3OJAB 3P72A 2JQDA 4U09A 3UL7A 3BZ5A 2ASSB 3UN9A 1IO0A 3RFEA 4RWTC 4R6GA 2A0ZA 2Q4GW 1OTMA 3ZYNA 3RFSA 4NKHA 4XSQA 2WQVA 4RCWA 2CA6A 2JE1A 4FHOA 5GMGA 3G3AA 4Q3GA 2OMUA 4C2BB 1K5DC 4CILA 4I6JB 1JL5A 4FCGA 5IYXC 1O6SA 4J0MA 2Y5QA 3W3JA 3C6NB 5AWDA 4LXRA 2O6QA 3E3ZA 4LXSA 2Z64A 4BV4R 4LSXA 5GMHA 4C2AB 2Z62A 4XGOA 3WPEA 2Z7XA 4V2CA 4CP6A 4QC0A 3OGLB 3E2JA 1O6TA 3E4GA 4Z8GA 3G04C 2BNHA 1KOHA 3SB4A 3M19A 3JB9j 3ZYIA 4Y61B 5FTTB 1A9NA 2XOTA 2WFHA 5LFNA 1P9AG 2Z81A 2ELLA 4HQ1A 3W3GA 2V70A 2P1NB 1ZIWA 4P91A 3KJ4A
chains in the Genus database with same CATH superfamily
2IFGA 4YEBB 4FS7A 3UL8A 1D0BA 3RW7A 1XEUA 3W3NA 3WPBA 4U06A 3WPHA 3W3MA 2O6SA 4PQ8A 3ZYOA 1A4YA 2UZXA 4U08A 2P1MB 2Z65A 2V9SA 2FT3A 1H6TA 1W8AA 4WP6A 4PKIG 1XWDC 5CMPA 3CIYA 4Z61C 4GLPA 5GMFA 1DFJI 1DCEA 1SQ0B 1FT8A 4PERA 2RA8A 1M9SA 4LI2A 3WPDA 4LSCA 5B0TA 3VQ1A 4PEQB 1OOKG 4Q62A 4H09A 1FO1A 2UZYA 1OTNA 3ULVA 3TSRE 3ULAA 4KT1A 1H6UA 2Z63A 1G9UA 5HDHA 4XOSA 5IJCA 2P1OB 1O6VA 4U7LA 1QYYA 5A5CA 1XECA 4L3FA 4FDWA 2R9UA 3RJ0A 1P8VA 4GT6A 4KNGA 1OGQA 3O53A 3WPGA 2WQUA 1U0ND 4R5DA 3WPFA 3G3BA 1WWLA 3W3KA 1M10B 4Z79A 4CNMA 5AWBA 1PGVA 1KOOA 2OMWA 2P1PB 1P8TA 2ASTB 5AZ5A 3UL9A 3M18A 5GQRK 2Z66A 5CMNA 5IJDA 4EZGA 4WYKA 4ECOA 2P1QB 4Z64C 2V9TB 1OZNA 3GOZA 5GS2B 3OGMB 4BSSA 4BSRA 3RIZA 4R09A 4R0AA 3W3LA 1FS2A 3ZYJA 5HZLB 4LSXC 4ARRA 4UFRA 4CC4A 5IJBA 4AY9X 5AWCA 4G8AA 3VQ2A 1LTXA 3RW6A 5GS0A 4RCAB 4LI1A 3C6PB 3WPCA 4R6JA 3DZEA 1XCDA 2ID5A 3O6NA 4QXEA 3OGKB 1M0ZA 3CIGA 1YRGA 1K5GC 2XWTC 3E6JA 1GWBA 1M9LA 2Z7XB 4R58A 3OJAA 4V2EA 1OTOA 1FQVA 4M7EA 4LSAA 3C6OB 2O6RA 4K17A 3RGXA 3G06A 4NKGA 3ULUA 1DS9A 2OMZA 5D3IA 4R6FA 4B8CD 2OMVA 5B0NA 4CC4C 4QBZA 1Z7XW 4FMZA 4MN8B 4PSJA 4R5CA 2OMXA 4MQWX 4L3AA 3REZA 4R07A 4IM6A 4TZHA 4BSUA 4NZRM 5AWAA 4ARNA 2WQWA 2OMYA 4V2DA 3G39A 5B4PA 3FXIA 2OMTA 3PMHG 4AW4A 3RGZA 4Q3IA 3WPIA 4J4LA 3CVRA 1XKUA 4FD0A 4Z94G 4M7EC 3RFJA 4P8SA 3WN4A 2JE0A 2WQXA 2Z82A 4OQTA 4CNCA 4ECNA 2RR6A 4R6AA 4R08A 4KXFB 3A79B 2BEXA 3OJAB 3P72A 2JQDA 4U09A 3UL7A 3BZ5A 2ASSB 3UN9A 1IO0A 3RFEA 4RWTC 4R6GA 2A0ZA 2Q4GW 1OTMA 3ZYNA 3RFSA 4NKHA 4XSQA 2WQVA 4RCWA 2CA6A 2JE1A 4FHOA 5GMGA 3G3AA 4Q3GA 2OMUA 4C2BB 1K5DC 4CILA 4NZTM 4I6JB 1JL5A 4FCGA 5IYXC 1O6SA 4J0MA 2Y5QA 3W3JA 3C6NB 5AWDA 4LXRA 2O6QA 3E3ZA 4LXSA 2Z64A 4BV4R 4LSXA 5GMHA 4C2AB 2Z62A 4XGOA 3WPEA 2Z7XA 4V2CA 4CP6A 4QC0A 3OGLB 3E2JA 1O6TA 3E4GA 4Z8GA 3G04C 2BNHA 1KOHA 3SB4A 3M19A 3JB9j 3ZYIA 4Y61B 5FTTB 1A9NA 2XOTA 2WFHA 5LFNA 1P9AG 2Z81A 2ELLA 4HQ1A 3W3GA 2V70A 2P1NB 1ZIWA 4P91A 3KJ4A
chains in the Genus database with same CATH topology
2IFGA 4YEBB 4FS7A 3UL8A 1D0BA 3RW7A 1XEUA 3W3NA 3WPBA 4U06A 3WPHA 3W3MA 2O6SA 4PQ8A 3ZYOA 1A4YA 2UZXA 4U08A 2P1MB 2Z65A 2V9SA 2FT3A 1H6TA 1W8AA 4WP6A 4PKIG 1XWDC 5CMPA 3CIYA 4Z61C 4GLPA 5GMFA 1DFJI 1DCEA 1SQ0B 1FT8A 4PERA 2RA8A 1M9SA 4LI2A 3WPDA 4LSCA 5B0TA 3VQ1A 4PEQB 1OOKG 4Q62A 4H09A 1FO1A 2UZYA 1OTNA 3ULVA 3TSRE 3ULAA 4KT1A 1H6UA 2Z63A 1G9UA 5HDHA 4XOSA 5IJCA 2P1OB 1O6VA 4U7LA 1QYYA 5A5CA 1XECA 4L3FA 4FDWA 2R9UA 3RJ0A 1P8VA 4GT6A 4KNGA 1OGQA 3O53A 3WPGA 2WQUA 1U0ND 4R5DA 3WPFA 3G3BA 1WWLA 3W3KA 1M10B 4Z79A 4CNMA 5AWBA 1PGVA 1KOOA 2OMWA 2P1PB 1P8TA 2ASTB 5AZ5A 3UL9A 3M18A 5GQRK 2Z66A 5CMNA 5IJDA 4EZGA 4WYKA 4ECOA 2P1QB 4Z64C 2V9TB 1OZNA 3GOZA 5GS2B 3OGMB 4BSSA 4BSRA 3RIZA 4R09A 4R0AA 3W3LA 1FS2A 3ZYJA 5HZLB 4LSXC 4ARRA 4UFRA 4CC4A 5IJBA 4AY9X 5AWCA 4G8AA 3VQ2A 1LTXA 3RW6A 5GS0A 4RCAB 4LI1A 3C6PB 3WPCA 4R6JA 3DZEA 1XCDA 2ID5A 3O6NA 4QXEA 3OGKB 1M0ZA 3CIGA 1YRGA 1K5GC 2XWTC 3E6JA 1GWBA 1M9LA 2Z7XB 4R58A 3OJAA 4V2EA 1OTOA 1FQVA 4M7EA 4LSAA 3C6OB 2O6RA 4K17A 3RGXA 3G06A 4NKGA 3ULUA 1DS9A 2OMZA 5D3IA 4R6FA 4B8CD 2OMVA 5B0NA 4CC4C 4QBZA 1Z7XW 4FMZA 4MN8B 4PSJA 4R5CA 2OMXA 4MQWX 4L3AA 3REZA 4R07A 4IM6A 4TZHA 4BSUA 5AWAA 4ARNA 2WQWA 2OMYA 4V2DA 3G39A 5B4PA 3FXIA 2OMTA 3PMHG 4AW4A 3RGZA 4Q3IA 3WPIA 4J4LA 3CVRA 1XKUA 4FD0A 4Z94G 4M7EC 3RFJA 4P8SA 3WN4A 2JE0A 2WQXA 2Z82A 4OQTA 4CNCA 4ECNA 2RR6A 4R6AA 4R08A 4KXFB 3A79B 2BEXA 3OJAB 3P72A 2JQDA 4U09A 3UL7A 3BZ5A 2ASSB 3UN9A 1IO0A 3RFEA 4RWTC 4R6GA 2A0ZA 2Q4GW 1OTMA 3ZYNA 3RFSA 4NKHA 4XSQA 2WQVA 4RCWA 2CA6A 2JE1A 4FHOA 5GMGA 3G3AA 4Q3GA 2OMUA 4C2BB 1K5DC 4CILA 4I6JB 1JL5A 4FCGA 5IYXC 1O6SA 4J0MA 2Y5QA 3W3JA 3C6NB 5AWDA 4LXRA 2O6QA 3E3ZA 4LXSA 2Z64A 4BV4R 4LSXA 5GMHA 4C2AB 2Z62A 4XGOA 3WPEA 2Z7XA 4V2CA 4CP6A 4QC0A 3OGLB 3E2JA 1O6TA 3E4GA 4Z8GA 3G04C 2BNHA 1KOHA 3SB4A 3M19A 3JB9j 3ZYIA 4Y61B 5FTTB 1A9NA 2XOTA 2WFHA 5LFNA 1P9AG 2Z81A 2ELLA 4HQ1A 3W3GA 2V70A 2P1NB 1ZIWA 4P91A 3KJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFG A;  4YEB B;  4FS7 A;  3UL8 A;  1D0B A;  3RW7 A;  1XEU A;  3W3N A;  3WPB A;  4U06 A;  3WPH A;  3W3M A;  2O6S A;  4PQ8 A;  3ZYO A;  1A4Y A;  2UZX A;  4U08 A;  2P1M B;  2Z65 A;  2V9S A;  2FT3 A;  1H6T A;  1W8A A;  4WP6 A;  4PKI G;  1XWD C;  5CMP A;  3CIY A;  4Z61 C;  4GLP A;  5GMF A;  1DFJ I;  1DCE A;  1SQ0 B;  1FT8 A;  4PER A;  2RA8 A;  1M9S A;  4LI2 A;  3WPD A;  4LSC A;  5B0T A;  3VQ1 A;  4PEQ B;  1OOK G;  4Q62 A;  4H09 A;  1FO1 A;  2UZY A;  1OTN A;  3ULV A;  3TSR E;  3ULA A;  4KT1 A;  1H6U A;  2Z63 A;  1G9U A;  5HDH A;  4XOS A;  5IJC A;  2P1O B;  1O6V A;  4U7L A;  1QYY A;  5A5C A;  1XEC A;  4L3F A;  4FDW A;  2R9U A;  3RJ0 A;  1P8V A;  4GT6 A;  4KNG A;  1OGQ A;  3O53 A;  3WPG A;  2WQU A;  1U0N D;  4R5D A;  3WPF A;  3G3B A;  1WWL A;  3W3K A;  1M10 B;  4Z79 A;  4CNM A;  5AWB A;  1PGV A;  1KOO A;  2OMW A;  2P1P B;  1P8T A;  2AST B;  5AZ5 A;  3UL9 A;  3M18 A;  5GQR K;  2Z66 A;  5CMN A;  5IJD A;  4EZG A;  4WYK A;  4ECO A;  2P1Q B;  4Z64 C;  2V9T B;  1OZN A;  3GOZ A;  5GS2 B;  3OGM B;  4BSS A;  4BSR A;  3RIZ A;  4R09 A;  4R0A A;  3W3L A;  1FS2 A;  3ZYJ A;  5HZL B;  4LSX C;  4ARR A;  4UFR A;  4CC4 A;  5IJB A;  4AY9 X;  5AWC A;  4G8A A;  3VQ2 A;  1LTX A;  3RW6 A;  5GS0 A;  4RCA B;  4LI1 A;  3C6P B;  3WPC A;  4R6J A;  3DZE A;  1XCD A;  2ID5 A;  3O6N A;  4QXE A;  3OGK B;  1M0Z A;  3CIG A;  1YRG A;  1K5G C;  2XWT C;  3E6J A;  1GWB A;  1M9L A;  2Z7X B;  4R58 A;  3OJA A;  4V2E A;  1OTO A;  1FQV A;  4M7E A;  4LSA A;  3C6O B;  2O6R A;  4K17 A;  3RGX A;  3G06 A;  4NKG A;  3ULU A;  1DS9 A;  2OMZ A;  5D3I A;  4R6F A;  4B8C D;  2OMV A;  5B0N A;  4CC4 C;  4QBZ A;  1Z7X W;  4FMZ A;  4MN8 B;  4PSJ A;  4R5C A;  2OMX A;  4MQW X;  4L3A A;  3REZ A;  4R07 A;  4IM6 A;  4TZH A;  4BSU A;  5AWA A;  4ARN A;  2WQW A;  2OMY A;  4V2D A;  3G39 A;  5B4P A;  3FXI A;  2OMT A;  3PMH G;  4AW4 A;  3RGZ A;  4Q3I A;  3WPI A;  4J4L A;  3CVR A;  1XKU A;  4FD0 A;  4Z94 G;  4M7E C;  3RFJ A;  4P8S A;  3WN4 A;  2JE0 A;  2WQX A;  2Z82 A;  4OQT A;  4CNC A;  4ECN A;  2RR6 A;  4R6A A;  4R08 A;  4KXF B;  3A79 B;  2BEX A;  3OJA B;  3P72 A;  2JQD A;  4U09 A;  3UL7 A;  3BZ5 A;  2ASS B;  3UN9 A;  1IO0 A;  3RFE A;  4RWT C;  4R6G A;  2A0Z A;  2Q4G W;  1OTM A;  3ZYN A;  3RFS A;  4NKH A;  4XSQ A;  2WQV A;  4RCW A;  2CA6 A;  2JE1 A;  4FHO A;  5GMG A;  3G3A A;  4Q3G A;  2OMU A;  4C2B B;  1K5D C;  4CIL A;  4I6J B;  1JL5 A;  4FCG A;  5IYX C;  1O6S A;  4J0M A;  2Y5Q A;  3W3J A;  3C6N B;  5AWD A;  4LXR A;  2O6Q A;  3E3Z A;  4LXS A;  2Z64 A;  4BV4 R;  4LSX A;  5GMH A;  4C2A B;  2Z62 A;  4XGO A;  3WPE A;  2Z7X A;  4V2C A;  4CP6 A;  4QC0 A;  3OGL B;  3E2J A;  1O6T A;  3E4G A;  4Z8G A;  3G04 C;  2BNH A;  1KOH A;  3SB4 A;  3M19 A;  3JB9 j;  3ZYI A;  4Y61 B;  5FTT B;  1A9N A;  2XOT A;  2WFH A;  5LFN A;  1P9A G;  2Z81 A;  2ELL A;  4HQ1 A;  3W3G A;  2V70 A;  2P1N B;  1ZIW A;  4P91 A;  3KJ4 A; 
#chains in the Genus database with same CATH topology
 2IFG A;  4YEB B;  4FS7 A;  3UL8 A;  1D0B A;  3RW7 A;  1XEU A;  3W3N A;  3WPB A;  4U06 A;  3WPH A;  3W3M A;  2O6S A;  4PQ8 A;  3ZYO A;  1A4Y A;  2UZX A;  4U08 A;  2P1M B;  2Z65 A;  2V9S A;  2FT3 A;  1H6T A;  1W8A A;  4WP6 A;  4PKI G;  1XWD C;  5CMP A;  3CIY A;  4Z61 C;  4GLP A;  5GMF A;  1DFJ I;  1DCE A;  1SQ0 B;  1FT8 A;  4PER A;  2RA8 A;  1M9S A;  4LI2 A;  3WPD A;  4LSC A;  5B0T A;  3VQ1 A;  4PEQ B;  1OOK G;  4Q62 A;  4H09 A;  1FO1 A;  2UZY A;  1OTN A;  3ULV A;  3TSR E;  3ULA A;  4KT1 A;  1H6U A;  2Z63 A;  1G9U A;  5HDH A;  4XOS A;  5IJC A;  2P1O B;  1O6V A;  4U7L A;  1QYY A;  5A5C A;  1XEC A;  4L3F A;  4FDW A;  2R9U A;  3RJ0 A;  1P8V A;  4GT6 A;  4KNG A;  1OGQ A;  3O53 A;  3WPG A;  2WQU A;  1U0N D;  4R5D A;  3WPF A;  3G3B A;  1WWL A;  3W3K A;  1M10 B;  4Z79 A;  4CNM A;  5AWB A;  1PGV A;  1KOO A;  2OMW A;  2P1P B;  1P8T A;  2AST B;  5AZ5 A;  3UL9 A;  3M18 A;  5GQR K;  2Z66 A;  5CMN A;  5IJD A;  4EZG A;  4WYK A;  4ECO A;  2P1Q B;  4Z64 C;  2V9T B;  1OZN A;  3GOZ A;  5GS2 B;  3OGM B;  4BSS A;  4BSR A;  3RIZ A;  4R09 A;  4R0A A;  3W3L A;  1FS2 A;  3ZYJ A;  5HZL B;  4LSX C;  4ARR A;  4UFR A;  4CC4 A;  5IJB A;  4AY9 X;  5AWC A;  4G8A A;  3VQ2 A;  1LTX A;  3RW6 A;  5GS0 A;  4RCA B;  4LI1 A;  3C6P B;  3WPC A;  4R6J A;  3DZE A;  1XCD A;  2ID5 A;  3O6N A;  4QXE A;  3OGK B;  1M0Z A;  3CIG A;  1YRG A;  1K5G C;  2XWT C;  3E6J A;  1GWB A;  1M9L A;  2Z7X B;  4R58 A;  3OJA A;  4V2E A;  1OTO A;  1FQV A;  4M7E A;  4LSA A;  3C6O B;  2O6R A;  4K17 A;  3RGX A;  3G06 A;  4NKG A;  3ULU A;  1DS9 A;  2OMZ A;  5D3I A;  4R6F A;  4B8C D;  2OMV A;  5B0N A;  4CC4 C;  4QBZ A;  1Z7X W;  4FMZ A;  4MN8 B;  4PSJ A;  4R5C A;  2OMX A;  4MQW X;  4L3A A;  3REZ A;  4R07 A;  4IM6 A;  4TZH A;  4BSU A;  4NZR M;  5AWA A;  4ARN A;  2WQW A;  2OMY A;  4V2D A;  3G39 A;  5B4P A;  3FXI A;  2OMT A;  3PMH G;  4AW4 A;  3RGZ A;  4Q3I A;  3WPI A;  4J4L A;  3CVR A;  1XKU A;  4FD0 A;  4Z94 G;  4M7E C;  3RFJ A;  4P8S A;  3WN4 A;  2JE0 A;  2WQX A;  2Z82 A;  4OQT A;  4CNC A;  4ECN A;  2RR6 A;  4R6A A;  4R08 A;  4KXF B;  3A79 B;  2BEX A;  3OJA B;  3P72 A;  2JQD A;  4U09 A;  3UL7 A;  3BZ5 A;  2ASS B;  3UN9 A;  1IO0 A;  3RFE A;  4RWT C;  4R6G A;  2A0Z A;  2Q4G W;  1OTM A;  3ZYN A;  3RFS A;  4NKH A;  4XSQ A;  2WQV A;  4RCW A;  2CA6 A;  2JE1 A;  4FHO A;  5GMG A;  3G3A A;  4Q3G A;  2OMU A;  4C2B B;  1K5D C;  4CIL A;  4NZT M;  4I6J B;  1JL5 A;  4FCG A;  5IYX C;  1O6S A;  4J0M A;  2Y5Q A;  3W3J A;  3C6N B;  5AWD A;  4LXR A;  2O6Q A;  3E3Z A;  4LXS A;  2Z64 A;  4BV4 R;  4LSX A;  5GMH A;  4C2A B;  2Z62 A;  4XGO A;  3WPE A;  2Z7X A;  4V2C A;  4CP6 A;  4QC0 A;  3OGL B;  3E2J A;  1O6T A;  3E4G A;  4Z8G A;  3G04 C;  2BNH A;  1KOH A;  3SB4 A;  3M19 A;  3JB9 j;  3ZYI A;  4Y61 B;  5FTT B;  1A9N A;  2XOT A;  2WFH A;  5LFN A;  1P9A G;  2Z81 A;  2ELL A;  4HQ1 A;  3W3G A;  2V70 A;  2P1N B;  1ZIW A;  4P91 A;  3KJ4 A; 
#chains in the Genus database with same CATH homology
 2IFG A;  4YEB B;  4FS7 A;  3UL8 A;  1D0B A;  3RW7 A;  1XEU A;  3W3N A;  3WPB A;  4U06 A;  3WPH A;  3W3M A;  2O6S A;  4PQ8 A;  3ZYO A;  1A4Y A;  2UZX A;  4U08 A;  2P1M B;  2Z65 A;  2V9S A;  2FT3 A;  1H6T A;  1W8A A;  4WP6 A;  4PKI G;  1XWD C;  5CMP A;  3CIY A;  4Z61 C;  4GLP A;  5GMF A;  1DFJ I;  1DCE A;  1SQ0 B;  1FT8 A;  4PER A;  2RA8 A;  1M9S A;  4LI2 A;  3WPD A;  4LSC A;  5B0T A;  3VQ1 A;  4PEQ B;  1OOK G;  4Q62 A;  4H09 A;  1FO1 A;  2UZY A;  1OTN A;  3ULV A;  3TSR E;  3ULA A;  4KT1 A;  1H6U A;  2Z63 A;  1G9U A;  5HDH A;  4XOS A;  5IJC A;  2P1O B;  1O6V A;  4U7L A;  1QYY A;  5A5C A;  1XEC A;  4L3F A;  4FDW A;  2R9U A;  3RJ0 A;  1P8V A;  4GT6 A;  4KNG A;  1OGQ A;  3O53 A;  3WPG A;  2WQU A;  1U0N D;  4R5D A;  3WPF A;  3G3B A;  1WWL A;  3W3K A;  1M10 B;  4Z79 A;  4CNM A;  5AWB A;  1PGV A;  1KOO A;  2OMW A;  2P1P B;  1P8T A;  2AST B;  5AZ5 A;  3UL9 A;  3M18 A;  5GQR K;  2Z66 A;  5CMN A;  5IJD A;  4EZG A;  4WYK A;  4ECO A;  2P1Q B;  4Z64 C;  2V9T B;  1OZN A;  3GOZ A;  5GS2 B;  3OGM B;  4BSS A;  4BSR A;  3RIZ A;  4R09 A;  4R0A A;  3W3L A;  1FS2 A;  3ZYJ A;  5HZL B;  4LSX C;  4ARR A;  4UFR A;  4CC4 A;  5IJB A;  4AY9 X;  5AWC A;  4G8A A;  3VQ2 A;  1LTX A;  3RW6 A;  5GS0 A;  4RCA B;  4LI1 A;  3C6P B;  3WPC A;  4R6J A;  3DZE A;  1XCD A;  2ID5 A;  3O6N A;  4QXE A;  3OGK B;  1M0Z A;  3CIG A;  1YRG A;  1K5G C;  2XWT C;  3E6J A;  1GWB A;  1M9L A;  2Z7X B;  4R58 A;  3OJA A;  4V2E A;  1OTO A;  1FQV A;  4M7E A;  4LSA A;  3C6O B;  2O6R A;  4K17 A;  3RGX A;  3G06 A;  4NKG A;  3ULU A;  1DS9 A;  2OMZ A;  5D3I A;  4R6F A;  4B8C D;  2OMV A;  5B0N A;  4CC4 C;  4QBZ A;  1Z7X W;  4FMZ A;  4MN8 B;  4PSJ A;  4R5C A;  2OMX A;  4MQW X;  4L3A A;  3REZ A;  4R07 A;  4IM6 A;  4TZH A;  4BSU A;  5AWA A;  4ARN A;  2WQW A;  2OMY A;  4V2D A;  3G39 A;  5B4P A;  3FXI A;  2OMT A;  3PMH G;  4AW4 A;  3RGZ A;  4Q3I A;  3WPI A;  4J4L A;  3CVR A;  1XKU A;  4FD0 A;  4Z94 G;  4M7E C;  3RFJ A;  4P8S A;  3WN4 A;  2JE0 A;  2WQX A;  2Z82 A;  4OQT A;  4CNC A;  4ECN A;  2RR6 A;  4R6A A;  4R08 A;  4KXF B;  3A79 B;  2BEX A;  3OJA B;  3P72 A;  2JQD A;  4U09 A;  3UL7 A;  3BZ5 A;  2ASS B;  3UN9 A;  1IO0 A;  3RFE A;  4RWT C;  4R6G A;  2A0Z A;  2Q4G W;  1OTM A;  3ZYN A;  3RFS A;  4NKH A;  4XSQ A;  2WQV A;  4RCW A;  2CA6 A;  2JE1 A;  4FHO A;  5GMG A;  3G3A A;  4Q3G A;  2OMU A;  4C2B B;  1K5D C;  4CIL A;  4I6J B;  1JL5 A;  4FCG A;  5IYX C;  1O6S A;  4J0M A;  2Y5Q A;  3W3J A;  3C6N B;  5AWD A;  4LXR A;  2O6Q A;  3E3Z A;  4LXS A;  2Z64 A;  4BV4 R;  4LSX A;  5GMH A;  4C2A B;  2Z62 A;  4XGO A;  3WPE A;  2Z7X A;  4V2C A;  4CP6 A;  4QC0 A;  3OGL B;  3E2J A;  1O6T A;  3E4G A;  4Z8G A;  3G04 C;  2BNH A;  1KOH A;  3SB4 A;  3M19 A;  3JB9 j;  3ZYI A;  4Y61 B;  5FTT B;  1A9N A;  2XOT A;  2WFH A;  5LFN A;  1P9A G;  2Z81 A;  2ELL A;  4HQ1 A;  3W3G A;  2V70 A;  2P1N B;  1ZIW A;  4P91 A;  3KJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...