1QYYA

Crystal structure of n-terminal domain of human platelet receptor glycoprotein ib-alpha at 2.8 angstrom resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
266
structure length
266
Chain Sequence
HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Platelet glycoprotein Ib alpha chain
publication title Platinum-induced space-group transformation in crystals of the platelet glycoprotein Ib alpha N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 266
sequence length 266
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1qyyA00
4C2BB 5GS0A 2OMZA 4ARRA 1M10B 1OTMA 3UN9A 3ULAA 2Z81A 4LSXA 2ASSB 4IM6A 3WPDA 5IJDA 1DS9A 1OTOA 4R07A 4R6FA 4P91A 5GS2B 5LFNA 4J0MA 1U0ND 2ELLA 4LXSA 4LI1A 3G04C 4KXFB 4NKGA 3RJ0A 4PEQB 2Q4GW 4OQTA 1M9SA 4C2AB 4RWTC 4CP6A 1P8VA 4FDWA 4Z94G 3E2JA 4CNMA 3RFJA 2Z82A 4P8SA 2RR6A 4V2DA 3ULVA 1FT8A 3A79B 4AW4A 2OMYA 3ZYNA 4LI2A 4CNCA 3O6NA 4TZHA 1O6SA 3OJAA 3WPGA 4PKIG 4PSJA 3TSRE 3RGXA 2A0ZA 3FXIA 3OJAB 3OGKB 3RFSA 1P8TA 2JE0A 1XKUA 2BEXA 4AY9X 3W3GA 5AWCA 4NKHA 1YRGA 5AZ5A 3W3NA 3RFEA 3M18A 4ARNA 5CMPA 3RW6A 3G06A 3G39A 1OZNA 4M7EA 2UZXA 4V2CA 3WPHA 4RCAB 3KJ4A 3P72A 1QYYA 2Z7XA 2Z62A 4LXRA 4Z61C 5IYXC 3BZ5A 3UL8A 3SB4A 4Q3GA 4ECOA 3WPCA 4FS7A 1LTXA 2Z65A 4PQ8A 2V70A 4WYKA 4EZGA 5IJCA 4FCGA 3UL7A 2JQDA 4R08A 3C6PB 3W3MA 2OMTA 4Z79A 1A9NA 4U7LA 1G9UA 3C6NB 2ASTB 3CIGA 2RA8A 5AWBA 4RCWA 3PMHG 4GT6A 1WWLA 2P1QB 4BSSA 3W3KA 2P1MB 4HQ1A 2Y5QA 1H6UA 4XOSA 4CC4C 3OGMB 3E6JA 5B0TA 4H09A 4FHOA 1FS2A 4BSUA 2V9TB 4I6JB 1O6VA 3C6OB 3G3AA 1XWDC 1XECA 3CVRA 2P1NB 4XSQA 3JB9j 2OMUA 2JE1A 3VQ1A 4R0AA 3RW7A 5AWAA 1OGQA 5IJBA 5AWDA 2CA6A 4R09A 4R6GA 4Q62A 4GLPA 4FMZA 2BNHA 2IFGA 2OMXA 1A4YA 4LSXC 2FT3A 3OGLB 3W3JA 3DZEA 2WQWA 5FTTB 3ZYJA 4R58A 3RGZA 4J4LA 2XOTA 3E4GA 4Z64C 2P1OB 2O6QA 5B4PA 4R6JA 3REZA 1XEUA 2Z7XB 2Z66A 2ID5A 2O6SA 2R9UA 2Z63A 5CMNA 3ZYIA 4LSCA 2V9SA 2UZYA 4R6AA 1FO1A 2Z64A 2WQVA 2WQXA 3W3LA 4U08A 4XGOA 2OMWA 3M19A 1K5DC 3WPFA 1O6TA 3WPEA 4UFRA 5HDHA 2P1PB 4ECNA 1OTNA 4L3FA 1XCDA 3GOZA 5B0NA 4M7EC 1PGVA 4U09A 4CILA 3RIZA 3UL9A 1KOOA 4BSRA 5D3IA 4G8AA 3ULUA 1FQVA 1W8AA 1KOHA 4MN8B 5GMFA 3WPBA 4QC0A 4L3AA 4LSAA 1GWBA 4BV4R 4Y61B 4YEBB 4KNGA 3E3ZA 5GMHA 4PERA 1Z7XW 4B8CD 4WP6A 4U06A 2O6RA 1SQ0B 4QBZA 1H6TA 1K5GC 4V2EA 1IO0A 2XWTC 1ZIWA 3ZYOA 4QXEA 3O53A 2WFHA 4Z8GA 3WPIA 1DCEA 4KT1A 1M9LA 3WN4A 4Q3IA 4FD0A 4CC4A 5HZLB 1P9AG 4MQWX 2OMVA 1D0BA 4R5CA 1JL5A 1OOKG 5A5CA 4R5DA 1DFJI 3CIYA 3G3BA 4K17A 2WQUA 3VQ2A 5GQRK 5GMGA 1M0ZA
chains in the Genus database with same CATH superfamily
4C2BB 5GS0A 2OMZA 4ARRA 1M10B 1OTMA 3UN9A 3ULAA 2Z81A 4LSXA 2ASSB 4IM6A 3WPDA 5IJDA 1DS9A 1OTOA 4R07A 4R6FA 4P91A 5GS2B 5LFNA 4J0MA 1U0ND 2ELLA 4LXSA 4LI1A 3G04C 4KXFB 4NKGA 3RJ0A 4PEQB 2Q4GW 4OQTA 1M9SA 4C2AB 4RWTC 4CP6A 1P8VA 4FDWA 4Z94G 3E2JA 4CNMA 3RFJA 2Z82A 4P8SA 2RR6A 4V2DA 3ULVA 1FT8A 3A79B 4AW4A 2OMYA 3ZYNA 4LI2A 4CNCA 3O6NA 4TZHA 1O6SA 3OJAA 3WPGA 4PKIG 4PSJA 3TSRE 3RGXA 2A0ZA 3FXIA 3OJAB 3OGKB 3RFSA 1P8TA 2JE0A 1XKUA 2BEXA 4AY9X 3W3GA 5AWCA 4NKHA 1YRGA 5AZ5A 3W3NA 3RFEA 3M18A 4ARNA 5CMPA 3RW6A 3G06A 3G39A 1OZNA 4M7EA 2UZXA 4V2CA 3WPHA 4RCAB 3KJ4A 3P72A 1QYYA 2Z7XA 2Z62A 4LXRA 4Z61C 5IYXC 3BZ5A 3UL8A 3SB4A 4Q3GA 4ECOA 3WPCA 4FS7A 1LTXA 2Z65A 4PQ8A 2V70A 4WYKA 4EZGA 5IJCA 4FCGA 3UL7A 2JQDA 4R08A 3C6PB 3W3MA 2OMTA 4Z79A 1A9NA 4U7LA 1G9UA 3C6NB 2ASTB 3CIGA 2RA8A 5AWBA 4RCWA 3PMHG 4GT6A 1WWLA 2P1QB 4BSSA 3W3KA 2P1MB 4HQ1A 2Y5QA 1H6UA 4XOSA 4CC4C 3OGMB 3E6JA 5B0TA 4H09A 4FHOA 1FS2A 4BSUA 2V9TB 4I6JB 1O6VA 3C6OB 3G3AA 1XWDC 1XECA 3CVRA 2P1NB 4XSQA 3JB9j 2OMUA 2JE1A 3VQ1A 4R0AA 3RW7A 4NZRM 5AWAA 1OGQA 5IJBA 5AWDA 2CA6A 4R09A 4R6GA 4Q62A 4GLPA 4FMZA 2BNHA 2IFGA 2OMXA 1A4YA 4LSXC 2FT3A 3OGLB 3W3JA 3DZEA 2WQWA 5FTTB 3ZYJA 4R58A 4NZTM 3RGZA 4J4LA 2XOTA 3E4GA 4Z64C 2P1OB 2O6QA 5B4PA 4R6JA 3REZA 1XEUA 2Z7XB 2Z66A 2ID5A 2O6SA 2R9UA 2Z63A 5CMNA 3ZYIA 4LSCA 2V9SA 2UZYA 4R6AA 1FO1A 2Z64A 2WQVA 2WQXA 3W3LA 4U08A 4XGOA 2OMWA 3M19A 1K5DC 3WPFA 1O6TA 3WPEA 4UFRA 5HDHA 2P1PB 4ECNA 1OTNA 4L3FA 1XCDA 3GOZA 5B0NA 4M7EC 1PGVA 4U09A 4CILA 3RIZA 3UL9A 1KOOA 4BSRA 5D3IA 4G8AA 3ULUA 1FQVA 1W8AA 1KOHA 4MN8B 5GMFA 3WPBA 4QC0A 4L3AA 4LSAA 1GWBA 4BV4R 4Y61B 4YEBB 4KNGA 3E3ZA 5GMHA 4PERA 1Z7XW 4B8CD 4WP6A 4U06A 2O6RA 1SQ0B 4QBZA 1H6TA 1K5GC 4V2EA 1IO0A 2XWTC 1ZIWA 3ZYOA 4QXEA 3O53A 2WFHA 4Z8GA 3WPIA 1DCEA 4KT1A 1M9LA 3WN4A 4Q3IA 4FD0A 4CC4A 5HZLB 1P9AG 4MQWX 2OMVA 1D0BA 4R5CA 1JL5A 1OOKG 5A5CA 4R5DA 1DFJI 3CIYA 3G3BA 4K17A 2WQUA 3VQ2A 5GQRK 5GMGA 1M0ZA
chains in the Genus database with same CATH topology
4C2BB 5GS0A 2OMZA 4ARRA 1M10B 1OTMA 3UN9A 3ULAA 2Z81A 4LSXA 2ASSB 4IM6A 3WPDA 5IJDA 1DS9A 1OTOA 4R07A 4R6FA 4P91A 5GS2B 5LFNA 4J0MA 1U0ND 2ELLA 4LXSA 4LI1A 3G04C 4KXFB 4NKGA 3RJ0A 4PEQB 2Q4GW 4OQTA 1M9SA 4C2AB 4RWTC 4CP6A 1P8VA 4FDWA 4Z94G 3E2JA 4CNMA 3RFJA 2Z82A 4P8SA 2RR6A 4V2DA 3ULVA 1FT8A 3A79B 4AW4A 2OMYA 3ZYNA 4LI2A 4CNCA 3O6NA 4TZHA 1O6SA 3OJAA 3WPGA 4PKIG 4PSJA 3TSRE 3RGXA 2A0ZA 3FXIA 3OJAB 3OGKB 3RFSA 1P8TA 2JE0A 1XKUA 2BEXA 4AY9X 3W3GA 5AWCA 4NKHA 1YRGA 5AZ5A 3W3NA 3RFEA 3M18A 4ARNA 5CMPA 3RW6A 3G06A 3G39A 1OZNA 4M7EA 2UZXA 4V2CA 3WPHA 4RCAB 3KJ4A 3P72A 1QYYA 2Z7XA 2Z62A 4LXRA 4Z61C 5IYXC 3BZ5A 3UL8A 3SB4A 4Q3GA 4ECOA 3WPCA 4FS7A 1LTXA 2Z65A 4PQ8A 2V70A 4WYKA 4EZGA 5IJCA 4FCGA 3UL7A 2JQDA 4R08A 3C6PB 3W3MA 2OMTA 4Z79A 1A9NA 4U7LA 1G9UA 3C6NB 2ASTB 3CIGA 2RA8A 5AWBA 4RCWA 3PMHG 4GT6A 1WWLA 2P1QB 4BSSA 3W3KA 2P1MB 4HQ1A 2Y5QA 1H6UA 4XOSA 4CC4C 3OGMB 3E6JA 5B0TA 4H09A 4FHOA 1FS2A 4BSUA 2V9TB 4I6JB 1O6VA 3C6OB 3G3AA 1XWDC 1XECA 3CVRA 2P1NB 4XSQA 3JB9j 2OMUA 2JE1A 3VQ1A 4R0AA 3RW7A 5AWAA 1OGQA 5IJBA 5AWDA 2CA6A 4R09A 4R6GA 4Q62A 4GLPA 4FMZA 2BNHA 2IFGA 2OMXA 1A4YA 4LSXC 2FT3A 3OGLB 3W3JA 3DZEA 2WQWA 5FTTB 3ZYJA 4R58A 3RGZA 4J4LA 2XOTA 3E4GA 4Z64C 2P1OB 2O6QA 5B4PA 4R6JA 3REZA 1XEUA 2Z7XB 2Z66A 2ID5A 2O6SA 2R9UA 2Z63A 5CMNA 3ZYIA 4LSCA 2V9SA 2UZYA 4R6AA 1FO1A 2Z64A 2WQVA 2WQXA 3W3LA 4U08A 4XGOA 2OMWA 3M19A 1K5DC 3WPFA 1O6TA 3WPEA 4UFRA 5HDHA 2P1PB 4ECNA 1OTNA 4L3FA 1XCDA 3GOZA 5B0NA 4M7EC 1PGVA 4U09A 4CILA 3RIZA 3UL9A 1KOOA 4BSRA 5D3IA 4G8AA 3ULUA 1FQVA 1W8AA 1KOHA 4MN8B 5GMFA 3WPBA 4QC0A 4L3AA 4LSAA 1GWBA 4BV4R 4Y61B 4YEBB 4KNGA 3E3ZA 5GMHA 4PERA 1Z7XW 4B8CD 4WP6A 4U06A 2O6RA 1SQ0B 4QBZA 1H6TA 1K5GC 4V2EA 1IO0A 2XWTC 1ZIWA 3ZYOA 4QXEA 3O53A 2WFHA 4Z8GA 3WPIA 1DCEA 4KT1A 1M9LA 3WN4A 4Q3IA 4FD0A 4CC4A 5HZLB 1P9AG 4MQWX 2OMVA 1D0BA 4R5CA 1JL5A 1OOKG 5A5CA 4R5DA 1DFJI 3CIYA 3G3BA 4K17A 2WQUA 3VQ2A 5GQRK 5GMGA 1M0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2B B;  5GS0 A;  2OMZ A;  4ARR A;  1M10 B;  1OTM A;  3UN9 A;  3ULA A;  2Z81 A;  4LSX A;  2ASS B;  4IM6 A;  3WPD A;  5IJD A;  1DS9 A;  1OTO A;  4R07 A;  4R6F A;  4P91 A;  5GS2 B;  5LFN A;  4J0M A;  1U0N D;  2ELL A;  4LXS A;  4LI1 A;  3G04 C;  4KXF B;  4NKG A;  3RJ0 A;  4PEQ B;  2Q4G W;  4OQT A;  1M9S A;  4C2A B;  4RWT C;  4CP6 A;  1P8V A;  4FDW A;  4Z94 G;  3E2J A;  4CNM A;  3RFJ A;  2Z82 A;  4P8S A;  2RR6 A;  4V2D A;  3ULV A;  1FT8 A;  3A79 B;  4AW4 A;  2OMY A;  3ZYN A;  4LI2 A;  4CNC A;  3O6N A;  4TZH A;  1O6S A;  3OJA A;  3WPG A;  4PKI G;  4PSJ A;  3TSR E;  3RGX A;  2A0Z A;  3FXI A;  3OJA B;  3OGK B;  3RFS A;  1P8T A;  2JE0 A;  1XKU A;  2BEX A;  4AY9 X;  3W3G A;  5AWC A;  4NKH A;  1YRG A;  5AZ5 A;  3W3N A;  3RFE A;  3M18 A;  4ARN A;  5CMP A;  3RW6 A;  3G06 A;  3G39 A;  1OZN A;  4M7E A;  2UZX A;  4V2C A;  3WPH A;  4RCA B;  3KJ4 A;  3P72 A;  1QYY A;  2Z7X A;  2Z62 A;  4LXR A;  4Z61 C;  5IYX C;  3BZ5 A;  3UL8 A;  3SB4 A;  4Q3G A;  4ECO A;  3WPC A;  4FS7 A;  1LTX A;  2Z65 A;  4PQ8 A;  2V70 A;  4WYK A;  4EZG A;  5IJC A;  4FCG A;  3UL7 A;  2JQD A;  4R08 A;  3C6P B;  3W3M A;  2OMT A;  4Z79 A;  1A9N A;  4U7L A;  1G9U A;  3C6N B;  2AST B;  3CIG A;  2RA8 A;  5AWB A;  4RCW A;  3PMH G;  4GT6 A;  1WWL A;  2P1Q B;  4BSS A;  3W3K A;  2P1M B;  4HQ1 A;  2Y5Q A;  1H6U A;  4XOS A;  4CC4 C;  3OGM B;  3E6J A;  5B0T A;  4H09 A;  4FHO A;  1FS2 A;  4BSU A;  2V9T B;  4I6J B;  1O6V A;  3C6O B;  3G3A A;  1XWD C;  1XEC A;  3CVR A;  2P1N B;  4XSQ A;  3JB9 j;  2OMU A;  2JE1 A;  3VQ1 A;  4R0A A;  3RW7 A;  5AWA A;  1OGQ A;  5IJB A;  5AWD A;  2CA6 A;  4R09 A;  4R6G A;  4Q62 A;  4GLP A;  4FMZ A;  2BNH A;  2IFG A;  2OMX A;  1A4Y A;  4LSX C;  2FT3 A;  3OGL B;  3W3J A;  3DZE A;  2WQW A;  5FTT B;  3ZYJ A;  4R58 A;  3RGZ A;  4J4L A;  2XOT A;  3E4G A;  4Z64 C;  2P1O B;  2O6Q A;  5B4P A;  4R6J A;  3REZ A;  1XEU A;  2Z7X B;  2Z66 A;  2ID5 A;  2O6S A;  2R9U A;  2Z63 A;  5CMN A;  3ZYI A;  4LSC A;  2V9S A;  2UZY A;  4R6A A;  1FO1 A;  2Z64 A;  2WQV A;  2WQX A;  3W3L A;  4U08 A;  4XGO A;  2OMW A;  3M19 A;  1K5D C;  3WPF A;  1O6T A;  3WPE A;  4UFR A;  5HDH A;  2P1P B;  4ECN A;  1OTN A;  4L3F A;  1XCD A;  3GOZ A;  5B0N A;  4M7E C;  1PGV A;  4U09 A;  4CIL A;  3RIZ A;  3UL9 A;  1KOO A;  4BSR A;  5D3I A;  4G8A A;  3ULU A;  1FQV A;  1W8A A;  1KOH A;  4MN8 B;  5GMF A;  3WPB A;  4QC0 A;  4L3A A;  4LSA A;  1GWB A;  4BV4 R;  4Y61 B;  4YEB B;  4KNG A;  3E3Z A;  5GMH A;  4PER A;  1Z7X W;  4B8C D;  4WP6 A;  4U06 A;  2O6R A;  1SQ0 B;  4QBZ A;  1H6T A;  1K5G C;  4V2E A;  1IO0 A;  2XWT C;  1ZIW A;  3ZYO A;  4QXE A;  3O53 A;  2WFH A;  4Z8G A;  3WPI A;  1DCE A;  4KT1 A;  1M9L A;  3WN4 A;  4Q3I A;  4FD0 A;  4CC4 A;  5HZL B;  1P9A G;  4MQW X;  2OMV A;  1D0B A;  4R5C A;  1JL5 A;  1OOK G;  5A5C A;  4R5D A;  1DFJ I;  3CIY A;  3G3B A;  4K17 A;  2WQU A;  3VQ2 A;  5GQR K;  5GMG A;  1M0Z A; 
#chains in the Genus database with same CATH topology
 4C2B B;  5GS0 A;  2OMZ A;  4ARR A;  1M10 B;  1OTM A;  3UN9 A;  3ULA A;  2Z81 A;  4LSX A;  2ASS B;  4IM6 A;  3WPD A;  5IJD A;  1DS9 A;  1OTO A;  4R07 A;  4R6F A;  4P91 A;  5GS2 B;  5LFN A;  4J0M A;  1U0N D;  2ELL A;  4LXS A;  4LI1 A;  3G04 C;  4KXF B;  4NKG A;  3RJ0 A;  4PEQ B;  2Q4G W;  4OQT A;  1M9S A;  4C2A B;  4RWT C;  4CP6 A;  1P8V A;  4FDW A;  4Z94 G;  3E2J A;  4CNM A;  3RFJ A;  2Z82 A;  4P8S A;  2RR6 A;  4V2D A;  3ULV A;  1FT8 A;  3A79 B;  4AW4 A;  2OMY A;  3ZYN A;  4LI2 A;  4CNC A;  3O6N A;  4TZH A;  1O6S A;  3OJA A;  3WPG A;  4PKI G;  4PSJ A;  3TSR E;  3RGX A;  2A0Z A;  3FXI A;  3OJA B;  3OGK B;  3RFS A;  1P8T A;  2JE0 A;  1XKU A;  2BEX A;  4AY9 X;  3W3G A;  5AWC A;  4NKH A;  1YRG A;  5AZ5 A;  3W3N A;  3RFE A;  3M18 A;  4ARN A;  5CMP A;  3RW6 A;  3G06 A;  3G39 A;  1OZN A;  4M7E A;  2UZX A;  4V2C A;  3WPH A;  4RCA B;  3KJ4 A;  3P72 A;  1QYY A;  2Z7X A;  2Z62 A;  4LXR A;  4Z61 C;  5IYX C;  3BZ5 A;  3UL8 A;  3SB4 A;  4Q3G A;  4ECO A;  3WPC A;  4FS7 A;  1LTX A;  2Z65 A;  4PQ8 A;  2V70 A;  4WYK A;  4EZG A;  5IJC A;  4FCG A;  3UL7 A;  2JQD A;  4R08 A;  3C6P B;  3W3M A;  2OMT A;  4Z79 A;  1A9N A;  4U7L A;  1G9U A;  3C6N B;  2AST B;  3CIG A;  2RA8 A;  5AWB A;  4RCW A;  3PMH G;  4GT6 A;  1WWL A;  2P1Q B;  4BSS A;  3W3K A;  2P1M B;  4HQ1 A;  2Y5Q A;  1H6U A;  4XOS A;  4CC4 C;  3OGM B;  3E6J A;  5B0T A;  4H09 A;  4FHO A;  1FS2 A;  4BSU A;  2V9T B;  4I6J B;  1O6V A;  3C6O B;  3G3A A;  1XWD C;  1XEC A;  3CVR A;  2P1N B;  4XSQ A;  3JB9 j;  2OMU A;  2JE1 A;  3VQ1 A;  4R0A A;  3RW7 A;  4NZR M;  5AWA A;  1OGQ A;  5IJB A;  5AWD A;  2CA6 A;  4R09 A;  4R6G A;  4Q62 A;  4GLP A;  4FMZ A;  2BNH A;  2IFG A;  2OMX A;  1A4Y A;  4LSX C;  2FT3 A;  3OGL B;  3W3J A;  3DZE A;  2WQW A;  5FTT B;  3ZYJ A;  4R58 A;  4NZT M;  3RGZ A;  4J4L A;  2XOT A;  3E4G A;  4Z64 C;  2P1O B;  2O6Q A;  5B4P A;  4R6J A;  3REZ A;  1XEU A;  2Z7X B;  2Z66 A;  2ID5 A;  2O6S A;  2R9U A;  2Z63 A;  5CMN A;  3ZYI A;  4LSC A;  2V9S A;  2UZY A;  4R6A A;  1FO1 A;  2Z64 A;  2WQV A;  2WQX A;  3W3L A;  4U08 A;  4XGO A;  2OMW A;  3M19 A;  1K5D C;  3WPF A;  1O6T A;  3WPE A;  4UFR A;  5HDH A;  2P1P B;  4ECN A;  1OTN A;  4L3F A;  1XCD A;  3GOZ A;  5B0N A;  4M7E C;  1PGV A;  4U09 A;  4CIL A;  3RIZ A;  3UL9 A;  1KOO A;  4BSR A;  5D3I A;  4G8A A;  3ULU A;  1FQV A;  1W8A A;  1KOH A;  4MN8 B;  5GMF A;  3WPB A;  4QC0 A;  4L3A A;  4LSA A;  1GWB A;  4BV4 R;  4Y61 B;  4YEB B;  4KNG A;  3E3Z A;  5GMH A;  4PER A;  1Z7X W;  4B8C D;  4WP6 A;  4U06 A;  2O6R A;  1SQ0 B;  4QBZ A;  1H6T A;  1K5G C;  4V2E A;  1IO0 A;  2XWT C;  1ZIW A;  3ZYO A;  4QXE A;  3O53 A;  2WFH A;  4Z8G A;  3WPI A;  1DCE A;  4KT1 A;  1M9L A;  3WN4 A;  4Q3I A;  4FD0 A;  4CC4 A;  5HZL B;  1P9A G;  4MQW X;  2OMV A;  1D0B A;  4R5C A;  1JL5 A;  1OOK G;  5A5C A;  4R5D A;  1DFJ I;  3CIY A;  3G3B A;  4K17 A;  2WQU A;  3VQ2 A;  5GQR K;  5GMG A;  1M0Z A; 
#chains in the Genus database with same CATH homology
 4C2B B;  5GS0 A;  2OMZ A;  4ARR A;  1M10 B;  1OTM A;  3UN9 A;  3ULA A;  2Z81 A;  4LSX A;  2ASS B;  4IM6 A;  3WPD A;  5IJD A;  1DS9 A;  1OTO A;  4R07 A;  4R6F A;  4P91 A;  5GS2 B;  5LFN A;  4J0M A;  1U0N D;  2ELL A;  4LXS A;  4LI1 A;  3G04 C;  4KXF B;  4NKG A;  3RJ0 A;  4PEQ B;  2Q4G W;  4OQT A;  1M9S A;  4C2A B;  4RWT C;  4CP6 A;  1P8V A;  4FDW A;  4Z94 G;  3E2J A;  4CNM A;  3RFJ A;  2Z82 A;  4P8S A;  2RR6 A;  4V2D A;  3ULV A;  1FT8 A;  3A79 B;  4AW4 A;  2OMY A;  3ZYN A;  4LI2 A;  4CNC A;  3O6N A;  4TZH A;  1O6S A;  3OJA A;  3WPG A;  4PKI G;  4PSJ A;  3TSR E;  3RGX A;  2A0Z A;  3FXI A;  3OJA B;  3OGK B;  3RFS A;  1P8T A;  2JE0 A;  1XKU A;  2BEX A;  4AY9 X;  3W3G A;  5AWC A;  4NKH A;  1YRG A;  5AZ5 A;  3W3N A;  3RFE A;  3M18 A;  4ARN A;  5CMP A;  3RW6 A;  3G06 A;  3G39 A;  1OZN A;  4M7E A;  2UZX A;  4V2C A;  3WPH A;  4RCA B;  3KJ4 A;  3P72 A;  1QYY A;  2Z7X A;  2Z62 A;  4LXR A;  4Z61 C;  5IYX C;  3BZ5 A;  3UL8 A;  3SB4 A;  4Q3G A;  4ECO A;  3WPC A;  4FS7 A;  1LTX A;  2Z65 A;  4PQ8 A;  2V70 A;  4WYK A;  4EZG A;  5IJC A;  4FCG A;  3UL7 A;  2JQD A;  4R08 A;  3C6P B;  3W3M A;  2OMT A;  4Z79 A;  1A9N A;  4U7L A;  1G9U A;  3C6N B;  2AST B;  3CIG A;  2RA8 A;  5AWB A;  4RCW A;  3PMH G;  4GT6 A;  1WWL A;  2P1Q B;  4BSS A;  3W3K A;  2P1M B;  4HQ1 A;  2Y5Q A;  1H6U A;  4XOS A;  4CC4 C;  3OGM B;  3E6J A;  5B0T A;  4H09 A;  4FHO A;  1FS2 A;  4BSU A;  2V9T B;  4I6J B;  1O6V A;  3C6O B;  3G3A A;  1XWD C;  1XEC A;  3CVR A;  2P1N B;  4XSQ A;  3JB9 j;  2OMU A;  2JE1 A;  3VQ1 A;  4R0A A;  3RW7 A;  5AWA A;  1OGQ A;  5IJB A;  5AWD A;  2CA6 A;  4R09 A;  4R6G A;  4Q62 A;  4GLP A;  4FMZ A;  2BNH A;  2IFG A;  2OMX A;  1A4Y A;  4LSX C;  2FT3 A;  3OGL B;  3W3J A;  3DZE A;  2WQW A;  5FTT B;  3ZYJ A;  4R58 A;  3RGZ A;  4J4L A;  2XOT A;  3E4G A;  4Z64 C;  2P1O B;  2O6Q A;  5B4P A;  4R6J A;  3REZ A;  1XEU A;  2Z7X B;  2Z66 A;  2ID5 A;  2O6S A;  2R9U A;  2Z63 A;  5CMN A;  3ZYI A;  4LSC A;  2V9S A;  2UZY A;  4R6A A;  1FO1 A;  2Z64 A;  2WQV A;  2WQX A;  3W3L A;  4U08 A;  4XGO A;  2OMW A;  3M19 A;  1K5D C;  3WPF A;  1O6T A;  3WPE A;  4UFR A;  5HDH A;  2P1P B;  4ECN A;  1OTN A;  4L3F A;  1XCD A;  3GOZ A;  5B0N A;  4M7E C;  1PGV A;  4U09 A;  4CIL A;  3RIZ A;  3UL9 A;  1KOO A;  4BSR A;  5D3I A;  4G8A A;  3ULU A;  1FQV A;  1W8A A;  1KOH A;  4MN8 B;  5GMF A;  3WPB A;  4QC0 A;  4L3A A;  4LSA A;  1GWB A;  4BV4 R;  4Y61 B;  4YEB B;  4KNG A;  3E3Z A;  5GMH A;  4PER A;  1Z7X W;  4B8C D;  4WP6 A;  4U06 A;  2O6R A;  1SQ0 B;  4QBZ A;  1H6T A;  1K5G C;  4V2E A;  1IO0 A;  2XWT C;  1ZIW A;  3ZYO A;  4QXE A;  3O53 A;  2WFH A;  4Z8G A;  3WPI A;  1DCE A;  4KT1 A;  1M9L A;  3WN4 A;  4Q3I A;  4FD0 A;  4CC4 A;  5HZL B;  1P9A G;  4MQW X;  2OMV A;  1D0B A;  4R5C A;  1JL5 A;  1OOK G;  5A5C A;  4R5D A;  1DFJ I;  3CIY A;  3G3B A;  4K17 A;  2WQU A;  3VQ2 A;  5GQR K;  5GMG A;  1M0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...