3O6NA

Crystal structure of apl1 leucine-rich repeat domain
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
378
Chain Sequence
QPEYKCIDCVFYDVHIDMQTQDVYFGFEDITLNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLVLERNDLSSLPRGIFHNTPKLTTLSMSNNNLERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAIPIAVEELDASHNSINVVRGPVNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISNNRLVALNLYGQPIPTLKVLDLSHNHLLHVERNQPQFDRLENLYLDHNSIVTLKLSTHHTLKNLTLSHNDWDCNSLRALFRNVARPAVDDADQHCKIDYQLEHGLCCKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Protein binding
molecule keywords APL1
total genus 140
structure length 378
sequence length 384
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3o6nA00
1M10B 3VQ2A 1D0BA 3WPDA 3BZ5A 2Z64A 3O6NA 3OJAA 4NKGA 4OQTA 4Q3IA 4QXEA 4U7LA 4XOSA 3RFEA 4Q3GA 2Y5QA 4GLPA 2IFGA 3OJAB 2Z63A 1O6VA 3PMHG 2FT3A 3GOZA 3UL8A 3KJ4A 4NKHA 2ID5A 3C6OB 2Z65A 3CIGA 1P9AG 2OMWA 2BEXA 3C6PB 1OTOA 2P1OB 3E6JA 3G39A 4Z94G 1DCEA 2CA6A 5IJBA 1G9UA 3WN4A 3ULAA 3RGXA 2ASSB 2Z62A 4UFRA 1FS2A 4XSQA 2WQXA 4FMZA 5GMHA 4FHOA 2WQUA 4J4LA 3ZYJA 2P1NB 1XCDA 3W3JA 4BSSA 3G3BA 4P91A 5HZLB 2P1PB 4K17A 4YEBB 4RCAB 4U09A 5IYXC 4ECNA 1M9SA 5GS2B 5HDHA 3RFSA 3OGKB 3JB9j 3G3AA 2Z66A 5CMPA 1FQVA 3OGLB 4I6JB 4LXSA 1OZNA 3E2JA 4LI2A 5IJCA 4PKIG 4R5CA 2WQVA 2Z82A 3VQ1A 3W3NA 1XEUA 4IM6A 2JQDA 2Z7XB 4WP6A 4LSXC 3W3LA 1DS9A 5FTTB 4BSRA 4BV4R 5GS0A 2Z81A 4LSAA 1FT8A 1M0ZA 1WWLA 1W8AA 4PSJA 3G04C 4U06A 2XOTA 4V2CA 4H09A 5IJDA 3ULUA 2V70A 4PERA 3P72A 4R6AA 2Q4GW 4CNCA 1M9LA 4U08A 1ZIWA 3WPCA 4EZGA 4G8AA 2XWTC 1XWDC 2O6QA 3M18A 1P8TA 4R6GA 5GQRK 4AY9X 3W3MA 1LTXA 2P1QB 2WFHA 1FO1A 3RFJA 2OMTA 4R09A 4FD0A 2OMXA 3E3ZA 3RW6A 1OTNA 1K5GC 4LI1A 3RJ0A 1GWBA 2RR6A 3UN9A 2V9SA 4PQ8A 3WPFA 3O53A 2OMVA 4CC4A 4CP6A 4Z79A 2A0ZA 3RW7A 5GMGA 1JL5A 3SB4A 3REZA 4CNMA 2R9UA 3ULVA 3WPHA 1H6UA 3ZYIA 2ELLA 4TZHA 4Z61C 1O6TA 1KOHA 4FDWA 4KXFB 5AWCA 2UZYA 4R6FA 5B4PA 2O6RA 4J0MA 3WPBA 4LSXA 1SQ0B 2JE1A 3DZEA 4L3FA 4B8CD 4LSCA 2P1MB 1O6SA 4RWTC 3ZYOA 2OMUA 4ECOA 2O6SA 3C6NB 3FXIA 1U0ND 2OMYA 4R5DA 4V2DA 5GMFA 1KOOA 4FS7A 4ARNA 4LXRA 5LFNA 4WYKA 1QYYA 4CILA 1DFJI 3WPIA 1A4YA 1Z7XW 1A9NA 2OMZA 3A79B 3UL9A 4R07A 5D3IA 3W3KA 4M7EC 4R08A 4R0AA 4L3AA 1K5DC 4R6JA 5A5CA 1P8VA 3M19A 4MN8B 4AW4A 5AZ5A 2RA8A 4Z64C 2BNHA 5B0NA 5AWAA 3ZYNA 4QC0A 4HQ1A 3WPEA 4R58A 4FCGA 1YRGA 3E4GA 4Y61B 4GT6A 1PGVA 1XECA 1OTMA 2WQWA 4C2BB 4M7EA 5AWBA 2V9TB 4BSUA 4CC4C 5CMNA 1OOKG 4Z8GA 4ARRA 4QBZA 4MQWX 4V2EA 3W3GA 4Q62A 3OGMB 5AWDA 2ASTB 1XKUA 4P8SA 3RIZA 3WPGA 1OGQA 1H6TA 4KNGA 4KT1A 2JE0A 2Z7XA 4PEQB 3CVRA 4RCWA 4XGOA 5B0TA 3UL7A 4C2AB 3CIYA 2UZXA 1IO0A 3RGZA 3G06A 3TSRE
chains in the Genus database with same CATH superfamily
1M10B 3VQ2A 1D0BA 3WPDA 3BZ5A 2Z64A 3O6NA 3OJAA 4NKGA 4OQTA 4Q3IA 4QXEA 4U7LA 4XOSA 3RFEA 4Q3GA 2Y5QA 4GLPA 2IFGA 3OJAB 2Z63A 1O6VA 3PMHG 2FT3A 3GOZA 3UL8A 3KJ4A 4NKHA 4NZRM 2ID5A 3C6OB 2Z65A 3CIGA 1P9AG 2OMWA 2BEXA 3C6PB 1OTOA 2P1OB 3E6JA 3G39A 4Z94G 1DCEA 2CA6A 5IJBA 1G9UA 3WN4A 3ULAA 3RGXA 2ASSB 2Z62A 4UFRA 1FS2A 4XSQA 2WQXA 4FMZA 5GMHA 4FHOA 2WQUA 4J4LA 3ZYJA 2P1NB 1XCDA 3W3JA 4BSSA 3G3BA 4P91A 5HZLB 2P1PB 4K17A 4YEBB 4RCAB 4U09A 5IYXC 4ECNA 1M9SA 5GS2B 5HDHA 3RFSA 3OGKB 3JB9j 3G3AA 2Z66A 5CMPA 1FQVA 3OGLB 4I6JB 4LXSA 1OZNA 3E2JA 4LI2A 5IJCA 4PKIG 4R5CA 2WQVA 2Z82A 3VQ1A 3W3NA 1XEUA 4IM6A 2JQDA 2Z7XB 4WP6A 4LSXC 3W3LA 1DS9A 5FTTB 4BSRA 4BV4R 5GS0A 2Z81A 4LSAA 1FT8A 1M0ZA 1WWLA 1W8AA 4PSJA 3G04C 4U06A 2XOTA 4V2CA 4H09A 5IJDA 3ULUA 2V70A 4PERA 3P72A 4R6AA 2Q4GW 4CNCA 1M9LA 4U08A 1ZIWA 3WPCA 4EZGA 4G8AA 2XWTC 1XWDC 2O6QA 3M18A 1P8TA 4R6GA 5GQRK 4AY9X 3W3MA 1LTXA 2P1QB 2WFHA 1FO1A 3RFJA 2OMTA 4R09A 4FD0A 2OMXA 3E3ZA 3RW6A 1OTNA 1K5GC 4LI1A 3RJ0A 1GWBA 2RR6A 3UN9A 2V9SA 4PQ8A 3WPFA 3O53A 2OMVA 4CC4A 4CP6A 4Z79A 2A0ZA 3RW7A 5GMGA 1JL5A 3SB4A 3REZA 4CNMA 2R9UA 3ULVA 3WPHA 1H6UA 3ZYIA 2ELLA 4NZTM 4TZHA 4Z61C 1O6TA 1KOHA 4FDWA 4KXFB 5AWCA 2UZYA 4R6FA 5B4PA 2O6RA 4J0MA 3WPBA 4LSXA 1SQ0B 2JE1A 3DZEA 4L3FA 4B8CD 4LSCA 2P1MB 1O6SA 4RWTC 3ZYOA 2OMUA 4ECOA 2O6SA 3C6NB 3FXIA 1U0ND 2OMYA 4R5DA 4V2DA 5GMFA 1KOOA 4FS7A 4ARNA 4LXRA 5LFNA 4WYKA 1QYYA 4CILA 1DFJI 3WPIA 1A4YA 1Z7XW 1A9NA 2OMZA 3A79B 3UL9A 4R07A 5D3IA 3W3KA 4M7EC 4R08A 4R0AA 4L3AA 1K5DC 4R6JA 5A5CA 1P8VA 3M19A 4MN8B 4AW4A 5AZ5A 2RA8A 4Z64C 2BNHA 5B0NA 5AWAA 3ZYNA 4QC0A 4HQ1A 3WPEA 4R58A 4FCGA 1YRGA 3E4GA 4Y61B 4GT6A 1PGVA 1XECA 1OTMA 2WQWA 4C2BB 4M7EA 5AWBA 2V9TB 4BSUA 4CC4C 5CMNA 1OOKG 4Z8GA 4ARRA 4QBZA 4MQWX 4V2EA 3W3GA 4Q62A 3OGMB 5AWDA 2ASTB 1XKUA 4P8SA 3RIZA 3WPGA 1OGQA 1H6TA 4KNGA 4KT1A 2JE0A 2Z7XA 4PEQB 3CVRA 4RCWA 4XGOA 5B0TA 3UL7A 4C2AB 3CIYA 2UZXA 1IO0A 3RGZA 3G06A 3TSRE
chains in the Genus database with same CATH topology
1M10B 3VQ2A 1D0BA 3WPDA 3BZ5A 2Z64A 3O6NA 3OJAA 4NKGA 4OQTA 4Q3IA 4QXEA 4U7LA 4XOSA 3RFEA 4Q3GA 2Y5QA 4GLPA 2IFGA 3OJAB 2Z63A 1O6VA 3PMHG 2FT3A 3GOZA 3UL8A 3KJ4A 4NKHA 2ID5A 3C6OB 2Z65A 3CIGA 1P9AG 2OMWA 2BEXA 3C6PB 1OTOA 2P1OB 3E6JA 3G39A 4Z94G 1DCEA 2CA6A 5IJBA 1G9UA 3WN4A 3ULAA 3RGXA 2ASSB 2Z62A 4UFRA 1FS2A 4XSQA 2WQXA 4FMZA 5GMHA 4FHOA 2WQUA 4J4LA 3ZYJA 2P1NB 1XCDA 3W3JA 4BSSA 3G3BA 4P91A 5HZLB 2P1PB 4K17A 4YEBB 4RCAB 4U09A 5IYXC 4ECNA 1M9SA 5GS2B 5HDHA 3RFSA 3OGKB 3JB9j 3G3AA 2Z66A 5CMPA 1FQVA 3OGLB 4I6JB 4LXSA 1OZNA 3E2JA 4LI2A 5IJCA 4PKIG 4R5CA 2WQVA 2Z82A 3VQ1A 3W3NA 1XEUA 4IM6A 2JQDA 2Z7XB 4WP6A 4LSXC 3W3LA 1DS9A 5FTTB 4BSRA 4BV4R 5GS0A 2Z81A 4LSAA 1FT8A 1M0ZA 1WWLA 1W8AA 4PSJA 3G04C 4U06A 2XOTA 4V2CA 4H09A 5IJDA 3ULUA 2V70A 4PERA 3P72A 4R6AA 2Q4GW 4CNCA 1M9LA 4U08A 1ZIWA 3WPCA 4EZGA 4G8AA 2XWTC 1XWDC 2O6QA 3M18A 1P8TA 4R6GA 5GQRK 4AY9X 3W3MA 1LTXA 2P1QB 2WFHA 1FO1A 3RFJA 2OMTA 4R09A 4FD0A 2OMXA 3E3ZA 3RW6A 1OTNA 1K5GC 4LI1A 3RJ0A 1GWBA 2RR6A 3UN9A 2V9SA 4PQ8A 3WPFA 3O53A 2OMVA 4CC4A 4CP6A 4Z79A 2A0ZA 3RW7A 5GMGA 1JL5A 3SB4A 3REZA 4CNMA 2R9UA 3ULVA 3WPHA 1H6UA 3ZYIA 2ELLA 4TZHA 4Z61C 1O6TA 1KOHA 4FDWA 4KXFB 5AWCA 2UZYA 4R6FA 5B4PA 2O6RA 4J0MA 3WPBA 4LSXA 1SQ0B 2JE1A 3DZEA 4L3FA 4B8CD 4LSCA 2P1MB 1O6SA 4RWTC 3ZYOA 2OMUA 4ECOA 2O6SA 3C6NB 3FXIA 1U0ND 2OMYA 4R5DA 4V2DA 5GMFA 1KOOA 4FS7A 4ARNA 4LXRA 5LFNA 4WYKA 1QYYA 4CILA 1DFJI 3WPIA 1A4YA 1Z7XW 1A9NA 2OMZA 3A79B 3UL9A 4R07A 5D3IA 3W3KA 4M7EC 4R08A 4R0AA 4L3AA 1K5DC 4R6JA 5A5CA 1P8VA 3M19A 4MN8B 4AW4A 5AZ5A 2RA8A 4Z64C 2BNHA 5B0NA 5AWAA 3ZYNA 4QC0A 4HQ1A 3WPEA 4R58A 4FCGA 1YRGA 3E4GA 4Y61B 4GT6A 1PGVA 1XECA 1OTMA 2WQWA 4C2BB 4M7EA 5AWBA 2V9TB 4BSUA 4CC4C 5CMNA 1OOKG 4Z8GA 4ARRA 4QBZA 4MQWX 4V2EA 3W3GA 4Q62A 3OGMB 5AWDA 2ASTB 1XKUA 4P8SA 3RIZA 3WPGA 1OGQA 1H6TA 4KNGA 4KT1A 2JE0A 2Z7XA 4PEQB 3CVRA 4RCWA 4XGOA 5B0TA 3UL7A 4C2AB 3CIYA 2UZXA 1IO0A 3RGZA 3G06A 3TSRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M10 B;  3VQ2 A;  1D0B A;  3WPD A;  3BZ5 A;  2Z64 A;  3O6N A;  3OJA A;  4NKG A;  4OQT A;  4Q3I A;  4QXE A;  4U7L A;  4XOS A;  3RFE A;  4Q3G A;  2Y5Q A;  4GLP A;  2IFG A;  3OJA B;  2Z63 A;  1O6V A;  3PMH G;  2FT3 A;  3GOZ A;  3UL8 A;  3KJ4 A;  4NKH A;  2ID5 A;  3C6O B;  2Z65 A;  3CIG A;  1P9A G;  2OMW A;  2BEX A;  3C6P B;  1OTO A;  2P1O B;  3E6J A;  3G39 A;  4Z94 G;  1DCE A;  2CA6 A;  5IJB A;  1G9U A;  3WN4 A;  3ULA A;  3RGX A;  2ASS B;  2Z62 A;  4UFR A;  1FS2 A;  4XSQ A;  2WQX A;  4FMZ A;  5GMH A;  4FHO A;  2WQU A;  4J4L A;  3ZYJ A;  2P1N B;  1XCD A;  3W3J A;  4BSS A;  3G3B A;  4P91 A;  5HZL B;  2P1P B;  4K17 A;  4YEB B;  4RCA B;  4U09 A;  5IYX C;  4ECN A;  1M9S A;  5GS2 B;  5HDH A;  3RFS A;  3OGK B;  3JB9 j;  3G3A A;  2Z66 A;  5CMP A;  1FQV A;  3OGL B;  4I6J B;  4LXS A;  1OZN A;  3E2J A;  4LI2 A;  5IJC A;  4PKI G;  4R5C A;  2WQV A;  2Z82 A;  3VQ1 A;  3W3N A;  1XEU A;  4IM6 A;  2JQD A;  2Z7X B;  4WP6 A;  4LSX C;  3W3L A;  1DS9 A;  5FTT B;  4BSR A;  4BV4 R;  5GS0 A;  2Z81 A;  4LSA A;  1FT8 A;  1M0Z A;  1WWL A;  1W8A A;  4PSJ A;  3G04 C;  4U06 A;  2XOT A;  4V2C A;  4H09 A;  5IJD A;  3ULU A;  2V70 A;  4PER A;  3P72 A;  4R6A A;  2Q4G W;  4CNC A;  1M9L A;  4U08 A;  1ZIW A;  3WPC A;  4EZG A;  4G8A A;  2XWT C;  1XWD C;  2O6Q A;  3M18 A;  1P8T A;  4R6G A;  5GQR K;  4AY9 X;  3W3M A;  1LTX A;  2P1Q B;  2WFH A;  1FO1 A;  3RFJ A;  2OMT A;  4R09 A;  4FD0 A;  2OMX A;  3E3Z A;  3RW6 A;  1OTN A;  1K5G C;  4LI1 A;  3RJ0 A;  1GWB A;  2RR6 A;  3UN9 A;  2V9S A;  4PQ8 A;  3WPF A;  3O53 A;  2OMV A;  4CC4 A;  4CP6 A;  4Z79 A;  2A0Z A;  3RW7 A;  5GMG A;  1JL5 A;  3SB4 A;  3REZ A;  4CNM A;  2R9U A;  3ULV A;  3WPH A;  1H6U A;  3ZYI A;  2ELL A;  4TZH A;  4Z61 C;  1O6T A;  1KOH A;  4FDW A;  4KXF B;  5AWC A;  2UZY A;  4R6F A;  5B4P A;  2O6R A;  4J0M A;  3WPB A;  4LSX A;  1SQ0 B;  2JE1 A;  3DZE A;  4L3F A;  4B8C D;  4LSC A;  2P1M B;  1O6S A;  4RWT C;  3ZYO A;  2OMU A;  4ECO A;  2O6S A;  3C6N B;  3FXI A;  1U0N D;  2OMY A;  4R5D A;  4V2D A;  5GMF A;  1KOO A;  4FS7 A;  4ARN A;  4LXR A;  5LFN A;  4WYK A;  1QYY A;  4CIL A;  1DFJ I;  3WPI A;  1A4Y A;  1Z7X W;  1A9N A;  2OMZ A;  3A79 B;  3UL9 A;  4R07 A;  5D3I A;  3W3K A;  4M7E C;  4R08 A;  4R0A A;  4L3A A;  1K5D C;  4R6J A;  5A5C A;  1P8V A;  3M19 A;  4MN8 B;  4AW4 A;  5AZ5 A;  2RA8 A;  4Z64 C;  2BNH A;  5B0N A;  5AWA A;  3ZYN A;  4QC0 A;  4HQ1 A;  3WPE A;  4R58 A;  4FCG A;  1YRG A;  3E4G A;  4Y61 B;  4GT6 A;  1PGV A;  1XEC A;  1OTM A;  2WQW A;  4C2B B;  4M7E A;  5AWB A;  2V9T B;  4BSU A;  4CC4 C;  5CMN A;  1OOK G;  4Z8G A;  4ARR A;  4QBZ A;  4MQW X;  4V2E A;  3W3G A;  4Q62 A;  3OGM B;  5AWD A;  2AST B;  1XKU A;  4P8S A;  3RIZ A;  3WPG A;  1OGQ A;  1H6T A;  4KNG A;  4KT1 A;  2JE0 A;  2Z7X A;  4PEQ B;  3CVR A;  4RCW A;  4XGO A;  5B0T A;  3UL7 A;  4C2A B;  3CIY A;  2UZX A;  1IO0 A;  3RGZ A;  3G06 A;  3TSR E; 
#chains in the Genus database with same CATH topology
 1M10 B;  3VQ2 A;  1D0B A;  3WPD A;  3BZ5 A;  2Z64 A;  3O6N A;  3OJA A;  4NKG A;  4OQT A;  4Q3I A;  4QXE A;  4U7L A;  4XOS A;  3RFE A;  4Q3G A;  2Y5Q A;  4GLP A;  2IFG A;  3OJA B;  2Z63 A;  1O6V A;  3PMH G;  2FT3 A;  3GOZ A;  3UL8 A;  3KJ4 A;  4NKH A;  4NZR M;  2ID5 A;  3C6O B;  2Z65 A;  3CIG A;  1P9A G;  2OMW A;  2BEX A;  3C6P B;  1OTO A;  2P1O B;  3E6J A;  3G39 A;  4Z94 G;  1DCE A;  2CA6 A;  5IJB A;  1G9U A;  3WN4 A;  3ULA A;  3RGX A;  2ASS B;  2Z62 A;  4UFR A;  1FS2 A;  4XSQ A;  2WQX A;  4FMZ A;  5GMH A;  4FHO A;  2WQU A;  4J4L A;  3ZYJ A;  2P1N B;  1XCD A;  3W3J A;  4BSS A;  3G3B A;  4P91 A;  5HZL B;  2P1P B;  4K17 A;  4YEB B;  4RCA B;  4U09 A;  5IYX C;  4ECN A;  1M9S A;  5GS2 B;  5HDH A;  3RFS A;  3OGK B;  3JB9 j;  3G3A A;  2Z66 A;  5CMP A;  1FQV A;  3OGL B;  4I6J B;  4LXS A;  1OZN A;  3E2J A;  4LI2 A;  5IJC A;  4PKI G;  4R5C A;  2WQV A;  2Z82 A;  3VQ1 A;  3W3N A;  1XEU A;  4IM6 A;  2JQD A;  2Z7X B;  4WP6 A;  4LSX C;  3W3L A;  1DS9 A;  5FTT B;  4BSR A;  4BV4 R;  5GS0 A;  2Z81 A;  4LSA A;  1FT8 A;  1M0Z A;  1WWL A;  1W8A A;  4PSJ A;  3G04 C;  4U06 A;  2XOT A;  4V2C A;  4H09 A;  5IJD A;  3ULU A;  2V70 A;  4PER A;  3P72 A;  4R6A A;  2Q4G W;  4CNC A;  1M9L A;  4U08 A;  1ZIW A;  3WPC A;  4EZG A;  4G8A A;  2XWT C;  1XWD C;  2O6Q A;  3M18 A;  1P8T A;  4R6G A;  5GQR K;  4AY9 X;  3W3M A;  1LTX A;  2P1Q B;  2WFH A;  1FO1 A;  3RFJ A;  2OMT A;  4R09 A;  4FD0 A;  2OMX A;  3E3Z A;  3RW6 A;  1OTN A;  1K5G C;  4LI1 A;  3RJ0 A;  1GWB A;  2RR6 A;  3UN9 A;  2V9S A;  4PQ8 A;  3WPF A;  3O53 A;  2OMV A;  4CC4 A;  4CP6 A;  4Z79 A;  2A0Z A;  3RW7 A;  5GMG A;  1JL5 A;  3SB4 A;  3REZ A;  4CNM A;  2R9U A;  3ULV A;  3WPH A;  1H6U A;  3ZYI A;  2ELL A;  4NZT M;  4TZH A;  4Z61 C;  1O6T A;  1KOH A;  4FDW A;  4KXF B;  5AWC A;  2UZY A;  4R6F A;  5B4P A;  2O6R A;  4J0M A;  3WPB A;  4LSX A;  1SQ0 B;  2JE1 A;  3DZE A;  4L3F A;  4B8C D;  4LSC A;  2P1M B;  1O6S A;  4RWT C;  3ZYO A;  2OMU A;  4ECO A;  2O6S A;  3C6N B;  3FXI A;  1U0N D;  2OMY A;  4R5D A;  4V2D A;  5GMF A;  1KOO A;  4FS7 A;  4ARN A;  4LXR A;  5LFN A;  4WYK A;  1QYY A;  4CIL A;  1DFJ I;  3WPI A;  1A4Y A;  1Z7X W;  1A9N A;  2OMZ A;  3A79 B;  3UL9 A;  4R07 A;  5D3I A;  3W3K A;  4M7E C;  4R08 A;  4R0A A;  4L3A A;  1K5D C;  4R6J A;  5A5C A;  1P8V A;  3M19 A;  4MN8 B;  4AW4 A;  5AZ5 A;  2RA8 A;  4Z64 C;  2BNH A;  5B0N A;  5AWA A;  3ZYN A;  4QC0 A;  4HQ1 A;  3WPE A;  4R58 A;  4FCG A;  1YRG A;  3E4G A;  4Y61 B;  4GT6 A;  1PGV A;  1XEC A;  1OTM A;  2WQW A;  4C2B B;  4M7E A;  5AWB A;  2V9T B;  4BSU A;  4CC4 C;  5CMN A;  1OOK G;  4Z8G A;  4ARR A;  4QBZ A;  4MQW X;  4V2E A;  3W3G A;  4Q62 A;  3OGM B;  5AWD A;  2AST B;  1XKU A;  4P8S A;  3RIZ A;  3WPG A;  1OGQ A;  1H6T A;  4KNG A;  4KT1 A;  2JE0 A;  2Z7X A;  4PEQ B;  3CVR A;  4RCW A;  4XGO A;  5B0T A;  3UL7 A;  4C2A B;  3CIY A;  2UZX A;  1IO0 A;  3RGZ A;  3G06 A;  3TSR E; 
#chains in the Genus database with same CATH homology
 1M10 B;  3VQ2 A;  1D0B A;  3WPD A;  3BZ5 A;  2Z64 A;  3O6N A;  3OJA A;  4NKG A;  4OQT A;  4Q3I A;  4QXE A;  4U7L A;  4XOS A;  3RFE A;  4Q3G A;  2Y5Q A;  4GLP A;  2IFG A;  3OJA B;  2Z63 A;  1O6V A;  3PMH G;  2FT3 A;  3GOZ A;  3UL8 A;  3KJ4 A;  4NKH A;  2ID5 A;  3C6O B;  2Z65 A;  3CIG A;  1P9A G;  2OMW A;  2BEX A;  3C6P B;  1OTO A;  2P1O B;  3E6J A;  3G39 A;  4Z94 G;  1DCE A;  2CA6 A;  5IJB A;  1G9U A;  3WN4 A;  3ULA A;  3RGX A;  2ASS B;  2Z62 A;  4UFR A;  1FS2 A;  4XSQ A;  2WQX A;  4FMZ A;  5GMH A;  4FHO A;  2WQU A;  4J4L A;  3ZYJ A;  2P1N B;  1XCD A;  3W3J A;  4BSS A;  3G3B A;  4P91 A;  5HZL B;  2P1P B;  4K17 A;  4YEB B;  4RCA B;  4U09 A;  5IYX C;  4ECN A;  1M9S A;  5GS2 B;  5HDH A;  3RFS A;  3OGK B;  3JB9 j;  3G3A A;  2Z66 A;  5CMP A;  1FQV A;  3OGL B;  4I6J B;  4LXS A;  1OZN A;  3E2J A;  4LI2 A;  5IJC A;  4PKI G;  4R5C A;  2WQV A;  2Z82 A;  3VQ1 A;  3W3N A;  1XEU A;  4IM6 A;  2JQD A;  2Z7X B;  4WP6 A;  4LSX C;  3W3L A;  1DS9 A;  5FTT B;  4BSR A;  4BV4 R;  5GS0 A;  2Z81 A;  4LSA A;  1FT8 A;  1M0Z A;  1WWL A;  1W8A A;  4PSJ A;  3G04 C;  4U06 A;  2XOT A;  4V2C A;  4H09 A;  5IJD A;  3ULU A;  2V70 A;  4PER A;  3P72 A;  4R6A A;  2Q4G W;  4CNC A;  1M9L A;  4U08 A;  1ZIW A;  3WPC A;  4EZG A;  4G8A A;  2XWT C;  1XWD C;  2O6Q A;  3M18 A;  1P8T A;  4R6G A;  5GQR K;  4AY9 X;  3W3M A;  1LTX A;  2P1Q B;  2WFH A;  1FO1 A;  3RFJ A;  2OMT A;  4R09 A;  4FD0 A;  2OMX A;  3E3Z A;  3RW6 A;  1OTN A;  1K5G C;  4LI1 A;  3RJ0 A;  1GWB A;  2RR6 A;  3UN9 A;  2V9S A;  4PQ8 A;  3WPF A;  3O53 A;  2OMV A;  4CC4 A;  4CP6 A;  4Z79 A;  2A0Z A;  3RW7 A;  5GMG A;  1JL5 A;  3SB4 A;  3REZ A;  4CNM A;  2R9U A;  3ULV A;  3WPH A;  1H6U A;  3ZYI A;  2ELL A;  4TZH A;  4Z61 C;  1O6T A;  1KOH A;  4FDW A;  4KXF B;  5AWC A;  2UZY A;  4R6F A;  5B4P A;  2O6R A;  4J0M A;  3WPB A;  4LSX A;  1SQ0 B;  2JE1 A;  3DZE A;  4L3F A;  4B8C D;  4LSC A;  2P1M B;  1O6S A;  4RWT C;  3ZYO A;  2OMU A;  4ECO A;  2O6S A;  3C6N B;  3FXI A;  1U0N D;  2OMY A;  4R5D A;  4V2D A;  5GMF A;  1KOO A;  4FS7 A;  4ARN A;  4LXR A;  5LFN A;  4WYK A;  1QYY A;  4CIL A;  1DFJ I;  3WPI A;  1A4Y A;  1Z7X W;  1A9N A;  2OMZ A;  3A79 B;  3UL9 A;  4R07 A;  5D3I A;  3W3K A;  4M7E C;  4R08 A;  4R0A A;  4L3A A;  1K5D C;  4R6J A;  5A5C A;  1P8V A;  3M19 A;  4MN8 B;  4AW4 A;  5AZ5 A;  2RA8 A;  4Z64 C;  2BNH A;  5B0N A;  5AWA A;  3ZYN A;  4QC0 A;  4HQ1 A;  3WPE A;  4R58 A;  4FCG A;  1YRG A;  3E4G A;  4Y61 B;  4GT6 A;  1PGV A;  1XEC A;  1OTM A;  2WQW A;  4C2B B;  4M7E A;  5AWB A;  2V9T B;  4BSU A;  4CC4 C;  5CMN A;  1OOK G;  4Z8G A;  4ARR A;  4QBZ A;  4MQW X;  4V2E A;  3W3G A;  4Q62 A;  3OGM B;  5AWD A;  2AST B;  1XKU A;  4P8S A;  3RIZ A;  3WPG A;  1OGQ A;  1H6T A;  4KNG A;  4KT1 A;  2JE0 A;  2Z7X A;  4PEQ B;  3CVR A;  4RCW A;  4XGO A;  5B0T A;  3UL7 A;  4C2A B;  3CIY A;  2UZX A;  1IO0 A;  3RGZ A;  3G06 A;  3TSR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...