3O6NA

Crystal structure of apl1 leucine-rich repeat domain
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
378
Chain Sequence
b'QPEYKCIDCVFYDVHIDMQTQDVYFGFEDITLNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLVLERNDLSSLPRGIFHNTPKLTTLSMSNNNLERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAIPIAVEELDASHNSINVVRGPVNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISNNRLVALNLYGQPIPTLKVLDLSHNHLLHVERNQPQFDRLENLYLDHNSIVTLKLSTHHTLKNLTLSHNDWDCNSLRALFRNVARPAVDDADQHCKIDYQLEHGLCCKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APL1
publication title A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Protein binding
total genus 140
structure length 378
sequence length 384
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3o6nA00
4GLPA 2WQWA 3G04C 5HZLB 4NKHA 3ULAA 4J4LA 3A79B 1SQ0B 3RGXA 1OZNA 5D3IA 4Q62A 2P1PB 3OJAA 4B8CD 3E6JA 1OTNA 2V9SA 2XWTC 1FQVA 4R0AA 3WPHA 3RGZA 4H09A 2UZXA 1FS2A 4R6JA 4M7EA 4LSAA 4YEBB 2ASSB 4CNCA 1XECA 4Y61B 4QBZA 4AW4A 2BEXA 3G3AA 3ULVA 3E4GA 4EZGA 3P72A 3JB9j 3ZYOA 1JL5A 2OMZA 4RCAB 4V2DA 4U06A 1OOKG 4XGOA 1Z7XW 1A4YA 1P8VA 3SB4A 3RIZA 3G3BA 5AWCA 2ELLA 3ZYNA 1OTMA 2OMUA 4LSXA 5GQRK 4ECOA 3WN4A 1K5GC 2Z65A 4OQTA 5GS0A 1G9UA 2OMWA 4FS7A 4RWTC 4LXSA 1XWDC 1OTOA 1D0BA 4PKIG 2A0ZA 1M10B 3M18A 2JE1A 4U08A 3OGMB 2Z82A 4U7LA 1P9AG 2WQXA 4GT6A 2Z7XB 4Z61C 4NKGA 4WP6A 3DZEA 5B4PA 4MQWX 3C6PB 1M0ZA 3O6NA 3UL8A 3ZYJA 4CC4A 5GMGA 2V70A 4R6AA 4FD0A 1YRGA 4LXRA 1H6UA 5IJBA 2Z64A 3OJAB 4P91A 4M7EC 3ULUA 5FTTB 4KXFB 2WQVA 2Z63A 1M9SA 4U09A 1GWBA 3VQ2A 1U0ND 4Z8GA 1DCEA 4R07A 1P8TA 5IJDA 1LTXA 1DS9A 2OMYA 4Q3GA 3RFEA 2Q4GW 4ARNA 2Y5QA 1FO1A 3UN9A 5IYXC 3BZ5A 4L3FA 4RCWA 4QXEA 4AY9X 4PEQB 3W3LA 2Z66A 3PMHG 4WYKA 3E3ZA 4I6JB 2R9UA 4FMZA 4LSXC 3WPDA 4KT1A 4R58A 3W3KA 4V2CA 1FT8A 2OMVA 5GMHA 4UFRA 4L3AA 4FCGA 3WPFA 3W3GA 1DFJI 4XOSA 5CMPA 4FDWA 4ARRA 3RFSA 4R08A 3REZA 5AWBA 1XEUA 2O6RA 5LFNA 1K5DC 4C2BB 4R6FA 2WQUA 2Z81A 3RFJA 4HQ1A 3G39A 3G06A 4G8AA 4TZHA 5B0NA 4Z79A 1WWLA 2CA6A 4V2EA 4Z64C 4BSRA 3RJ0A 3UL9A 3E2JA 1O6VA 5GMFA 2UZYA 4XSQA 4QC0A 2ID5A 4CC4C 3O53A 4CILA 2IFGA 3W3JA 1O6SA 2OMTA 2P1QB 2JE0A 4C2AB 3CIYA 5IJCA 4CNMA 5CMNA 4R5DA 2O6QA 4BSUA 2P1NB 4MN8B 3TSRE 1KOHA 3M19A 4Q3IA 1OGQA 1IO0A 2JQDA 2RA8A 4IM6A 1QYYA 1O6TA 4BV4R 5AWDA 4KNGA 3W3NA 5AZ5A 2OMXA 3VQ1A 2ASTB 3FXIA 5AWAA 4CP6A 2FT3A 3OGLB 4BSSA 1PGVA 2P1MB 4LSCA 2V9TB 4PSJA 3WPGA 4P8SA 4FHOA 1M9LA 4PQ8A 3C6NB 3WPEA 4LI2A 4PERA 3UL7A 3WPCA 1XKUA 3GOZA 1KOOA 2BNHA 3CVRA 4LI1A 3OGKB 5HDHA 2XOTA 4Z94G 2WFHA 5B0TA 1XCDA 4R5CA 4R6GA 4J0MA 3W3MA 3ZYIA 2Z62A 5A5CA 1W8AA 4R09A 3CIGA 1H6TA 4K17A 2RR6A 3RW7A 2O6SA 3WPIA 3C6OB 3WPBA 3RW6A 4ECNA 1A9NA 2Z7XA 5GS2B 2P1OB 1ZIWA 3KJ4A
chains in the Genus database with same CATH superfamily
4GLPA 2WQWA 3G04C 5HZLB 4NKHA 3ULAA 4J4LA 3A79B 1SQ0B 3RGXA 1OZNA 5D3IA 4Q62A 2P1PB 3OJAA 4B8CD 3E6JA 1OTNA 2V9SA 2XWTC 1FQVA 4R0AA 3WPHA 3RGZA 4H09A 2UZXA 1FS2A 4R6JA 4M7EA 4LSAA 4YEBB 2ASSB 4CNCA 1XECA 4Y61B 4QBZA 4AW4A 2BEXA 3G3AA 3ULVA 3E4GA 4EZGA 3P72A 3JB9j 3ZYOA 1JL5A 2OMZA 4RCAB 4V2DA 4NZRM 4U06A 1OOKG 4XGOA 1Z7XW 1A4YA 1P8VA 3SB4A 3RIZA 3G3BA 5AWCA 2ELLA 3ZYNA 1OTMA 2OMUA 4LSXA 5GQRK 4ECOA 3WN4A 1K5GC 2Z65A 4OQTA 5GS0A 1G9UA 2OMWA 4FS7A 4RWTC 4LXSA 1XWDC 1OTOA 1D0BA 4PKIG 2A0ZA 1M10B 3M18A 2JE1A 4U08A 3OGMB 2Z82A 4U7LA 1P9AG 2WQXA 4GT6A 2Z7XB 4Z61C 4NKGA 4WP6A 3DZEA 5B4PA 4MQWX 3C6PB 1M0ZA 3O6NA 3UL8A 3ZYJA 4CC4A 5GMGA 2V70A 4R6AA 4FD0A 1YRGA 4LXRA 1H6UA 5IJBA 2Z64A 3OJAB 4P91A 4M7EC 3ULUA 5FTTB 4KXFB 2WQVA 2Z63A 1M9SA 4U09A 1GWBA 3VQ2A 1U0ND 4Z8GA 1DCEA 4R07A 1P8TA 5IJDA 1LTXA 1DS9A 2OMYA 4Q3GA 3RFEA 2Q4GW 4ARNA 2Y5QA 1FO1A 3UN9A 5IYXC 3BZ5A 4L3FA 4RCWA 4QXEA 4AY9X 4PEQB 3W3LA 2Z66A 3PMHG 4WYKA 3E3ZA 4I6JB 2R9UA 4FMZA 4LSXC 3WPDA 4KT1A 4R58A 3W3KA 4V2CA 1FT8A 2OMVA 5GMHA 4UFRA 4L3AA 4FCGA 3WPFA 3W3GA 1DFJI 4XOSA 5CMPA 4FDWA 4ARRA 3RFSA 4R08A 3REZA 5AWBA 1XEUA 2O6RA 5LFNA 1K5DC 4C2BB 4R6FA 2WQUA 2Z81A 3RFJA 4HQ1A 3G39A 3G06A 4G8AA 4TZHA 5B0NA 4Z79A 1WWLA 2CA6A 4V2EA 4Z64C 4BSRA 3RJ0A 3UL9A 3E2JA 1O6VA 5GMFA 2UZYA 4XSQA 4QC0A 2ID5A 4CC4C 3O53A 4CILA 2IFGA 3W3JA 1O6SA 2OMTA 2P1QB 2JE0A 4C2AB 3CIYA 5IJCA 4CNMA 5CMNA 4R5DA 2O6QA 4BSUA 2P1NB 4MN8B 3TSRE 1KOHA 3M19A 4Q3IA 1OGQA 1IO0A 2JQDA 2RA8A 4IM6A 1QYYA 1O6TA 4BV4R 4NZTM 5AWDA 4KNGA 3W3NA 5AZ5A 2OMXA 3VQ1A 2ASTB 3FXIA 5AWAA 4CP6A 2FT3A 3OGLB 4BSSA 1PGVA 2P1MB 4LSCA 2V9TB 4PSJA 3WPGA 4P8SA 4FHOA 1M9LA 4PQ8A 3C6NB 3WPEA 4LI2A 4PERA 3UL7A 3WPCA 1XKUA 3GOZA 1KOOA 2BNHA 3CVRA 4LI1A 3OGKB 5HDHA 2XOTA 4Z94G 2WFHA 5B0TA 1XCDA 4R5CA 4R6GA 4J0MA 3W3MA 3ZYIA 2Z62A 5A5CA 1W8AA 4R09A 3CIGA 1H6TA 4K17A 2RR6A 3RW7A 2O6SA 3WPIA 3C6OB 3WPBA 3RW6A 4ECNA 1A9NA 2Z7XA 5GS2B 2P1OB 1ZIWA 3KJ4A
chains in the Genus database with same CATH topology
4GLPA 2WQWA 3G04C 5HZLB 4NKHA 3ULAA 4J4LA 3A79B 1SQ0B 3RGXA 1OZNA 5D3IA 4Q62A 2P1PB 3OJAA 4B8CD 3E6JA 1OTNA 2V9SA 2XWTC 1FQVA 4R0AA 3WPHA 3RGZA 4H09A 2UZXA 1FS2A 4R6JA 4M7EA 4LSAA 4YEBB 2ASSB 4CNCA 1XECA 4Y61B 4QBZA 4AW4A 2BEXA 3G3AA 3ULVA 3E4GA 4EZGA 3P72A 3JB9j 3ZYOA 1JL5A 2OMZA 4RCAB 4V2DA 4U06A 1OOKG 4XGOA 1Z7XW 1A4YA 1P8VA 3SB4A 3RIZA 3G3BA 5AWCA 2ELLA 3ZYNA 1OTMA 2OMUA 4LSXA 5GQRK 4ECOA 3WN4A 1K5GC 2Z65A 4OQTA 5GS0A 1G9UA 2OMWA 4FS7A 4RWTC 4LXSA 1XWDC 1OTOA 1D0BA 4PKIG 2A0ZA 1M10B 3M18A 2JE1A 4U08A 3OGMB 2Z82A 4U7LA 1P9AG 2WQXA 4GT6A 2Z7XB 4Z61C 4NKGA 4WP6A 3DZEA 5B4PA 4MQWX 3C6PB 1M0ZA 3O6NA 3UL8A 3ZYJA 4CC4A 5GMGA 2V70A 4R6AA 4FD0A 1YRGA 4LXRA 1H6UA 5IJBA 2Z64A 3OJAB 4P91A 4M7EC 3ULUA 5FTTB 4KXFB 2WQVA 2Z63A 1M9SA 4U09A 1GWBA 3VQ2A 1U0ND 4Z8GA 1DCEA 4R07A 1P8TA 5IJDA 1LTXA 1DS9A 2OMYA 4Q3GA 3RFEA 2Q4GW 4ARNA 2Y5QA 1FO1A 3UN9A 5IYXC 3BZ5A 4L3FA 4RCWA 4QXEA 4AY9X 4PEQB 3W3LA 2Z66A 3PMHG 4WYKA 3E3ZA 4I6JB 2R9UA 4FMZA 4LSXC 3WPDA 4KT1A 4R58A 3W3KA 4V2CA 1FT8A 2OMVA 5GMHA 4UFRA 4L3AA 4FCGA 3WPFA 3W3GA 1DFJI 4XOSA 5CMPA 4FDWA 4ARRA 3RFSA 4R08A 3REZA 5AWBA 1XEUA 2O6RA 5LFNA 1K5DC 4C2BB 4R6FA 2WQUA 2Z81A 3RFJA 4HQ1A 3G39A 3G06A 4G8AA 4TZHA 5B0NA 4Z79A 1WWLA 2CA6A 4V2EA 4Z64C 4BSRA 3RJ0A 3UL9A 3E2JA 1O6VA 5GMFA 2UZYA 4XSQA 4QC0A 2ID5A 4CC4C 3O53A 4CILA 2IFGA 3W3JA 1O6SA 2OMTA 2P1QB 2JE0A 4C2AB 3CIYA 5IJCA 4CNMA 5CMNA 4R5DA 2O6QA 4BSUA 2P1NB 4MN8B 3TSRE 1KOHA 3M19A 4Q3IA 1OGQA 1IO0A 2JQDA 2RA8A 4IM6A 1QYYA 1O6TA 4BV4R 5AWDA 4KNGA 3W3NA 5AZ5A 2OMXA 3VQ1A 2ASTB 3FXIA 5AWAA 4CP6A 2FT3A 3OGLB 4BSSA 1PGVA 2P1MB 4LSCA 2V9TB 4PSJA 3WPGA 4P8SA 4FHOA 1M9LA 4PQ8A 3C6NB 3WPEA 4LI2A 4PERA 3UL7A 3WPCA 1XKUA 3GOZA 1KOOA 2BNHA 3CVRA 4LI1A 3OGKB 5HDHA 2XOTA 4Z94G 2WFHA 5B0TA 1XCDA 4R5CA 4R6GA 4J0MA 3W3MA 3ZYIA 2Z62A 5A5CA 1W8AA 4R09A 3CIGA 1H6TA 4K17A 2RR6A 3RW7A 2O6SA 3WPIA 3C6OB 3WPBA 3RW6A 4ECNA 1A9NA 2Z7XA 5GS2B 2P1OB 1ZIWA 3KJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLP A;  2WQW A;  3G04 C;  5HZL B;  4NKH A;  3ULA A;  4J4L A;  3A79 B;  1SQ0 B;  3RGX A;  1OZN A;  5D3I A;  4Q62 A;  2P1P B;  3OJA A;  4B8C D;  3E6J A;  1OTN A;  2V9S A;  2XWT C;  1FQV A;  4R0A A;  3WPH A;  3RGZ A;  4H09 A;  2UZX A;  1FS2 A;  4R6J A;  4M7E A;  4LSA A;  4YEB B;  2ASS B;  4CNC A;  1XEC A;  4Y61 B;  4QBZ A;  4AW4 A;  2BEX A;  3G3A A;  3ULV A;  3E4G A;  4EZG A;  3P72 A;  3JB9 j;  3ZYO A;  1JL5 A;  2OMZ A;  4RCA B;  4V2D A;  4U06 A;  1OOK G;  4XGO A;  1Z7X W;  1A4Y A;  1P8V A;  3SB4 A;  3RIZ A;  3G3B A;  5AWC A;  2ELL A;  3ZYN A;  1OTM A;  2OMU A;  4LSX A;  5GQR K;  4ECO A;  3WN4 A;  1K5G C;  2Z65 A;  4OQT A;  5GS0 A;  1G9U A;  2OMW A;  4FS7 A;  4RWT C;  4LXS A;  1XWD C;  1OTO A;  1D0B A;  4PKI G;  2A0Z A;  1M10 B;  3M18 A;  2JE1 A;  4U08 A;  3OGM B;  2Z82 A;  4U7L A;  1P9A G;  2WQX A;  4GT6 A;  2Z7X B;  4Z61 C;  4NKG A;  4WP6 A;  3DZE A;  5B4P A;  4MQW X;  3C6P B;  1M0Z A;  3O6N A;  3UL8 A;  3ZYJ A;  4CC4 A;  5GMG A;  2V70 A;  4R6A A;  4FD0 A;  1YRG A;  4LXR A;  1H6U A;  5IJB A;  2Z64 A;  3OJA B;  4P91 A;  4M7E C;  3ULU A;  5FTT B;  4KXF B;  2WQV A;  2Z63 A;  1M9S A;  4U09 A;  1GWB A;  3VQ2 A;  1U0N D;  4Z8G A;  1DCE A;  4R07 A;  1P8T A;  5IJD A;  1LTX A;  1DS9 A;  2OMY A;  4Q3G A;  3RFE A;  2Q4G W;  4ARN A;  2Y5Q A;  1FO1 A;  3UN9 A;  5IYX C;  3BZ5 A;  4L3F A;  4RCW A;  4QXE A;  4AY9 X;  4PEQ B;  3W3L A;  2Z66 A;  3PMH G;  4WYK A;  3E3Z A;  4I6J B;  2R9U A;  4FMZ A;  4LSX C;  3WPD A;  4KT1 A;  4R58 A;  3W3K A;  4V2C A;  1FT8 A;  2OMV A;  5GMH A;  4UFR A;  4L3A A;  4FCG A;  3WPF A;  3W3G A;  1DFJ I;  4XOS A;  5CMP A;  4FDW A;  4ARR A;  3RFS A;  4R08 A;  3REZ A;  5AWB A;  1XEU A;  2O6R A;  5LFN A;  1K5D C;  4C2B B;  4R6F A;  2WQU A;  2Z81 A;  3RFJ A;  4HQ1 A;  3G39 A;  3G06 A;  4G8A A;  4TZH A;  5B0N A;  4Z79 A;  1WWL A;  2CA6 A;  4V2E A;  4Z64 C;  4BSR A;  3RJ0 A;  3UL9 A;  3E2J A;  1O6V A;  5GMF A;  2UZY A;  4XSQ A;  4QC0 A;  2ID5 A;  4CC4 C;  3O53 A;  4CIL A;  2IFG A;  3W3J A;  1O6S A;  2OMT A;  2P1Q B;  2JE0 A;  4C2A B;  3CIY A;  5IJC A;  4CNM A;  5CMN A;  4R5D A;  2O6Q A;  4BSU A;  2P1N B;  4MN8 B;  3TSR E;  1KOH A;  3M19 A;  4Q3I A;  1OGQ A;  1IO0 A;  2JQD A;  2RA8 A;  4IM6 A;  1QYY A;  1O6T A;  4BV4 R;  5AWD A;  4KNG A;  3W3N A;  5AZ5 A;  2OMX A;  3VQ1 A;  2AST B;  3FXI A;  5AWA A;  4CP6 A;  2FT3 A;  3OGL B;  4BSS A;  1PGV A;  2P1M B;  4LSC A;  2V9T B;  4PSJ A;  3WPG A;  4P8S A;  4FHO A;  1M9L A;  4PQ8 A;  3C6N B;  3WPE A;  4LI2 A;  4PER A;  3UL7 A;  3WPC A;  1XKU A;  3GOZ A;  1KOO A;  2BNH A;  3CVR A;  4LI1 A;  3OGK B;  5HDH A;  2XOT A;  4Z94 G;  2WFH A;  5B0T A;  1XCD A;  4R5C A;  4R6G A;  4J0M A;  3W3M A;  3ZYI A;  2Z62 A;  5A5C A;  1W8A A;  4R09 A;  3CIG A;  1H6T A;  4K17 A;  2RR6 A;  3RW7 A;  2O6S A;  3WPI A;  3C6O B;  3WPB A;  3RW6 A;  4ECN A;  1A9N A;  2Z7X A;  5GS2 B;  2P1O B;  1ZIW A;  3KJ4 A; 
#chains in the Genus database with same CATH topology
 4GLP A;  2WQW A;  3G04 C;  5HZL B;  4NKH A;  3ULA A;  4J4L A;  3A79 B;  1SQ0 B;  3RGX A;  1OZN A;  5D3I A;  4Q62 A;  2P1P B;  3OJA A;  4B8C D;  3E6J A;  1OTN A;  2V9S A;  2XWT C;  1FQV A;  4R0A A;  3WPH A;  3RGZ A;  4H09 A;  2UZX A;  1FS2 A;  4R6J A;  4M7E A;  4LSA A;  4YEB B;  2ASS B;  4CNC A;  1XEC A;  4Y61 B;  4QBZ A;  4AW4 A;  2BEX A;  3G3A A;  3ULV A;  3E4G A;  4EZG A;  3P72 A;  3JB9 j;  3ZYO A;  1JL5 A;  2OMZ A;  4RCA B;  4V2D A;  4NZR M;  4U06 A;  1OOK G;  4XGO A;  1Z7X W;  1A4Y A;  1P8V A;  3SB4 A;  3RIZ A;  3G3B A;  5AWC A;  2ELL A;  3ZYN A;  1OTM A;  2OMU A;  4LSX A;  5GQR K;  4ECO A;  3WN4 A;  1K5G C;  2Z65 A;  4OQT A;  5GS0 A;  1G9U A;  2OMW A;  4FS7 A;  4RWT C;  4LXS A;  1XWD C;  1OTO A;  1D0B A;  4PKI G;  2A0Z A;  1M10 B;  3M18 A;  2JE1 A;  4U08 A;  3OGM B;  2Z82 A;  4U7L A;  1P9A G;  2WQX A;  4GT6 A;  2Z7X B;  4Z61 C;  4NKG A;  4WP6 A;  3DZE A;  5B4P A;  4MQW X;  3C6P B;  1M0Z A;  3O6N A;  3UL8 A;  3ZYJ A;  4CC4 A;  5GMG A;  2V70 A;  4R6A A;  4FD0 A;  1YRG A;  4LXR A;  1H6U A;  5IJB A;  2Z64 A;  3OJA B;  4P91 A;  4M7E C;  3ULU A;  5FTT B;  4KXF B;  2WQV A;  2Z63 A;  1M9S A;  4U09 A;  1GWB A;  3VQ2 A;  1U0N D;  4Z8G A;  1DCE A;  4R07 A;  1P8T A;  5IJD A;  1LTX A;  1DS9 A;  2OMY A;  4Q3G A;  3RFE A;  2Q4G W;  4ARN A;  2Y5Q A;  1FO1 A;  3UN9 A;  5IYX C;  3BZ5 A;  4L3F A;  4RCW A;  4QXE A;  4AY9 X;  4PEQ B;  3W3L A;  2Z66 A;  3PMH G;  4WYK A;  3E3Z A;  4I6J B;  2R9U A;  4FMZ A;  4LSX C;  3WPD A;  4KT1 A;  4R58 A;  3W3K A;  4V2C A;  1FT8 A;  2OMV A;  5GMH A;  4UFR A;  4L3A A;  4FCG A;  3WPF A;  3W3G A;  1DFJ I;  4XOS A;  5CMP A;  4FDW A;  4ARR A;  3RFS A;  4R08 A;  3REZ A;  5AWB A;  1XEU A;  2O6R A;  5LFN A;  1K5D C;  4C2B B;  4R6F A;  2WQU A;  2Z81 A;  3RFJ A;  4HQ1 A;  3G39 A;  3G06 A;  4G8A A;  4TZH A;  5B0N A;  4Z79 A;  1WWL A;  2CA6 A;  4V2E A;  4Z64 C;  4BSR A;  3RJ0 A;  3UL9 A;  3E2J A;  1O6V A;  5GMF A;  2UZY A;  4XSQ A;  4QC0 A;  2ID5 A;  4CC4 C;  3O53 A;  4CIL A;  2IFG A;  3W3J A;  1O6S A;  2OMT A;  2P1Q B;  2JE0 A;  4C2A B;  3CIY A;  5IJC A;  4CNM A;  5CMN A;  4R5D A;  2O6Q A;  4BSU A;  2P1N B;  4MN8 B;  3TSR E;  1KOH A;  3M19 A;  4Q3I A;  1OGQ A;  1IO0 A;  2JQD A;  2RA8 A;  4IM6 A;  1QYY A;  1O6T A;  4BV4 R;  4NZT M;  5AWD A;  4KNG A;  3W3N A;  5AZ5 A;  2OMX A;  3VQ1 A;  2AST B;  3FXI A;  5AWA A;  4CP6 A;  2FT3 A;  3OGL B;  4BSS A;  1PGV A;  2P1M B;  4LSC A;  2V9T B;  4PSJ A;  3WPG A;  4P8S A;  4FHO A;  1M9L A;  4PQ8 A;  3C6N B;  3WPE A;  4LI2 A;  4PER A;  3UL7 A;  3WPC A;  1XKU A;  3GOZ A;  1KOO A;  2BNH A;  3CVR A;  4LI1 A;  3OGK B;  5HDH A;  2XOT A;  4Z94 G;  2WFH A;  5B0T A;  1XCD A;  4R5C A;  4R6G A;  4J0M A;  3W3M A;  3ZYI A;  2Z62 A;  5A5C A;  1W8A A;  4R09 A;  3CIG A;  1H6T A;  4K17 A;  2RR6 A;  3RW7 A;  2O6S A;  3WPI A;  3C6O B;  3WPB A;  3RW6 A;  4ECN A;  1A9N A;  2Z7X A;  5GS2 B;  2P1O B;  1ZIW A;  3KJ4 A; 
#chains in the Genus database with same CATH homology
 4GLP A;  2WQW A;  3G04 C;  5HZL B;  4NKH A;  3ULA A;  4J4L A;  3A79 B;  1SQ0 B;  3RGX A;  1OZN A;  5D3I A;  4Q62 A;  2P1P B;  3OJA A;  4B8C D;  3E6J A;  1OTN A;  2V9S A;  2XWT C;  1FQV A;  4R0A A;  3WPH A;  3RGZ A;  4H09 A;  2UZX A;  1FS2 A;  4R6J A;  4M7E A;  4LSA A;  4YEB B;  2ASS B;  4CNC A;  1XEC A;  4Y61 B;  4QBZ A;  4AW4 A;  2BEX A;  3G3A A;  3ULV A;  3E4G A;  4EZG A;  3P72 A;  3JB9 j;  3ZYO A;  1JL5 A;  2OMZ A;  4RCA B;  4V2D A;  4U06 A;  1OOK G;  4XGO A;  1Z7X W;  1A4Y A;  1P8V A;  3SB4 A;  3RIZ A;  3G3B A;  5AWC A;  2ELL A;  3ZYN A;  1OTM A;  2OMU A;  4LSX A;  5GQR K;  4ECO A;  3WN4 A;  1K5G C;  2Z65 A;  4OQT A;  5GS0 A;  1G9U A;  2OMW A;  4FS7 A;  4RWT C;  4LXS A;  1XWD C;  1OTO A;  1D0B A;  4PKI G;  2A0Z A;  1M10 B;  3M18 A;  2JE1 A;  4U08 A;  3OGM B;  2Z82 A;  4U7L A;  1P9A G;  2WQX A;  4GT6 A;  2Z7X B;  4Z61 C;  4NKG A;  4WP6 A;  3DZE A;  5B4P A;  4MQW X;  3C6P B;  1M0Z A;  3O6N A;  3UL8 A;  3ZYJ A;  4CC4 A;  5GMG A;  2V70 A;  4R6A A;  4FD0 A;  1YRG A;  4LXR A;  1H6U A;  5IJB A;  2Z64 A;  3OJA B;  4P91 A;  4M7E C;  3ULU A;  5FTT B;  4KXF B;  2WQV A;  2Z63 A;  1M9S A;  4U09 A;  1GWB A;  3VQ2 A;  1U0N D;  4Z8G A;  1DCE A;  4R07 A;  1P8T A;  5IJD A;  1LTX A;  1DS9 A;  2OMY A;  4Q3G A;  3RFE A;  2Q4G W;  4ARN A;  2Y5Q A;  1FO1 A;  3UN9 A;  5IYX C;  3BZ5 A;  4L3F A;  4RCW A;  4QXE A;  4AY9 X;  4PEQ B;  3W3L A;  2Z66 A;  3PMH G;  4WYK A;  3E3Z A;  4I6J B;  2R9U A;  4FMZ A;  4LSX C;  3WPD A;  4KT1 A;  4R58 A;  3W3K A;  4V2C A;  1FT8 A;  2OMV A;  5GMH A;  4UFR A;  4L3A A;  4FCG A;  3WPF A;  3W3G A;  1DFJ I;  4XOS A;  5CMP A;  4FDW A;  4ARR A;  3RFS A;  4R08 A;  3REZ A;  5AWB A;  1XEU A;  2O6R A;  5LFN A;  1K5D C;  4C2B B;  4R6F A;  2WQU A;  2Z81 A;  3RFJ A;  4HQ1 A;  3G39 A;  3G06 A;  4G8A A;  4TZH A;  5B0N A;  4Z79 A;  1WWL A;  2CA6 A;  4V2E A;  4Z64 C;  4BSR A;  3RJ0 A;  3UL9 A;  3E2J A;  1O6V A;  5GMF A;  2UZY A;  4XSQ A;  4QC0 A;  2ID5 A;  4CC4 C;  3O53 A;  4CIL A;  2IFG A;  3W3J A;  1O6S A;  2OMT A;  2P1Q B;  2JE0 A;  4C2A B;  3CIY A;  5IJC A;  4CNM A;  5CMN A;  4R5D A;  2O6Q A;  4BSU A;  2P1N B;  4MN8 B;  3TSR E;  1KOH A;  3M19 A;  4Q3I A;  1OGQ A;  1IO0 A;  2JQD A;  2RA8 A;  4IM6 A;  1QYY A;  1O6T A;  4BV4 R;  5AWD A;  4KNG A;  3W3N A;  5AZ5 A;  2OMX A;  3VQ1 A;  2AST B;  3FXI A;  5AWA A;  4CP6 A;  2FT3 A;  3OGL B;  4BSS A;  1PGV A;  2P1M B;  4LSC A;  2V9T B;  4PSJ A;  3WPG A;  4P8S A;  4FHO A;  1M9L A;  4PQ8 A;  3C6N B;  3WPE A;  4LI2 A;  4PER A;  3UL7 A;  3WPC A;  1XKU A;  3GOZ A;  1KOO A;  2BNH A;  3CVR A;  4LI1 A;  3OGK B;  5HDH A;  2XOT A;  4Z94 G;  2WFH A;  5B0T A;  1XCD A;  4R5C A;  4R6G A;  4J0M A;  3W3M A;  3ZYI A;  2Z62 A;  5A5C A;  1W8A A;  4R09 A;  3CIG A;  1H6T A;  4K17 A;  2RR6 A;  3RW7 A;  2O6S A;  3WPI A;  3C6O B;  3WPB A;  3RW6 A;  4ECN A;  1A9N A;  2Z7X A;  5GS2 B;  2P1O B;  1ZIW A;  3KJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...