3O6NA

Crystal structure of apl1 leucine-rich repeat domain
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
378
Chain Sequence
QPEYKCIDCVFYDVHIDMQTQDVYFGFEDITLNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLVLERNDLSSLPRGIFHNTPKLTTLSMSNNNLERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAIPIAVEELDASHNSINVVRGPVNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISNNRLVALNLYGQPIPTLKVLDLSHNHLLHVERNQPQFDRLENLYLDHNSIVTLKLSTHHTLKNLTLSHNDWDCNSLRALFRNVARPAVDDADQHCKIDYQLEHGLCCKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords APL1
publication title A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 140
structure length 378
sequence length 384
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3o6nA00
4CNMA 1OTMA 4PERA 2OMZA 3E3ZA 1PGVA 1OZNA 2Z7XA 5GMGA 1P8TA 3RIZA 3WPHA 4PKIG 3W3NA 3E2JA 3A79B 3OGKB 3RGZA 4CP6A 2RR6A 2O6SA 2XOTA 3SB4A 4KNGA 3E4GA 4BSUA 1FQVA 2OMXA 2XWTC 4CC4C 5AWAA 2Z64A 4YEBB 2Z7XB 4NKHA 5GS2B 3C6OB 5GMHA 4ECOA 5AWDA 4Z79A 5AWCA 3O6NA 2V9TB 3WPBA 3CIGA 1H6UA 4C2BB 1O6SA 3M18A 2Y5QA 4U7LA 1P8VA 3ULUA 4Z64C 5GMFA 4R6JA 3TSRE 4P8SA 4ECNA 2BNHA 4GT6A 3VQ2A 3ZYIA 4Q3GA 2UZYA 5IJCA 3WPCA 4MQWX 1OTOA 1O6VA 4U06A 3RFEA 2WQUA 2P1NB 5GQRK 2OMVA 4L3AA 2IFGA 4LI1A 1M0ZA 4Q3IA 4GLPA 3ULAA 2Z62A 4CNCA 1GWBA 4C2AB 4V2EA 5IJBA 3W3MA 2ELLA 4U09A 1OGQA 4WP6A 4XGOA 5D3IA 2Z81A 1DCEA 4LSXA 3C6PB 4U08A 4FS7A 1P9AG 3KJ4A 2O6QA 3G04C 2ASSB 3CVRA 3WN4A 3G3AA 4FD0A 4PQ8A 4AW4A 1WWLA 4FDWA 2ASTB 5B0TA 4RCAB 4V2CA 4LI2A 5HZLB 5IJDA 5CMNA 4J4LA 3GOZA 4QBZA 1FT8A 5GS0A 3PMHG 1M9LA 3UN9A 2WQWA 3M19A 4WYKA 3OJAA 4PSJA 3OGLB 4RWTC 3WPDA 1O6TA 2FT3A 3UL7A 2A0ZA 2WFHA 2WQXA 3RW6A 4LSXC 4ARRA 2OMYA 4R07A 1KOHA 3G06A 4R08A 3WPFA 2V70A 2CA6A 4BSRA 3G3BA 2V9SA 4QC0A 1ZIWA 4QXEA 3RGXA 4G8AA 4R6AA 3WPGA 4FCGA 4LSCA 3ZYOA 4Z61C 4R6FA 4RCWA 3VQ1A 4NKGA 3RJ0A 2P1PB 2OMTA 1A9NA 5B0NA 1OTNA 4R6GA 4LXSA 4P91A 1A4YA 4XSQA 4J0MA 2JQDA 1U0ND 3W3JA 1K5GC 1D0BA 4KT1A 4EZGA 5A5CA 3W3LA 3FXIA 2P1QB 4UFRA 2BEXA 1XEUA 2OMWA 5IYXC 4I6JB 4XOSA 3RFJA 5HDHA 3W3GA 3WPIA 5FTTB 1FS2A 3ULVA 1W8AA 4R0AA 1M10B 4R09A 3O53A 3JB9j 3ZYJA 1XECA 4M7EA 4L3FA 4B8CD 3REZA 5AWBA 1FO1A 1DFJI 5LFNA 1KOOA 1K5DC 4FHOA 3P72A 5CMPA 4Z8GA 4PEQB 5AZ5A 2Z65A 4AY9X 5B4PA 4KXFB 3RW7A 1M9SA 4CILA 4OQTA 4Q62A 1OOKG 4LXRA 4FMZA 3OGMB 4LSAA 1XCDA 4MN8B 1JL5A 3G39A 2Z66A 4BV4R 2UZXA 2Z63A 1QYYA 1Z7XW 3CIYA 2JE1A 3OJAB 3W3KA 4ARNA 1XKUA 3WPEA 2P1MB 4M7EC 4Z94G 2ID5A 4IM6A 1G9UA 2JE0A 3RFSA 4BSSA 1DS9A 2OMUA 2WQVA 2P1OB 4V2DA 1XWDC 4R5CA 3C6NB 3UL9A 4R5DA 4HQ1A 2Z82A 4CC4A 1LTXA 3DZEA 1YRGA 4Y61B 3ZYNA 3UL8A 1H6TA 1SQ0B 2O6RA 3E6JA 4H09A 2R9UA 4K17A 2RA8A 3BZ5A 4R58A 2Q4GW 1IO0A 4TZHA
chains in the Genus database with same CATH superfamily
4CNMA 1OTMA 4PERA 2OMZA 3E3ZA 4NZRM 1PGVA 1OZNA 2Z7XA 5GMGA 1P8TA 3RIZA 3WPHA 4PKIG 3W3NA 3E2JA 3A79B 3OGKB 3RGZA 4CP6A 2RR6A 2O6SA 2XOTA 3SB4A 4KNGA 3E4GA 4BSUA 1FQVA 2OMXA 2XWTC 4CC4C 5AWAA 2Z64A 4YEBB 2Z7XB 4NKHA 5GS2B 3C6OB 5GMHA 4ECOA 4NZTM 5AWDA 4Z79A 5AWCA 3O6NA 2V9TB 3WPBA 3CIGA 1H6UA 4C2BB 1O6SA 3M18A 2Y5QA 4U7LA 1P8VA 3ULUA 4Z64C 5GMFA 4R6JA 3TSRE 4P8SA 4ECNA 2BNHA 4GT6A 3VQ2A 3ZYIA 4Q3GA 2UZYA 5IJCA 3WPCA 4MQWX 1OTOA 1O6VA 4U06A 3RFEA 2WQUA 2P1NB 5GQRK 2OMVA 4L3AA 2IFGA 4LI1A 1M0ZA 4Q3IA 4GLPA 3ULAA 2Z62A 4CNCA 1GWBA 4C2AB 4V2EA 5IJBA 3W3MA 2ELLA 4U09A 1OGQA 4WP6A 4XGOA 5D3IA 2Z81A 1DCEA 4LSXA 3C6PB 4U08A 4FS7A 1P9AG 3KJ4A 2O6QA 3G04C 2ASSB 3CVRA 3WN4A 3G3AA 4FD0A 4PQ8A 4AW4A 1WWLA 4FDWA 2ASTB 5B0TA 4RCAB 4V2CA 4LI2A 5HZLB 5IJDA 5CMNA 4J4LA 3GOZA 4QBZA 1FT8A 5GS0A 3PMHG 1M9LA 3UN9A 2WQWA 3M19A 4WYKA 3OJAA 4PSJA 3OGLB 4RWTC 3WPDA 1O6TA 2FT3A 3UL7A 2A0ZA 2WFHA 2WQXA 3RW6A 4LSXC 4ARRA 2OMYA 4R07A 1KOHA 3G06A 4R08A 3WPFA 2V70A 2CA6A 4BSRA 3G3BA 2V9SA 4QC0A 1ZIWA 4QXEA 3RGXA 4G8AA 4R6AA 3WPGA 4FCGA 4LSCA 3ZYOA 4Z61C 4R6FA 4RCWA 3VQ1A 4NKGA 3RJ0A 2P1PB 2OMTA 1A9NA 5B0NA 1OTNA 4R6GA 4LXSA 4P91A 1A4YA 4XSQA 4J0MA 2JQDA 1U0ND 3W3JA 1K5GC 1D0BA 4KT1A 4EZGA 5A5CA 3W3LA 3FXIA 2P1QB 4UFRA 2BEXA 1XEUA 2OMWA 5IYXC 4I6JB 4XOSA 3RFJA 5HDHA 3W3GA 3WPIA 5FTTB 1FS2A 3ULVA 1W8AA 4R0AA 1M10B 4R09A 3O53A 3JB9j 3ZYJA 1XECA 4M7EA 4L3FA 4B8CD 3REZA 5AWBA 1FO1A 1DFJI 5LFNA 1KOOA 1K5DC 4FHOA 3P72A 5CMPA 4Z8GA 4PEQB 5AZ5A 2Z65A 4AY9X 5B4PA 4KXFB 3RW7A 1M9SA 4CILA 4OQTA 4Q62A 1OOKG 4LXRA 4FMZA 3OGMB 4LSAA 1XCDA 4MN8B 1JL5A 3G39A 2Z66A 4BV4R 2UZXA 2Z63A 1QYYA 1Z7XW 3CIYA 2JE1A 3OJAB 3W3KA 4ARNA 1XKUA 3WPEA 2P1MB 4M7EC 4Z94G 2ID5A 4IM6A 1G9UA 2JE0A 3RFSA 4BSSA 1DS9A 2OMUA 2WQVA 2P1OB 4V2DA 1XWDC 4R5CA 3C6NB 3UL9A 4R5DA 4HQ1A 2Z82A 4CC4A 1LTXA 3DZEA 1YRGA 4Y61B 3ZYNA 3UL8A 1H6TA 1SQ0B 2O6RA 3E6JA 4H09A 2R9UA 4K17A 2RA8A 3BZ5A 4R58A 2Q4GW 1IO0A 4TZHA
chains in the Genus database with same CATH topology
4CNMA 1OTMA 4PERA 2OMZA 3E3ZA 1PGVA 1OZNA 2Z7XA 5GMGA 1P8TA 3RIZA 3WPHA 4PKIG 3W3NA 3E2JA 3A79B 3OGKB 3RGZA 4CP6A 2RR6A 2O6SA 2XOTA 3SB4A 4KNGA 3E4GA 4BSUA 1FQVA 2OMXA 2XWTC 4CC4C 5AWAA 2Z64A 4YEBB 2Z7XB 4NKHA 5GS2B 3C6OB 5GMHA 4ECOA 5AWDA 4Z79A 5AWCA 3O6NA 2V9TB 3WPBA 3CIGA 1H6UA 4C2BB 1O6SA 3M18A 2Y5QA 4U7LA 1P8VA 3ULUA 4Z64C 5GMFA 4R6JA 3TSRE 4P8SA 4ECNA 2BNHA 4GT6A 3VQ2A 3ZYIA 4Q3GA 2UZYA 5IJCA 3WPCA 4MQWX 1OTOA 1O6VA 4U06A 3RFEA 2WQUA 2P1NB 5GQRK 2OMVA 4L3AA 2IFGA 4LI1A 1M0ZA 4Q3IA 4GLPA 3ULAA 2Z62A 4CNCA 1GWBA 4C2AB 4V2EA 5IJBA 3W3MA 2ELLA 4U09A 1OGQA 4WP6A 4XGOA 5D3IA 2Z81A 1DCEA 4LSXA 3C6PB 4U08A 4FS7A 1P9AG 3KJ4A 2O6QA 3G04C 2ASSB 3CVRA 3WN4A 3G3AA 4FD0A 4PQ8A 4AW4A 1WWLA 4FDWA 2ASTB 5B0TA 4RCAB 4V2CA 4LI2A 5HZLB 5IJDA 5CMNA 4J4LA 3GOZA 4QBZA 1FT8A 5GS0A 3PMHG 1M9LA 3UN9A 2WQWA 3M19A 4WYKA 3OJAA 4PSJA 3OGLB 4RWTC 3WPDA 1O6TA 2FT3A 3UL7A 2A0ZA 2WFHA 2WQXA 3RW6A 4LSXC 4ARRA 2OMYA 4R07A 1KOHA 3G06A 4R08A 3WPFA 2V70A 2CA6A 4BSRA 3G3BA 2V9SA 4QC0A 1ZIWA 4QXEA 3RGXA 4G8AA 4R6AA 3WPGA 4FCGA 4LSCA 3ZYOA 4Z61C 4R6FA 4RCWA 3VQ1A 4NKGA 3RJ0A 2P1PB 2OMTA 1A9NA 5B0NA 1OTNA 4R6GA 4LXSA 4P91A 1A4YA 4XSQA 4J0MA 2JQDA 1U0ND 3W3JA 1K5GC 1D0BA 4KT1A 4EZGA 5A5CA 3W3LA 3FXIA 2P1QB 4UFRA 2BEXA 1XEUA 2OMWA 5IYXC 4I6JB 4XOSA 3RFJA 5HDHA 3W3GA 3WPIA 5FTTB 1FS2A 3ULVA 1W8AA 4R0AA 1M10B 4R09A 3O53A 3JB9j 3ZYJA 1XECA 4M7EA 4L3FA 4B8CD 3REZA 5AWBA 1FO1A 1DFJI 5LFNA 1KOOA 1K5DC 4FHOA 3P72A 5CMPA 4Z8GA 4PEQB 5AZ5A 2Z65A 4AY9X 5B4PA 4KXFB 3RW7A 1M9SA 4CILA 4OQTA 4Q62A 1OOKG 4LXRA 4FMZA 3OGMB 4LSAA 1XCDA 4MN8B 1JL5A 3G39A 2Z66A 4BV4R 2UZXA 2Z63A 1QYYA 1Z7XW 3CIYA 2JE1A 3OJAB 3W3KA 4ARNA 1XKUA 3WPEA 2P1MB 4M7EC 4Z94G 2ID5A 4IM6A 1G9UA 2JE0A 3RFSA 4BSSA 1DS9A 2OMUA 2WQVA 2P1OB 4V2DA 1XWDC 4R5CA 3C6NB 3UL9A 4R5DA 4HQ1A 2Z82A 4CC4A 1LTXA 3DZEA 1YRGA 4Y61B 3ZYNA 3UL8A 1H6TA 1SQ0B 2O6RA 3E6JA 4H09A 2R9UA 4K17A 2RA8A 3BZ5A 4R58A 2Q4GW 1IO0A 4TZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CNM A;  1OTM A;  4PER A;  2OMZ A;  3E3Z A;  1PGV A;  1OZN A;  2Z7X A;  5GMG A;  1P8T A;  3RIZ A;  3WPH A;  4PKI G;  3W3N A;  3E2J A;  3A79 B;  3OGK B;  3RGZ A;  4CP6 A;  2RR6 A;  2O6S A;  2XOT A;  3SB4 A;  4KNG A;  3E4G A;  4BSU A;  1FQV A;  2OMX A;  2XWT C;  4CC4 C;  5AWA A;  2Z64 A;  4YEB B;  2Z7X B;  4NKH A;  5GS2 B;  3C6O B;  5GMH A;  4ECO A;  5AWD A;  4Z79 A;  5AWC A;  3O6N A;  2V9T B;  3WPB A;  3CIG A;  1H6U A;  4C2B B;  1O6S A;  3M18 A;  2Y5Q A;  4U7L A;  1P8V A;  3ULU A;  4Z64 C;  5GMF A;  4R6J A;  3TSR E;  4P8S A;  4ECN A;  2BNH A;  4GT6 A;  3VQ2 A;  3ZYI A;  4Q3G A;  2UZY A;  5IJC A;  3WPC A;  4MQW X;  1OTO A;  1O6V A;  4U06 A;  3RFE A;  2WQU A;  2P1N B;  5GQR K;  2OMV A;  4L3A A;  2IFG A;  4LI1 A;  1M0Z A;  4Q3I A;  4GLP A;  3ULA A;  2Z62 A;  4CNC A;  1GWB A;  4C2A B;  4V2E A;  5IJB A;  3W3M A;  2ELL A;  4U09 A;  1OGQ A;  4WP6 A;  4XGO A;  5D3I A;  2Z81 A;  1DCE A;  4LSX A;  3C6P B;  4U08 A;  4FS7 A;  1P9A G;  3KJ4 A;  2O6Q A;  3G04 C;  2ASS B;  3CVR A;  3WN4 A;  3G3A A;  4FD0 A;  4PQ8 A;  4AW4 A;  1WWL A;  4FDW A;  2AST B;  5B0T A;  4RCA B;  4V2C A;  4LI2 A;  5HZL B;  5IJD A;  5CMN A;  4J4L A;  3GOZ A;  4QBZ A;  1FT8 A;  5GS0 A;  3PMH G;  1M9L A;  3UN9 A;  2WQW A;  3M19 A;  4WYK A;  3OJA A;  4PSJ A;  3OGL B;  4RWT C;  3WPD A;  1O6T A;  2FT3 A;  3UL7 A;  2A0Z A;  2WFH A;  2WQX A;  3RW6 A;  4LSX C;  4ARR A;  2OMY A;  4R07 A;  1KOH A;  3G06 A;  4R08 A;  3WPF A;  2V70 A;  2CA6 A;  4BSR A;  3G3B A;  2V9S A;  4QC0 A;  1ZIW A;  4QXE A;  3RGX A;  4G8A A;  4R6A A;  3WPG A;  4FCG A;  4LSC A;  3ZYO A;  4Z61 C;  4R6F A;  4RCW A;  3VQ1 A;  4NKG A;  3RJ0 A;  2P1P B;  2OMT A;  1A9N A;  5B0N A;  1OTN A;  4R6G A;  4LXS A;  4P91 A;  1A4Y A;  4XSQ A;  4J0M A;  2JQD A;  1U0N D;  3W3J A;  1K5G C;  1D0B A;  4KT1 A;  4EZG A;  5A5C A;  3W3L A;  3FXI A;  2P1Q B;  4UFR A;  2BEX A;  1XEU A;  2OMW A;  5IYX C;  4I6J B;  4XOS A;  3RFJ A;  5HDH A;  3W3G A;  3WPI A;  5FTT B;  1FS2 A;  3ULV A;  1W8A A;  4R0A A;  1M10 B;  4R09 A;  3O53 A;  3JB9 j;  3ZYJ A;  1XEC A;  4M7E A;  4L3F A;  4B8C D;  3REZ A;  5AWB A;  1FO1 A;  1DFJ I;  5LFN A;  1KOO A;  1K5D C;  4FHO A;  3P72 A;  5CMP A;  4Z8G A;  4PEQ B;  5AZ5 A;  2Z65 A;  4AY9 X;  5B4P A;  4KXF B;  3RW7 A;  1M9S A;  4CIL A;  4OQT A;  4Q62 A;  1OOK G;  4LXR A;  4FMZ A;  3OGM B;  4LSA A;  1XCD A;  4MN8 B;  1JL5 A;  3G39 A;  2Z66 A;  4BV4 R;  2UZX A;  2Z63 A;  1QYY A;  1Z7X W;  3CIY A;  2JE1 A;  3OJA B;  3W3K A;  4ARN A;  1XKU A;  3WPE A;  2P1M B;  4M7E C;  4Z94 G;  2ID5 A;  4IM6 A;  1G9U A;  2JE0 A;  3RFS A;  4BSS A;  1DS9 A;  2OMU A;  2WQV A;  2P1O B;  4V2D A;  1XWD C;  4R5C A;  3C6N B;  3UL9 A;  4R5D A;  4HQ1 A;  2Z82 A;  4CC4 A;  1LTX A;  3DZE A;  1YRG A;  4Y61 B;  3ZYN A;  3UL8 A;  1H6T A;  1SQ0 B;  2O6R A;  3E6J A;  4H09 A;  2R9U A;  4K17 A;  2RA8 A;  3BZ5 A;  4R58 A;  2Q4G W;  1IO0 A;  4TZH A; 
#chains in the Genus database with same CATH topology
 4CNM A;  1OTM A;  4PER A;  2OMZ A;  3E3Z A;  4NZR M;  1PGV A;  1OZN A;  2Z7X A;  5GMG A;  1P8T A;  3RIZ A;  3WPH A;  4PKI G;  3W3N A;  3E2J A;  3A79 B;  3OGK B;  3RGZ A;  4CP6 A;  2RR6 A;  2O6S A;  2XOT A;  3SB4 A;  4KNG A;  3E4G A;  4BSU A;  1FQV A;  2OMX A;  2XWT C;  4CC4 C;  5AWA A;  2Z64 A;  4YEB B;  2Z7X B;  4NKH A;  5GS2 B;  3C6O B;  5GMH A;  4ECO A;  4NZT M;  5AWD A;  4Z79 A;  5AWC A;  3O6N A;  2V9T B;  3WPB A;  3CIG A;  1H6U A;  4C2B B;  1O6S A;  3M18 A;  2Y5Q A;  4U7L A;  1P8V A;  3ULU A;  4Z64 C;  5GMF A;  4R6J A;  3TSR E;  4P8S A;  4ECN A;  2BNH A;  4GT6 A;  3VQ2 A;  3ZYI A;  4Q3G A;  2UZY A;  5IJC A;  3WPC A;  4MQW X;  1OTO A;  1O6V A;  4U06 A;  3RFE A;  2WQU A;  2P1N B;  5GQR K;  2OMV A;  4L3A A;  2IFG A;  4LI1 A;  1M0Z A;  4Q3I A;  4GLP A;  3ULA A;  2Z62 A;  4CNC A;  1GWB A;  4C2A B;  4V2E A;  5IJB A;  3W3M A;  2ELL A;  4U09 A;  1OGQ A;  4WP6 A;  4XGO A;  5D3I A;  2Z81 A;  1DCE A;  4LSX A;  3C6P B;  4U08 A;  4FS7 A;  1P9A G;  3KJ4 A;  2O6Q A;  3G04 C;  2ASS B;  3CVR A;  3WN4 A;  3G3A A;  4FD0 A;  4PQ8 A;  4AW4 A;  1WWL A;  4FDW A;  2AST B;  5B0T A;  4RCA B;  4V2C A;  4LI2 A;  5HZL B;  5IJD A;  5CMN A;  4J4L A;  3GOZ A;  4QBZ A;  1FT8 A;  5GS0 A;  3PMH G;  1M9L A;  3UN9 A;  2WQW A;  3M19 A;  4WYK A;  3OJA A;  4PSJ A;  3OGL B;  4RWT C;  3WPD A;  1O6T A;  2FT3 A;  3UL7 A;  2A0Z A;  2WFH A;  2WQX A;  3RW6 A;  4LSX C;  4ARR A;  2OMY A;  4R07 A;  1KOH A;  3G06 A;  4R08 A;  3WPF A;  2V70 A;  2CA6 A;  4BSR A;  3G3B A;  2V9S A;  4QC0 A;  1ZIW A;  4QXE A;  3RGX A;  4G8A A;  4R6A A;  3WPG A;  4FCG A;  4LSC A;  3ZYO A;  4Z61 C;  4R6F A;  4RCW A;  3VQ1 A;  4NKG A;  3RJ0 A;  2P1P B;  2OMT A;  1A9N A;  5B0N A;  1OTN A;  4R6G A;  4LXS A;  4P91 A;  1A4Y A;  4XSQ A;  4J0M A;  2JQD A;  1U0N D;  3W3J A;  1K5G C;  1D0B A;  4KT1 A;  4EZG A;  5A5C A;  3W3L A;  3FXI A;  2P1Q B;  4UFR A;  2BEX A;  1XEU A;  2OMW A;  5IYX C;  4I6J B;  4XOS A;  3RFJ A;  5HDH A;  3W3G A;  3WPI A;  5FTT B;  1FS2 A;  3ULV A;  1W8A A;  4R0A A;  1M10 B;  4R09 A;  3O53 A;  3JB9 j;  3ZYJ A;  1XEC A;  4M7E A;  4L3F A;  4B8C D;  3REZ A;  5AWB A;  1FO1 A;  1DFJ I;  5LFN A;  1KOO A;  1K5D C;  4FHO A;  3P72 A;  5CMP A;  4Z8G A;  4PEQ B;  5AZ5 A;  2Z65 A;  4AY9 X;  5B4P A;  4KXF B;  3RW7 A;  1M9S A;  4CIL A;  4OQT A;  4Q62 A;  1OOK G;  4LXR A;  4FMZ A;  3OGM B;  4LSA A;  1XCD A;  4MN8 B;  1JL5 A;  3G39 A;  2Z66 A;  4BV4 R;  2UZX A;  2Z63 A;  1QYY A;  1Z7X W;  3CIY A;  2JE1 A;  3OJA B;  3W3K A;  4ARN A;  1XKU A;  3WPE A;  2P1M B;  4M7E C;  4Z94 G;  2ID5 A;  4IM6 A;  1G9U A;  2JE0 A;  3RFS A;  4BSS A;  1DS9 A;  2OMU A;  2WQV A;  2P1O B;  4V2D A;  1XWD C;  4R5C A;  3C6N B;  3UL9 A;  4R5D A;  4HQ1 A;  2Z82 A;  4CC4 A;  1LTX A;  3DZE A;  1YRG A;  4Y61 B;  3ZYN A;  3UL8 A;  1H6T A;  1SQ0 B;  2O6R A;  3E6J A;  4H09 A;  2R9U A;  4K17 A;  2RA8 A;  3BZ5 A;  4R58 A;  2Q4G W;  1IO0 A;  4TZH A; 
#chains in the Genus database with same CATH homology
 4CNM A;  1OTM A;  4PER A;  2OMZ A;  3E3Z A;  1PGV A;  1OZN A;  2Z7X A;  5GMG A;  1P8T A;  3RIZ A;  3WPH A;  4PKI G;  3W3N A;  3E2J A;  3A79 B;  3OGK B;  3RGZ A;  4CP6 A;  2RR6 A;  2O6S A;  2XOT A;  3SB4 A;  4KNG A;  3E4G A;  4BSU A;  1FQV A;  2OMX A;  2XWT C;  4CC4 C;  5AWA A;  2Z64 A;  4YEB B;  2Z7X B;  4NKH A;  5GS2 B;  3C6O B;  5GMH A;  4ECO A;  5AWD A;  4Z79 A;  5AWC A;  3O6N A;  2V9T B;  3WPB A;  3CIG A;  1H6U A;  4C2B B;  1O6S A;  3M18 A;  2Y5Q A;  4U7L A;  1P8V A;  3ULU A;  4Z64 C;  5GMF A;  4R6J A;  3TSR E;  4P8S A;  4ECN A;  2BNH A;  4GT6 A;  3VQ2 A;  3ZYI A;  4Q3G A;  2UZY A;  5IJC A;  3WPC A;  4MQW X;  1OTO A;  1O6V A;  4U06 A;  3RFE A;  2WQU A;  2P1N B;  5GQR K;  2OMV A;  4L3A A;  2IFG A;  4LI1 A;  1M0Z A;  4Q3I A;  4GLP A;  3ULA A;  2Z62 A;  4CNC A;  1GWB A;  4C2A B;  4V2E A;  5IJB A;  3W3M A;  2ELL A;  4U09 A;  1OGQ A;  4WP6 A;  4XGO A;  5D3I A;  2Z81 A;  1DCE A;  4LSX A;  3C6P B;  4U08 A;  4FS7 A;  1P9A G;  3KJ4 A;  2O6Q A;  3G04 C;  2ASS B;  3CVR A;  3WN4 A;  3G3A A;  4FD0 A;  4PQ8 A;  4AW4 A;  1WWL A;  4FDW A;  2AST B;  5B0T A;  4RCA B;  4V2C A;  4LI2 A;  5HZL B;  5IJD A;  5CMN A;  4J4L A;  3GOZ A;  4QBZ A;  1FT8 A;  5GS0 A;  3PMH G;  1M9L A;  3UN9 A;  2WQW A;  3M19 A;  4WYK A;  3OJA A;  4PSJ A;  3OGL B;  4RWT C;  3WPD A;  1O6T A;  2FT3 A;  3UL7 A;  2A0Z A;  2WFH A;  2WQX A;  3RW6 A;  4LSX C;  4ARR A;  2OMY A;  4R07 A;  1KOH A;  3G06 A;  4R08 A;  3WPF A;  2V70 A;  2CA6 A;  4BSR A;  3G3B A;  2V9S A;  4QC0 A;  1ZIW A;  4QXE A;  3RGX A;  4G8A A;  4R6A A;  3WPG A;  4FCG A;  4LSC A;  3ZYO A;  4Z61 C;  4R6F A;  4RCW A;  3VQ1 A;  4NKG A;  3RJ0 A;  2P1P B;  2OMT A;  1A9N A;  5B0N A;  1OTN A;  4R6G A;  4LXS A;  4P91 A;  1A4Y A;  4XSQ A;  4J0M A;  2JQD A;  1U0N D;  3W3J A;  1K5G C;  1D0B A;  4KT1 A;  4EZG A;  5A5C A;  3W3L A;  3FXI A;  2P1Q B;  4UFR A;  2BEX A;  1XEU A;  2OMW A;  5IYX C;  4I6J B;  4XOS A;  3RFJ A;  5HDH A;  3W3G A;  3WPI A;  5FTT B;  1FS2 A;  3ULV A;  1W8A A;  4R0A A;  1M10 B;  4R09 A;  3O53 A;  3JB9 j;  3ZYJ A;  1XEC A;  4M7E A;  4L3F A;  4B8C D;  3REZ A;  5AWB A;  1FO1 A;  1DFJ I;  5LFN A;  1KOO A;  1K5D C;  4FHO A;  3P72 A;  5CMP A;  4Z8G A;  4PEQ B;  5AZ5 A;  2Z65 A;  4AY9 X;  5B4P A;  4KXF B;  3RW7 A;  1M9S A;  4CIL A;  4OQT A;  4Q62 A;  1OOK G;  4LXR A;  4FMZ A;  3OGM B;  4LSA A;  1XCD A;  4MN8 B;  1JL5 A;  3G39 A;  2Z66 A;  4BV4 R;  2UZX A;  2Z63 A;  1QYY A;  1Z7X W;  3CIY A;  2JE1 A;  3OJA B;  3W3K A;  4ARN A;  1XKU A;  3WPE A;  2P1M B;  4M7E C;  4Z94 G;  2ID5 A;  4IM6 A;  1G9U A;  2JE0 A;  3RFS A;  4BSS A;  1DS9 A;  2OMU A;  2WQV A;  2P1O B;  4V2D A;  1XWD C;  4R5C A;  3C6N B;  3UL9 A;  4R5D A;  4HQ1 A;  2Z82 A;  4CC4 A;  1LTX A;  3DZE A;  1YRG A;  4Y61 B;  3ZYN A;  3UL8 A;  1H6T A;  1SQ0 B;  2O6R A;  3E6J A;  4H09 A;  2R9U A;  4K17 A;  2RA8 A;  3BZ5 A;  4R58 A;  2Q4G W;  1IO0 A;  4TZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...