1QYYA

Crystal structure of n-terminal domain of human platelet receptor glycoprotein ib-alpha at 2.8 angstrom resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
266
structure length
266
Chain Sequence
b'HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib alpha chain
publication title Platinum-induced space-group transformation in crystals of the platelet glycoprotein Ib alpha N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 69
structure length 266
sequence length 266
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1qyyA00
3RFJA 5GS0A 4GT6A 4Z8GA 1G9UA 4XSQA 1D0BA 4P8SA 5B0NA 2Z62A 4R0AA 2XWTC 4Z64C 5AZ5A 3P72A 1WWLA 4QC0A 4PKIG 2ELLA 2XOTA 1DFJI 3G04C 4KNGA 3WPHA 3C6NB 1FO1A 4R5CA 5LFNA 2P1NB 4CC4A 3G39A 4K17A 4Z79A 2P1MB 2CA6A 2O6QA 4Z94G 2WQXA 1M9LA 4R07A 5AWCA 4V2CA 3RW7A 3WPIA 2OMWA 2UZXA 3E6JA 2OMTA 3OJAB 3WPCA 2WFHA 1K5GC 2ASSB 4M7EA 1W8AA 3DZEA 3ULUA 4R6AA 2Y5QA 5IJBA 4AY9X 3OGLB 2P1PB 1K5DC 3ZYOA 3CIYA 4G8AA 2R9UA 4CP6A 5GMGA 3W3NA 4PERA 4Q3IA 2Z82A 1OZNA 3ZYJA 2A0ZA 4U06A 2Z7XA 1ZIWA 5B0TA 4J0MA 2OMVA 4CNCA 4HQ1A 4I6JB 5AWDA 4CILA 3RW6A 4LXRA 5A5CA 4P91A 4Y61B 3UL9A 3VQ2A 1Z7XW 3SB4A 2WQVA 2IFGA 4M7EC 4PSJA 4LSXA 4L3AA 5GS2B 3WPEA 4LSCA 1A9NA 5GMHA 2Z63A 4RCAB 4GLPA 1XEUA 3VQ1A 1XECA 3TSRE 3OGMB 4FMZA 1O6TA 3A79B 2UZYA 2V9SA 1H6TA 3RJ0A 2BEXA 4LXSA 4BV4R 2Z65A 1DCEA 4UFRA 3ULAA 1P9AG 4J4LA 1PGVA 3WPFA 4YEBB 3UL8A 2OMXA 5CMNA 1XWDC 4V2DA 3ULVA 1SQ0B 3UL7A 4R6FA 4EZGA 5GQRK 4H09A 2ASTB 4R5DA 4TZHA 3PMHG 4C2BB 4ARNA 2FT3A 3RFSA 4R09A 5GMFA 3M19A 4NKGA 4MQWX 4XOSA 4LSXC 3C6PB 4LI1A 2V70A 4QBZA 3RIZA 3RGXA 5FTTB 5IYXC 1OGQA 3REZA 1P8TA 3G3AA 2ID5A 5IJCA 4BSRA 3BZ5A 4CC4C 4XGOA 3W3KA 3OJAA 1FQVA 5B4PA 4PEQB 1XKUA 2OMZA 3JB9j 1QYYA 4Z61C 4ECNA 3CIGA 3WPDA 4KT1A 4V2EA 4Q3GA 1JL5A 3WN4A 3KJ4A 4CNMA 3W3LA 3E4GA 3OGKB 2V9TB 2RR6A 2JE1A 1A4YA 5D3IA 4IM6A 4FS7A 4BSSA 1M9SA 5HDHA 3E3ZA 4LSAA 2Z66A 4PQ8A 4FHOA 2O6SA 2JE0A 3RGZA 4R58A 3ZYNA 5AWAA 3W3JA 4B8CD 4FD0A 4NKHA 1OOKG 1KOHA 4RWTC 4ARRA 1OTMA 3CVRA 1O6VA 2RA8A 3E2JA 3GOZA 4FDWA 3C6OB 4LI2A 4WYKA 4OQTA 4R6JA 2Q4GW 4L3FA 1H6UA 1P8VA 3M18A 3G3BA 4R6GA 4AW4A 4MN8B 2Z7XB 1GWBA 3FXIA 4KXFB 1M0ZA 1XCDA 5CMPA 2OMYA 1FT8A 5AWBA 4RCWA 4QXEA 3ZYIA 5IJDA 1OTOA 2P1QB 2O6RA 2P1OB 2WQWA 1IO0A 4C2AB 2WQUA 4U09A 1LTXA 3W3GA 3WPBA 1O6SA 1DS9A 1FS2A 4WP6A 4FCGA 4R08A 3WPGA 4U08A 2BNHA 3RFEA 4BSUA 4Q62A 2Z81A 1KOOA 2Z64A 5HZLB 3UN9A 3O53A 1OTNA 3W3MA 3O6NA 1U0ND 2JQDA 2OMUA 1YRGA 1M10B 4ECOA 3G06A 4U7LA
chains in the Genus database with same CATH superfamily
3RFJA 5GS0A 4GT6A 4Z8GA 1G9UA 4XSQA 1D0BA 4P8SA 5B0NA 2Z62A 4R0AA 2XWTC 4Z64C 5AZ5A 3P72A 1WWLA 4QC0A 4PKIG 2ELLA 2XOTA 1DFJI 3G04C 4KNGA 3WPHA 3C6NB 1FO1A 4R5CA 5LFNA 2P1NB 4CC4A 3G39A 4K17A 4Z79A 2P1MB 2CA6A 2O6QA 4Z94G 2WQXA 1M9LA 4R07A 5AWCA 4V2CA 3RW7A 3WPIA 2OMWA 2UZXA 3E6JA 2OMTA 3OJAB 3WPCA 2WFHA 1K5GC 2ASSB 4M7EA 1W8AA 3DZEA 3ULUA 4R6AA 2Y5QA 5IJBA 4AY9X 3OGLB 2P1PB 1K5DC 3ZYOA 3CIYA 4G8AA 2R9UA 4CP6A 5GMGA 3W3NA 4PERA 4Q3IA 2Z82A 1OZNA 3ZYJA 2A0ZA 4U06A 2Z7XA 1ZIWA 5B0TA 4J0MA 2OMVA 4CNCA 4HQ1A 4I6JB 5AWDA 4CILA 3RW6A 4LXRA 5A5CA 4P91A 4Y61B 3UL9A 3VQ2A 1Z7XW 3SB4A 2WQVA 2IFGA 4M7EC 4PSJA 4LSXA 4L3AA 5GS2B 3WPEA 4LSCA 1A9NA 5GMHA 2Z63A 4RCAB 4GLPA 1XEUA 3VQ1A 1XECA 3TSRE 3OGMB 4FMZA 1O6TA 3A79B 2UZYA 2V9SA 1H6TA 3RJ0A 2BEXA 4LXSA 4BV4R 2Z65A 1DCEA 4UFRA 3ULAA 1P9AG 4J4LA 1PGVA 3WPFA 4YEBB 3UL8A 2OMXA 5CMNA 1XWDC 4V2DA 3ULVA 1SQ0B 3UL7A 4R6FA 4NZTM 4EZGA 5GQRK 4H09A 2ASTB 4R5DA 4TZHA 3PMHG 4C2BB 4ARNA 2FT3A 3RFSA 4R09A 5GMFA 3M19A 4NKGA 4MQWX 4XOSA 4LSXC 3C6PB 4LI1A 2V70A 4QBZA 3RIZA 3RGXA 5FTTB 5IYXC 1OGQA 3REZA 1P8TA 3G3AA 2ID5A 5IJCA 4BSRA 3BZ5A 4CC4C 4XGOA 3W3KA 3OJAA 1FQVA 5B4PA 4PEQB 1XKUA 2OMZA 3JB9j 1QYYA 4Z61C 4ECNA 3CIGA 3WPDA 4KT1A 4V2EA 4Q3GA 1JL5A 3WN4A 3KJ4A 4CNMA 3W3LA 3E4GA 3OGKB 2V9TB 2RR6A 2JE1A 1A4YA 5D3IA 4IM6A 4FS7A 4BSSA 1M9SA 5HDHA 3E3ZA 4LSAA 2Z66A 4PQ8A 4FHOA 2O6SA 2JE0A 3RGZA 4R58A 3ZYNA 5AWAA 3W3JA 4B8CD 4FD0A 4NKHA 1OOKG 1KOHA 4RWTC 4ARRA 1OTMA 3CVRA 1O6VA 2RA8A 3E2JA 3GOZA 4FDWA 3C6OB 4LI2A 4WYKA 4OQTA 4R6JA 2Q4GW 4L3FA 1H6UA 1P8VA 3M18A 3G3BA 4R6GA 4AW4A 4MN8B 2Z7XB 1GWBA 3FXIA 4KXFB 1M0ZA 1XCDA 5CMPA 2OMYA 1FT8A 5AWBA 4RCWA 4QXEA 3ZYIA 5IJDA 1OTOA 2P1QB 2O6RA 2P1OB 2WQWA 1IO0A 4C2AB 2WQUA 4U09A 1LTXA 3W3GA 3WPBA 1O6SA 1DS9A 1FS2A 4WP6A 4FCGA 4R08A 3WPGA 4U08A 2BNHA 3RFEA 4BSUA 4Q62A 2Z81A 1KOOA 2Z64A 5HZLB 3UN9A 3O53A 1OTNA 3W3MA 3O6NA 1U0ND 2JQDA 2OMUA 1YRGA 1M10B 4NZRM 4ECOA 3G06A 4U7LA
chains in the Genus database with same CATH topology
3RFJA 5GS0A 4GT6A 4Z8GA 1G9UA 4XSQA 1D0BA 4P8SA 5B0NA 2Z62A 4R0AA 2XWTC 4Z64C 5AZ5A 3P72A 1WWLA 4QC0A 4PKIG 2ELLA 2XOTA 1DFJI 3G04C 4KNGA 3WPHA 3C6NB 1FO1A 4R5CA 5LFNA 2P1NB 4CC4A 3G39A 4K17A 4Z79A 2P1MB 2CA6A 2O6QA 4Z94G 2WQXA 1M9LA 4R07A 5AWCA 4V2CA 3RW7A 3WPIA 2OMWA 2UZXA 3E6JA 2OMTA 3OJAB 3WPCA 2WFHA 1K5GC 2ASSB 4M7EA 1W8AA 3DZEA 3ULUA 4R6AA 2Y5QA 5IJBA 4AY9X 3OGLB 2P1PB 1K5DC 3ZYOA 3CIYA 4G8AA 2R9UA 4CP6A 5GMGA 3W3NA 4PERA 4Q3IA 2Z82A 1OZNA 3ZYJA 2A0ZA 4U06A 2Z7XA 1ZIWA 5B0TA 4J0MA 2OMVA 4CNCA 4HQ1A 4I6JB 5AWDA 4CILA 3RW6A 4LXRA 5A5CA 4P91A 4Y61B 3UL9A 3VQ2A 1Z7XW 3SB4A 2WQVA 2IFGA 4M7EC 4PSJA 4LSXA 4L3AA 5GS2B 3WPEA 4LSCA 1A9NA 5GMHA 2Z63A 4RCAB 4GLPA 1XEUA 3VQ1A 1XECA 3TSRE 3OGMB 4FMZA 1O6TA 3A79B 2UZYA 2V9SA 1H6TA 3RJ0A 2BEXA 4LXSA 4BV4R 2Z65A 1DCEA 4UFRA 3ULAA 1P9AG 4J4LA 1PGVA 3WPFA 4YEBB 3UL8A 2OMXA 5CMNA 1XWDC 4V2DA 3ULVA 1SQ0B 3UL7A 4R6FA 4EZGA 5GQRK 4H09A 2ASTB 4R5DA 4TZHA 3PMHG 4C2BB 4ARNA 2FT3A 3RFSA 4R09A 5GMFA 3M19A 4NKGA 4MQWX 4XOSA 4LSXC 3C6PB 4LI1A 2V70A 4QBZA 3RIZA 3RGXA 5FTTB 5IYXC 1OGQA 3REZA 1P8TA 3G3AA 2ID5A 5IJCA 4BSRA 3BZ5A 4CC4C 4XGOA 3W3KA 3OJAA 1FQVA 5B4PA 4PEQB 1XKUA 2OMZA 3JB9j 1QYYA 4Z61C 4ECNA 3CIGA 3WPDA 4KT1A 4V2EA 4Q3GA 1JL5A 3WN4A 3KJ4A 4CNMA 3W3LA 3E4GA 3OGKB 2V9TB 2RR6A 2JE1A 1A4YA 5D3IA 4IM6A 4FS7A 4BSSA 1M9SA 5HDHA 3E3ZA 4LSAA 2Z66A 4PQ8A 4FHOA 2O6SA 2JE0A 3RGZA 4R58A 3ZYNA 5AWAA 3W3JA 4B8CD 4FD0A 4NKHA 1OOKG 1KOHA 4RWTC 4ARRA 1OTMA 3CVRA 1O6VA 2RA8A 3E2JA 3GOZA 4FDWA 3C6OB 4LI2A 4WYKA 4OQTA 4R6JA 2Q4GW 4L3FA 1H6UA 1P8VA 3M18A 3G3BA 4R6GA 4AW4A 4MN8B 2Z7XB 1GWBA 3FXIA 4KXFB 1M0ZA 1XCDA 5CMPA 2OMYA 1FT8A 5AWBA 4RCWA 4QXEA 3ZYIA 5IJDA 1OTOA 2P1QB 2O6RA 2P1OB 2WQWA 1IO0A 4C2AB 2WQUA 4U09A 1LTXA 3W3GA 3WPBA 1O6SA 1DS9A 1FS2A 4WP6A 4FCGA 4R08A 3WPGA 4U08A 2BNHA 3RFEA 4BSUA 4Q62A 2Z81A 1KOOA 2Z64A 5HZLB 3UN9A 3O53A 1OTNA 3W3MA 3O6NA 1U0ND 2JQDA 2OMUA 1YRGA 1M10B 4ECOA 3G06A 4U7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFJ A;  5GS0 A;  4GT6 A;  4Z8G A;  1G9U A;  4XSQ A;  1D0B A;  4P8S A;  5B0N A;  2Z62 A;  4R0A A;  2XWT C;  4Z64 C;  5AZ5 A;  3P72 A;  1WWL A;  4QC0 A;  4PKI G;  2ELL A;  2XOT A;  1DFJ I;  3G04 C;  4KNG A;  3WPH A;  3C6N B;  1FO1 A;  4R5C A;  5LFN A;  2P1N B;  4CC4 A;  3G39 A;  4K17 A;  4Z79 A;  2P1M B;  2CA6 A;  2O6Q A;  4Z94 G;  2WQX A;  1M9L A;  4R07 A;  5AWC A;  4V2C A;  3RW7 A;  3WPI A;  2OMW A;  2UZX A;  3E6J A;  2OMT A;  3OJA B;  3WPC A;  2WFH A;  1K5G C;  2ASS B;  4M7E A;  1W8A A;  3DZE A;  3ULU A;  4R6A A;  2Y5Q A;  5IJB A;  4AY9 X;  3OGL B;  2P1P B;  1K5D C;  3ZYO A;  3CIY A;  4G8A A;  2R9U A;  4CP6 A;  5GMG A;  3W3N A;  4PER A;  4Q3I A;  2Z82 A;  1OZN A;  3ZYJ A;  2A0Z A;  4U06 A;  2Z7X A;  1ZIW A;  5B0T A;  4J0M A;  2OMV A;  4CNC A;  4HQ1 A;  4I6J B;  5AWD A;  4CIL A;  3RW6 A;  4LXR A;  5A5C A;  4P91 A;  4Y61 B;  3UL9 A;  3VQ2 A;  1Z7X W;  3SB4 A;  2WQV A;  2IFG A;  4M7E C;  4PSJ A;  4LSX A;  4L3A A;  5GS2 B;  3WPE A;  4LSC A;  1A9N A;  5GMH A;  2Z63 A;  4RCA B;  4GLP A;  1XEU A;  3VQ1 A;  1XEC A;  3TSR E;  3OGM B;  4FMZ A;  1O6T A;  3A79 B;  2UZY A;  2V9S A;  1H6T A;  3RJ0 A;  2BEX A;  4LXS A;  4BV4 R;  2Z65 A;  1DCE A;  4UFR A;  3ULA A;  1P9A G;  4J4L A;  1PGV A;  3WPF A;  4YEB B;  3UL8 A;  2OMX A;  5CMN A;  1XWD C;  4V2D A;  3ULV A;  1SQ0 B;  3UL7 A;  4R6F A;  4EZG A;  5GQR K;  4H09 A;  2AST B;  4R5D A;  4TZH A;  3PMH G;  4C2B B;  4ARN A;  2FT3 A;  3RFS A;  4R09 A;  5GMF A;  3M19 A;  4NKG A;  4MQW X;  4XOS A;  4LSX C;  3C6P B;  4LI1 A;  2V70 A;  4QBZ A;  3RIZ A;  3RGX A;  5FTT B;  5IYX C;  1OGQ A;  3REZ A;  1P8T A;  3G3A A;  2ID5 A;  5IJC A;  4BSR A;  3BZ5 A;  4CC4 C;  4XGO A;  3W3K A;  3OJA A;  1FQV A;  5B4P A;  4PEQ B;  1XKU A;  2OMZ A;  3JB9 j;  1QYY A;  4Z61 C;  4ECN A;  3CIG A;  3WPD A;  4KT1 A;  4V2E A;  4Q3G A;  1JL5 A;  3WN4 A;  3KJ4 A;  4CNM A;  3W3L A;  3E4G A;  3OGK B;  2V9T B;  2RR6 A;  2JE1 A;  1A4Y A;  5D3I A;  4IM6 A;  4FS7 A;  4BSS A;  1M9S A;  5HDH A;  3E3Z A;  4LSA A;  2Z66 A;  4PQ8 A;  4FHO A;  2O6S A;  2JE0 A;  3RGZ A;  4R58 A;  3ZYN A;  5AWA A;  3W3J A;  4B8C D;  4FD0 A;  4NKH A;  1OOK G;  1KOH A;  4RWT C;  4ARR A;  1OTM A;  3CVR A;  1O6V A;  2RA8 A;  3E2J A;  3GOZ A;  4FDW A;  3C6O B;  4LI2 A;  4WYK A;  4OQT A;  4R6J A;  2Q4G W;  4L3F A;  1H6U A;  1P8V A;  3M18 A;  3G3B A;  4R6G A;  4AW4 A;  4MN8 B;  2Z7X B;  1GWB A;  3FXI A;  4KXF B;  1M0Z A;  1XCD A;  5CMP A;  2OMY A;  1FT8 A;  5AWB A;  4RCW A;  4QXE A;  3ZYI A;  5IJD A;  1OTO A;  2P1Q B;  2O6R A;  2P1O B;  2WQW A;  1IO0 A;  4C2A B;  2WQU A;  4U09 A;  1LTX A;  3W3G A;  3WPB A;  1O6S A;  1DS9 A;  1FS2 A;  4WP6 A;  4FCG A;  4R08 A;  3WPG A;  4U08 A;  2BNH A;  3RFE A;  4BSU A;  4Q62 A;  2Z81 A;  1KOO A;  2Z64 A;  5HZL B;  3UN9 A;  3O53 A;  1OTN A;  3W3M A;  3O6N A;  1U0N D;  2JQD A;  2OMU A;  1YRG A;  1M10 B;  4ECO A;  3G06 A;  4U7L A; 
#chains in the Genus database with same CATH topology
 3RFJ A;  5GS0 A;  4GT6 A;  4Z8G A;  1G9U A;  4XSQ A;  1D0B A;  4P8S A;  5B0N A;  2Z62 A;  4R0A A;  2XWT C;  4Z64 C;  5AZ5 A;  3P72 A;  1WWL A;  4QC0 A;  4PKI G;  2ELL A;  2XOT A;  1DFJ I;  3G04 C;  4KNG A;  3WPH A;  3C6N B;  1FO1 A;  4R5C A;  5LFN A;  2P1N B;  4CC4 A;  3G39 A;  4K17 A;  4Z79 A;  2P1M B;  2CA6 A;  2O6Q A;  4Z94 G;  2WQX A;  1M9L A;  4R07 A;  5AWC A;  4V2C A;  3RW7 A;  3WPI A;  2OMW A;  2UZX A;  3E6J A;  2OMT A;  3OJA B;  3WPC A;  2WFH A;  1K5G C;  2ASS B;  4M7E A;  1W8A A;  3DZE A;  3ULU A;  4R6A A;  2Y5Q A;  5IJB A;  4AY9 X;  3OGL B;  2P1P B;  1K5D C;  3ZYO A;  3CIY A;  4G8A A;  2R9U A;  4CP6 A;  5GMG A;  3W3N A;  4PER A;  4Q3I A;  2Z82 A;  1OZN A;  3ZYJ A;  2A0Z A;  4U06 A;  2Z7X A;  1ZIW A;  5B0T A;  4J0M A;  2OMV A;  4CNC A;  4HQ1 A;  4I6J B;  5AWD A;  4CIL A;  3RW6 A;  4LXR A;  5A5C A;  4P91 A;  4Y61 B;  3UL9 A;  3VQ2 A;  1Z7X W;  3SB4 A;  2WQV A;  2IFG A;  4M7E C;  4PSJ A;  4LSX A;  4L3A A;  5GS2 B;  3WPE A;  4LSC A;  1A9N A;  5GMH A;  2Z63 A;  4RCA B;  4GLP A;  1XEU A;  3VQ1 A;  1XEC A;  3TSR E;  3OGM B;  4FMZ A;  1O6T A;  3A79 B;  2UZY A;  2V9S A;  1H6T A;  3RJ0 A;  2BEX A;  4LXS A;  4BV4 R;  2Z65 A;  1DCE A;  4UFR A;  3ULA A;  1P9A G;  4J4L A;  1PGV A;  3WPF A;  4YEB B;  3UL8 A;  2OMX A;  5CMN A;  1XWD C;  4V2D A;  3ULV A;  1SQ0 B;  3UL7 A;  4R6F A;  4NZT M;  4EZG A;  5GQR K;  4H09 A;  2AST B;  4R5D A;  4TZH A;  3PMH G;  4C2B B;  4ARN A;  2FT3 A;  3RFS A;  4R09 A;  5GMF A;  3M19 A;  4NKG A;  4MQW X;  4XOS A;  4LSX C;  3C6P B;  4LI1 A;  2V70 A;  4QBZ A;  3RIZ A;  3RGX A;  5FTT B;  5IYX C;  1OGQ A;  3REZ A;  1P8T A;  3G3A A;  2ID5 A;  5IJC A;  4BSR A;  3BZ5 A;  4CC4 C;  4XGO A;  3W3K A;  3OJA A;  1FQV A;  5B4P A;  4PEQ B;  1XKU A;  2OMZ A;  3JB9 j;  1QYY A;  4Z61 C;  4ECN A;  3CIG A;  3WPD A;  4KT1 A;  4V2E A;  4Q3G A;  1JL5 A;  3WN4 A;  3KJ4 A;  4CNM A;  3W3L A;  3E4G A;  3OGK B;  2V9T B;  2RR6 A;  2JE1 A;  1A4Y A;  5D3I A;  4IM6 A;  4FS7 A;  4BSS A;  1M9S A;  5HDH A;  3E3Z A;  4LSA A;  2Z66 A;  4PQ8 A;  4FHO A;  2O6S A;  2JE0 A;  3RGZ A;  4R58 A;  3ZYN A;  5AWA A;  3W3J A;  4B8C D;  4FD0 A;  4NKH A;  1OOK G;  1KOH A;  4RWT C;  4ARR A;  1OTM A;  3CVR A;  1O6V A;  2RA8 A;  3E2J A;  3GOZ A;  4FDW A;  3C6O B;  4LI2 A;  4WYK A;  4OQT A;  4R6J A;  2Q4G W;  4L3F A;  1H6U A;  1P8V A;  3M18 A;  3G3B A;  4R6G A;  4AW4 A;  4MN8 B;  2Z7X B;  1GWB A;  3FXI A;  4KXF B;  1M0Z A;  1XCD A;  5CMP A;  2OMY A;  1FT8 A;  5AWB A;  4RCW A;  4QXE A;  3ZYI A;  5IJD A;  1OTO A;  2P1Q B;  2O6R A;  2P1O B;  2WQW A;  1IO0 A;  4C2A B;  2WQU A;  4U09 A;  1LTX A;  3W3G A;  3WPB A;  1O6S A;  1DS9 A;  1FS2 A;  4WP6 A;  4FCG A;  4R08 A;  3WPG A;  4U08 A;  2BNH A;  3RFE A;  4BSU A;  4Q62 A;  2Z81 A;  1KOO A;  2Z64 A;  5HZL B;  3UN9 A;  3O53 A;  1OTN A;  3W3M A;  3O6N A;  1U0N D;  2JQD A;  2OMU A;  1YRG A;  1M10 B;  4NZR M;  4ECO A;  3G06 A;  4U7L A; 
#chains in the Genus database with same CATH homology
 3RFJ A;  5GS0 A;  4GT6 A;  4Z8G A;  1G9U A;  4XSQ A;  1D0B A;  4P8S A;  5B0N A;  2Z62 A;  4R0A A;  2XWT C;  4Z64 C;  5AZ5 A;  3P72 A;  1WWL A;  4QC0 A;  4PKI G;  2ELL A;  2XOT A;  1DFJ I;  3G04 C;  4KNG A;  3WPH A;  3C6N B;  1FO1 A;  4R5C A;  5LFN A;  2P1N B;  4CC4 A;  3G39 A;  4K17 A;  4Z79 A;  2P1M B;  2CA6 A;  2O6Q A;  4Z94 G;  2WQX A;  1M9L A;  4R07 A;  5AWC A;  4V2C A;  3RW7 A;  3WPI A;  2OMW A;  2UZX A;  3E6J A;  2OMT A;  3OJA B;  3WPC A;  2WFH A;  1K5G C;  2ASS B;  4M7E A;  1W8A A;  3DZE A;  3ULU A;  4R6A A;  2Y5Q A;  5IJB A;  4AY9 X;  3OGL B;  2P1P B;  1K5D C;  3ZYO A;  3CIY A;  4G8A A;  2R9U A;  4CP6 A;  5GMG A;  3W3N A;  4PER A;  4Q3I A;  2Z82 A;  1OZN A;  3ZYJ A;  2A0Z A;  4U06 A;  2Z7X A;  1ZIW A;  5B0T A;  4J0M A;  2OMV A;  4CNC A;  4HQ1 A;  4I6J B;  5AWD A;  4CIL A;  3RW6 A;  4LXR A;  5A5C A;  4P91 A;  4Y61 B;  3UL9 A;  3VQ2 A;  1Z7X W;  3SB4 A;  2WQV A;  2IFG A;  4M7E C;  4PSJ A;  4LSX A;  4L3A A;  5GS2 B;  3WPE A;  4LSC A;  1A9N A;  5GMH A;  2Z63 A;  4RCA B;  4GLP A;  1XEU A;  3VQ1 A;  1XEC A;  3TSR E;  3OGM B;  4FMZ A;  1O6T A;  3A79 B;  2UZY A;  2V9S A;  1H6T A;  3RJ0 A;  2BEX A;  4LXS A;  4BV4 R;  2Z65 A;  1DCE A;  4UFR A;  3ULA A;  1P9A G;  4J4L A;  1PGV A;  3WPF A;  4YEB B;  3UL8 A;  2OMX A;  5CMN A;  1XWD C;  4V2D A;  3ULV A;  1SQ0 B;  3UL7 A;  4R6F A;  4EZG A;  5GQR K;  4H09 A;  2AST B;  4R5D A;  4TZH A;  3PMH G;  4C2B B;  4ARN A;  2FT3 A;  3RFS A;  4R09 A;  5GMF A;  3M19 A;  4NKG A;  4MQW X;  4XOS A;  4LSX C;  3C6P B;  4LI1 A;  2V70 A;  4QBZ A;  3RIZ A;  3RGX A;  5FTT B;  5IYX C;  1OGQ A;  3REZ A;  1P8T A;  3G3A A;  2ID5 A;  5IJC A;  4BSR A;  3BZ5 A;  4CC4 C;  4XGO A;  3W3K A;  3OJA A;  1FQV A;  5B4P A;  4PEQ B;  1XKU A;  2OMZ A;  3JB9 j;  1QYY A;  4Z61 C;  4ECN A;  3CIG A;  3WPD A;  4KT1 A;  4V2E A;  4Q3G A;  1JL5 A;  3WN4 A;  3KJ4 A;  4CNM A;  3W3L A;  3E4G A;  3OGK B;  2V9T B;  2RR6 A;  2JE1 A;  1A4Y A;  5D3I A;  4IM6 A;  4FS7 A;  4BSS A;  1M9S A;  5HDH A;  3E3Z A;  4LSA A;  2Z66 A;  4PQ8 A;  4FHO A;  2O6S A;  2JE0 A;  3RGZ A;  4R58 A;  3ZYN A;  5AWA A;  3W3J A;  4B8C D;  4FD0 A;  4NKH A;  1OOK G;  1KOH A;  4RWT C;  4ARR A;  1OTM A;  3CVR A;  1O6V A;  2RA8 A;  3E2J A;  3GOZ A;  4FDW A;  3C6O B;  4LI2 A;  4WYK A;  4OQT A;  4R6J A;  2Q4G W;  4L3F A;  1H6U A;  1P8V A;  3M18 A;  3G3B A;  4R6G A;  4AW4 A;  4MN8 B;  2Z7X B;  1GWB A;  3FXI A;  4KXF B;  1M0Z A;  1XCD A;  5CMP A;  2OMY A;  1FT8 A;  5AWB A;  4RCW A;  4QXE A;  3ZYI A;  5IJD A;  1OTO A;  2P1Q B;  2O6R A;  2P1O B;  2WQW A;  1IO0 A;  4C2A B;  2WQU A;  4U09 A;  1LTX A;  3W3G A;  3WPB A;  1O6S A;  1DS9 A;  1FS2 A;  4WP6 A;  4FCG A;  4R08 A;  3WPG A;  4U08 A;  2BNH A;  3RFE A;  4BSU A;  4Q62 A;  2Z81 A;  1KOO A;  2Z64 A;  5HZL B;  3UN9 A;  3O53 A;  1OTN A;  3W3M A;  3O6N A;  1U0N D;  2JQD A;  2OMU A;  1YRG A;  1M10 B;  4ECO A;  3G06 A;  4U7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...