1QYYA

Crystal structure of n-terminal domain of human platelet receptor glycoprotein ib-alpha at 2.8 angstrom resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
266
structure length
266
Chain Sequence
HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib alpha chain
publication title Platinum-induced space-group transformation in crystals of the platelet glycoprotein Ib alpha N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 69
structure length 266
sequence length 266
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1qyyA00
2OMWA 4U7LA 4R6JA 5GS0A 4XSQA 4Z79A 2Z81A 4C2AB 3C6OB 1KOOA 4Z8GA 4IM6A 5AWCA 3DZEA 2P1QB 2RA8A 2Y5QA 3CVRA 5CMNA 3WPEA 4C2BB 2V9TB 5AWDA 3ZYJA 4R5DA 1XWDC 4KNGA 5GMGA 2Z65A 4ECNA 4R6FA 3OGLB 4J0MA 5B0NA 4L3AA 1W8AA 3WPBA 4AY9X 4J4LA 4ARNA 3O6NA 4AW4A 4GT6A 3CIYA 3OGKB 5IYXC 1KOHA 3E6JA 5IJDA 1P9AG 4LSAA 3O53A 1SQ0B 2P1OB 4BSUA 5B0TA 3SB4A 4BSRA 1FQVA 4WYKA 3ULAA 1PGVA 4LSXA 2R9UA 1G9UA 1LTXA 4Z61C 4FS7A 4G8AA 3WPHA 4P8SA 5B4PA 4BV4R 4Z64C 1OGQA 4PSJA 3JB9j 4LXSA 2P1NB 4M7EC 3REZA 4V2CA 3G06A 3UL9A 4TZHA 3ZYIA 2WQUA 2XOTA 2IFGA 3WPIA 2Z7XB 2FT3A 4R5CA 4QBZA 4KT1A 2Z7XA 2V70A 2Z64A 4V2EA 2A0ZA 3WPCA 1XCDA 4R09A 5GS2B 3WPFA 2O6RA 2Z62A 4OQTA 4QXEA 3RW7A 1OOKG 2P1MB 4U09A 2UZXA 4WP6A 1JL5A 1P8TA 3P72A 4LI2A 1O6SA 4FD0A 2P1PB 5A5CA 4XGOA 5AWBA 2Z66A 1ZIWA 2BEXA 4PEQB 4Y61B 3RGXA 5FTTB 1GWBA 3RFJA 1D0BA 2CA6A 1QYYA 4NKHA 2WQVA 4H09A 4Z94G 4L3FA 3WPDA 4R6GA 5HZLB 3C6NB 4NKGA 4Q62A 1H6UA 2RR6A 1OTMA 4CNMA 4HQ1A 2OMVA 1IO0A 3RIZA 3ZYNA 4B8CD 3E4GA 3G3AA 4BSSA 4QC0A 1XEUA 3W3JA 2Q4GW 4RCWA 1DS9A 4FHOA 1DFJI 5HDHA 2WQXA 5GMHA 1YRGA 4Q3IA 5D3IA 1K5GC 3VQ2A 4XOSA 1OTOA 2Z82A 1DCEA 1FO1A 2OMZA 4K17A 5AWAA 1OZNA 2OMTA 2O6SA 2XWTC 1M9SA 1M10B 1O6TA 3RFSA 2OMYA 2UZYA 3RJ0A 2WFHA 2ASTB 5LFNA 3G39A 5GQRK 4EZGA 4CC4C 4FCGA 3W3MA 4R08A 1Z7XW 3ULUA 3W3LA 3E3ZA 3OGMB 3VQ1A 3G04C 1OTNA 4PQ8A 1P8VA 3CIGA 4R6AA 3W3GA 4RCAB 3TSRE 5GMFA 5IJBA 3C6PB 4LI1A 4Q3GA 4CNCA 3W3NA 1A9NA 4KXFB 3PMHG 4P91A 3UL8A 5IJCA 4FMZA 1XKUA 2ASSB 3RW6A 1O6VA 2JQDA 4R0AA 2Z63A 3M19A 3UN9A 4I6JB 3RFEA 1M0ZA 1K5DC 3KJ4A 4PKIG 2OMUA 3G3BA 2JE1A 2WQWA 3GOZA 4FDWA 4MQWX 1U0ND 4PERA 1M9LA 3W3KA 3A79B 4CP6A 4LXRA 4ECOA 1A4YA 3E2JA 4M7EA 2BNHA 1FT8A 2ELLA 4GLPA 3M18A 4V2DA 5AZ5A 4UFRA 4LSXC 2V9SA 4LSCA 4R58A 2OMXA 2ID5A 3OJAB 3WN4A 3WPGA 4ARRA 4U06A 1XECA 4U08A 1WWLA 3FXIA 3OJAA 3ZYOA 3UL7A 4RWTC 5CMPA 2JE0A 4CILA 4MN8B 4R07A 1H6TA 4CC4A 3ULVA 3BZ5A 3RGZA 2O6QA 4YEBB 1FS2A
chains in the Genus database with same CATH superfamily
2OMWA 4U7LA 4R6JA 5GS0A 4XSQA 4Z79A 2Z81A 4C2AB 3C6OB 1KOOA 4Z8GA 4IM6A 5AWCA 3DZEA 2P1QB 2RA8A 2Y5QA 3CVRA 5CMNA 3WPEA 4C2BB 2V9TB 5AWDA 3ZYJA 4R5DA 1XWDC 4KNGA 5GMGA 2Z65A 4ECNA 4R6FA 3OGLB 4J0MA 5B0NA 4L3AA 1W8AA 3WPBA 4AY9X 4J4LA 4ARNA 3O6NA 4AW4A 4GT6A 3CIYA 3OGKB 5IYXC 1KOHA 3E6JA 5IJDA 1P9AG 4LSAA 3O53A 1SQ0B 2P1OB 4BSUA 5B0TA 3SB4A 4BSRA 1FQVA 4NZRM 4WYKA 3ULAA 1PGVA 4LSXA 2R9UA 1G9UA 1LTXA 4Z61C 4FS7A 4G8AA 3WPHA 4P8SA 5B4PA 4BV4R 4Z64C 1OGQA 4PSJA 3JB9j 4LXSA 2P1NB 4M7EC 3REZA 4V2CA 3G06A 3UL9A 4TZHA 3ZYIA 2WQUA 2XOTA 2IFGA 3WPIA 2Z7XB 2FT3A 4R5CA 4QBZA 4KT1A 2Z7XA 2V70A 2Z64A 4V2EA 2A0ZA 3WPCA 1XCDA 4R09A 5GS2B 3WPFA 2O6RA 2Z62A 4OQTA 4QXEA 3RW7A 1OOKG 2P1MB 4U09A 2UZXA 4WP6A 1JL5A 1P8TA 3P72A 4LI2A 1O6SA 4FD0A 2P1PB 5A5CA 4XGOA 5AWBA 2Z66A 1ZIWA 4NZTM 2BEXA 4PEQB 4Y61B 3RGXA 5FTTB 1GWBA 3RFJA 1D0BA 2CA6A 1QYYA 4NKHA 2WQVA 4H09A 4Z94G 4L3FA 3WPDA 4R6GA 5HZLB 3C6NB 4NKGA 4Q62A 1H6UA 2RR6A 1OTMA 4CNMA 4HQ1A 2OMVA 1IO0A 3RIZA 3ZYNA 4B8CD 3E4GA 3G3AA 4BSSA 4QC0A 1XEUA 3W3JA 2Q4GW 4RCWA 1DS9A 4FHOA 1DFJI 5HDHA 2WQXA 5GMHA 1YRGA 4Q3IA 5D3IA 1K5GC 3VQ2A 4XOSA 1OTOA 2Z82A 1DCEA 1FO1A 2OMZA 4K17A 5AWAA 1OZNA 2OMTA 2O6SA 2XWTC 1M9SA 1M10B 1O6TA 3RFSA 2OMYA 2UZYA 3RJ0A 2WFHA 2ASTB 5LFNA 3G39A 5GQRK 4EZGA 4CC4C 4FCGA 3W3MA 4R08A 1Z7XW 3ULUA 3W3LA 3E3ZA 3OGMB 3VQ1A 3G04C 1OTNA 4PQ8A 1P8VA 3CIGA 4R6AA 3W3GA 4RCAB 3TSRE 5GMFA 5IJBA 3C6PB 4LI1A 4Q3GA 4CNCA 3W3NA 4KXFB 1A9NA 3PMHG 4P91A 3UL8A 5IJCA 4FMZA 1XKUA 2ASSB 3RW6A 1O6VA 2JQDA 4R0AA 2Z63A 3M19A 3UN9A 4I6JB 3RFEA 1M0ZA 1K5DC 3KJ4A 4PKIG 2OMUA 3G3BA 2JE1A 2WQWA 3GOZA 4FDWA 4MQWX 1U0ND 4PERA 1M9LA 3W3KA 3A79B 4CP6A 4LXRA 4ECOA 1A4YA 3E2JA 4M7EA 2BNHA 1FT8A 2ELLA 4GLPA 3M18A 4V2DA 5AZ5A 4UFRA 4LSXC 2V9SA 4LSCA 4R58A 2OMXA 2ID5A 3OJAB 3WN4A 3WPGA 4ARRA 4U06A 1XECA 4U08A 1WWLA 3FXIA 3OJAA 3ZYOA 3UL7A 4RWTC 5CMPA 2JE0A 4CILA 4MN8B 4R07A 1H6TA 4CC4A 3ULVA 3BZ5A 3RGZA 2O6QA 4YEBB 1FS2A
chains in the Genus database with same CATH topology
2OMWA 4U7LA 4R6JA 5GS0A 4XSQA 4Z79A 2Z81A 4C2AB 3C6OB 1KOOA 4Z8GA 4IM6A 5AWCA 3DZEA 2P1QB 2RA8A 2Y5QA 3CVRA 5CMNA 3WPEA 4C2BB 2V9TB 5AWDA 3ZYJA 4R5DA 1XWDC 4KNGA 5GMGA 2Z65A 4ECNA 4R6FA 3OGLB 4J0MA 5B0NA 4L3AA 1W8AA 3WPBA 4AY9X 4J4LA 4ARNA 3O6NA 4AW4A 4GT6A 3CIYA 3OGKB 5IYXC 1KOHA 3E6JA 5IJDA 1P9AG 4LSAA 3O53A 1SQ0B 2P1OB 4BSUA 5B0TA 3SB4A 4BSRA 1FQVA 4WYKA 3ULAA 1PGVA 4LSXA 2R9UA 1G9UA 1LTXA 4Z61C 4FS7A 4G8AA 3WPHA 4P8SA 5B4PA 4BV4R 4Z64C 1OGQA 4PSJA 3JB9j 4LXSA 2P1NB 4M7EC 3REZA 4V2CA 3G06A 3UL9A 4TZHA 3ZYIA 2WQUA 2XOTA 2IFGA 3WPIA 2Z7XB 2FT3A 4R5CA 4QBZA 4KT1A 2Z7XA 2V70A 2Z64A 4V2EA 2A0ZA 3WPCA 1XCDA 4R09A 5GS2B 3WPFA 2O6RA 2Z62A 4OQTA 4QXEA 3RW7A 1OOKG 2P1MB 4U09A 2UZXA 4WP6A 1JL5A 1P8TA 3P72A 4LI2A 1O6SA 4FD0A 2P1PB 5A5CA 4XGOA 5AWBA 2Z66A 1ZIWA 2BEXA 4PEQB 4Y61B 3RGXA 5FTTB 1GWBA 3RFJA 1D0BA 2CA6A 1QYYA 4NKHA 2WQVA 4H09A 4Z94G 4L3FA 3WPDA 4R6GA 5HZLB 3C6NB 4NKGA 4Q62A 1H6UA 2RR6A 1OTMA 4CNMA 4HQ1A 2OMVA 1IO0A 3RIZA 3ZYNA 4B8CD 3E4GA 3G3AA 4BSSA 4QC0A 1XEUA 3W3JA 2Q4GW 4RCWA 1DS9A 4FHOA 1DFJI 5HDHA 2WQXA 5GMHA 1YRGA 4Q3IA 5D3IA 1K5GC 3VQ2A 4XOSA 1OTOA 2Z82A 1DCEA 1FO1A 2OMZA 4K17A 5AWAA 1OZNA 2OMTA 2O6SA 2XWTC 1M9SA 1M10B 1O6TA 3RFSA 2OMYA 2UZYA 3RJ0A 2WFHA 2ASTB 5LFNA 3G39A 5GQRK 4EZGA 4CC4C 4FCGA 3W3MA 4R08A 1Z7XW 3ULUA 3W3LA 3E3ZA 3OGMB 3VQ1A 3G04C 1OTNA 4PQ8A 1P8VA 3CIGA 4R6AA 3W3GA 4RCAB 3TSRE 5GMFA 5IJBA 3C6PB 4LI1A 4Q3GA 4CNCA 3W3NA 1A9NA 4KXFB 3PMHG 4P91A 3UL8A 5IJCA 4FMZA 1XKUA 2ASSB 3RW6A 1O6VA 2JQDA 4R0AA 2Z63A 3M19A 3UN9A 4I6JB 3RFEA 1M0ZA 1K5DC 3KJ4A 4PKIG 2OMUA 3G3BA 2JE1A 2WQWA 3GOZA 4FDWA 4MQWX 1U0ND 4PERA 1M9LA 3W3KA 3A79B 4CP6A 4LXRA 4ECOA 1A4YA 3E2JA 4M7EA 2BNHA 1FT8A 2ELLA 4GLPA 3M18A 4V2DA 5AZ5A 4UFRA 4LSXC 2V9SA 4LSCA 4R58A 2OMXA 2ID5A 3OJAB 3WN4A 3WPGA 4ARRA 4U06A 1XECA 4U08A 1WWLA 3FXIA 3OJAA 3ZYOA 3UL7A 4RWTC 5CMPA 2JE0A 4CILA 4MN8B 4R07A 1H6TA 4CC4A 3ULVA 3BZ5A 3RGZA 2O6QA 4YEBB 1FS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMW A;  4U7L A;  4R6J A;  5GS0 A;  4XSQ A;  4Z79 A;  2Z81 A;  4C2A B;  3C6O B;  1KOO A;  4Z8G A;  4IM6 A;  5AWC A;  3DZE A;  2P1Q B;  2RA8 A;  2Y5Q A;  3CVR A;  5CMN A;  3WPE A;  4C2B B;  2V9T B;  5AWD A;  3ZYJ A;  4R5D A;  1XWD C;  4KNG A;  5GMG A;  2Z65 A;  4ECN A;  4R6F A;  3OGL B;  4J0M A;  5B0N A;  4L3A A;  1W8A A;  3WPB A;  4AY9 X;  4J4L A;  4ARN A;  3O6N A;  4AW4 A;  4GT6 A;  3CIY A;  3OGK B;  5IYX C;  1KOH A;  3E6J A;  5IJD A;  1P9A G;  4LSA A;  3O53 A;  1SQ0 B;  2P1O B;  4BSU A;  5B0T A;  3SB4 A;  4BSR A;  1FQV A;  4WYK A;  3ULA A;  1PGV A;  4LSX A;  2R9U A;  1G9U A;  1LTX A;  4Z61 C;  4FS7 A;  4G8A A;  3WPH A;  4P8S A;  5B4P A;  4BV4 R;  4Z64 C;  1OGQ A;  4PSJ A;  3JB9 j;  4LXS A;  2P1N B;  4M7E C;  3REZ A;  4V2C A;  3G06 A;  3UL9 A;  4TZH A;  3ZYI A;  2WQU A;  2XOT A;  2IFG A;  3WPI A;  2Z7X B;  2FT3 A;  4R5C A;  4QBZ A;  4KT1 A;  2Z7X A;  2V70 A;  2Z64 A;  4V2E A;  2A0Z A;  3WPC A;  1XCD A;  4R09 A;  5GS2 B;  3WPF A;  2O6R A;  2Z62 A;  4OQT A;  4QXE A;  3RW7 A;  1OOK G;  2P1M B;  4U09 A;  2UZX A;  4WP6 A;  1JL5 A;  1P8T A;  3P72 A;  4LI2 A;  1O6S A;  4FD0 A;  2P1P B;  5A5C A;  4XGO A;  5AWB A;  2Z66 A;  1ZIW A;  2BEX A;  4PEQ B;  4Y61 B;  3RGX A;  5FTT B;  1GWB A;  3RFJ A;  1D0B A;  2CA6 A;  1QYY A;  4NKH A;  2WQV A;  4H09 A;  4Z94 G;  4L3F A;  3WPD A;  4R6G A;  5HZL B;  3C6N B;  4NKG A;  4Q62 A;  1H6U A;  2RR6 A;  1OTM A;  4CNM A;  4HQ1 A;  2OMV A;  1IO0 A;  3RIZ A;  3ZYN A;  4B8C D;  3E4G A;  3G3A A;  4BSS A;  4QC0 A;  1XEU A;  3W3J A;  2Q4G W;  4RCW A;  1DS9 A;  4FHO A;  1DFJ I;  5HDH A;  2WQX A;  5GMH A;  1YRG A;  4Q3I A;  5D3I A;  1K5G C;  3VQ2 A;  4XOS A;  1OTO A;  2Z82 A;  1DCE A;  1FO1 A;  2OMZ A;  4K17 A;  5AWA A;  1OZN A;  2OMT A;  2O6S A;  2XWT C;  1M9S A;  1M10 B;  1O6T A;  3RFS A;  2OMY A;  2UZY A;  3RJ0 A;  2WFH A;  2AST B;  5LFN A;  3G39 A;  5GQR K;  4EZG A;  4CC4 C;  4FCG A;  3W3M A;  4R08 A;  1Z7X W;  3ULU A;  3W3L A;  3E3Z A;  3OGM B;  3VQ1 A;  3G04 C;  1OTN A;  4PQ8 A;  1P8V A;  3CIG A;  4R6A A;  3W3G A;  4RCA B;  3TSR E;  5GMF A;  5IJB A;  3C6P B;  4LI1 A;  4Q3G A;  4CNC A;  3W3N A;  1A9N A;  4KXF B;  3PMH G;  4P91 A;  3UL8 A;  5IJC A;  4FMZ A;  1XKU A;  2ASS B;  3RW6 A;  1O6V A;  2JQD A;  4R0A A;  2Z63 A;  3M19 A;  3UN9 A;  4I6J B;  3RFE A;  1M0Z A;  1K5D C;  3KJ4 A;  4PKI G;  2OMU A;  3G3B A;  2JE1 A;  2WQW A;  3GOZ A;  4FDW A;  4MQW X;  1U0N D;  4PER A;  1M9L A;  3W3K A;  3A79 B;  4CP6 A;  4LXR A;  4ECO A;  1A4Y A;  3E2J A;  4M7E A;  2BNH A;  1FT8 A;  2ELL A;  4GLP A;  3M18 A;  4V2D A;  5AZ5 A;  4UFR A;  4LSX C;  2V9S A;  4LSC A;  4R58 A;  2OMX A;  2ID5 A;  3OJA B;  3WN4 A;  3WPG A;  4ARR A;  4U06 A;  1XEC A;  4U08 A;  1WWL A;  3FXI A;  3OJA A;  3ZYO A;  3UL7 A;  4RWT C;  5CMP A;  2JE0 A;  4CIL A;  4MN8 B;  4R07 A;  1H6T A;  4CC4 A;  3ULV A;  3BZ5 A;  3RGZ A;  2O6Q A;  4YEB B;  1FS2 A; 
#chains in the Genus database with same CATH topology
 2OMW A;  4U7L A;  4R6J A;  5GS0 A;  4XSQ A;  4Z79 A;  2Z81 A;  4C2A B;  3C6O B;  1KOO A;  4Z8G A;  4IM6 A;  5AWC A;  3DZE A;  2P1Q B;  2RA8 A;  2Y5Q A;  3CVR A;  5CMN A;  3WPE A;  4C2B B;  2V9T B;  5AWD A;  3ZYJ A;  4R5D A;  1XWD C;  4KNG A;  5GMG A;  2Z65 A;  4ECN A;  4R6F A;  3OGL B;  4J0M A;  5B0N A;  4L3A A;  1W8A A;  3WPB A;  4AY9 X;  4J4L A;  4ARN A;  3O6N A;  4AW4 A;  4GT6 A;  3CIY A;  3OGK B;  5IYX C;  1KOH A;  3E6J A;  5IJD A;  1P9A G;  4LSA A;  3O53 A;  1SQ0 B;  2P1O B;  4BSU A;  5B0T A;  3SB4 A;  4BSR A;  1FQV A;  4NZR M;  4WYK A;  3ULA A;  1PGV A;  4LSX A;  2R9U A;  1G9U A;  1LTX A;  4Z61 C;  4FS7 A;  4G8A A;  3WPH A;  4P8S A;  5B4P A;  4BV4 R;  4Z64 C;  1OGQ A;  4PSJ A;  3JB9 j;  4LXS A;  2P1N B;  4M7E C;  3REZ A;  4V2C A;  3G06 A;  3UL9 A;  4TZH A;  3ZYI A;  2WQU A;  2XOT A;  2IFG A;  3WPI A;  2Z7X B;  2FT3 A;  4R5C A;  4QBZ A;  4KT1 A;  2Z7X A;  2V70 A;  2Z64 A;  4V2E A;  2A0Z A;  3WPC A;  1XCD A;  4R09 A;  5GS2 B;  3WPF A;  2O6R A;  2Z62 A;  4OQT A;  4QXE A;  3RW7 A;  1OOK G;  2P1M B;  4U09 A;  2UZX A;  4WP6 A;  1JL5 A;  1P8T A;  3P72 A;  4LI2 A;  1O6S A;  4FD0 A;  2P1P B;  5A5C A;  4XGO A;  5AWB A;  2Z66 A;  1ZIW A;  4NZT M;  2BEX A;  4PEQ B;  4Y61 B;  3RGX A;  5FTT B;  1GWB A;  3RFJ A;  1D0B A;  2CA6 A;  1QYY A;  4NKH A;  2WQV A;  4H09 A;  4Z94 G;  4L3F A;  3WPD A;  4R6G A;  5HZL B;  3C6N B;  4NKG A;  4Q62 A;  1H6U A;  2RR6 A;  1OTM A;  4CNM A;  4HQ1 A;  2OMV A;  1IO0 A;  3RIZ A;  3ZYN A;  4B8C D;  3E4G A;  3G3A A;  4BSS A;  4QC0 A;  1XEU A;  3W3J A;  2Q4G W;  4RCW A;  1DS9 A;  4FHO A;  1DFJ I;  5HDH A;  2WQX A;  5GMH A;  1YRG A;  4Q3I A;  5D3I A;  1K5G C;  3VQ2 A;  4XOS A;  1OTO A;  2Z82 A;  1DCE A;  1FO1 A;  2OMZ A;  4K17 A;  5AWA A;  1OZN A;  2OMT A;  2O6S A;  2XWT C;  1M9S A;  1M10 B;  1O6T A;  3RFS A;  2OMY A;  2UZY A;  3RJ0 A;  2WFH A;  2AST B;  5LFN A;  3G39 A;  5GQR K;  4EZG A;  4CC4 C;  4FCG A;  3W3M A;  4R08 A;  1Z7X W;  3ULU A;  3W3L A;  3E3Z A;  3OGM B;  3VQ1 A;  3G04 C;  1OTN A;  4PQ8 A;  1P8V A;  3CIG A;  4R6A A;  3W3G A;  4RCA B;  3TSR E;  5GMF A;  5IJB A;  3C6P B;  4LI1 A;  4Q3G A;  4CNC A;  3W3N A;  4KXF B;  1A9N A;  3PMH G;  4P91 A;  3UL8 A;  5IJC A;  4FMZ A;  1XKU A;  2ASS B;  3RW6 A;  1O6V A;  2JQD A;  4R0A A;  2Z63 A;  3M19 A;  3UN9 A;  4I6J B;  3RFE A;  1M0Z A;  1K5D C;  3KJ4 A;  4PKI G;  2OMU A;  3G3B A;  2JE1 A;  2WQW A;  3GOZ A;  4FDW A;  4MQW X;  1U0N D;  4PER A;  1M9L A;  3W3K A;  3A79 B;  4CP6 A;  4LXR A;  4ECO A;  1A4Y A;  3E2J A;  4M7E A;  2BNH A;  1FT8 A;  2ELL A;  4GLP A;  3M18 A;  4V2D A;  5AZ5 A;  4UFR A;  4LSX C;  2V9S A;  4LSC A;  4R58 A;  2OMX A;  2ID5 A;  3OJA B;  3WN4 A;  3WPG A;  4ARR A;  4U06 A;  1XEC A;  4U08 A;  1WWL A;  3FXI A;  3OJA A;  3ZYO A;  3UL7 A;  4RWT C;  5CMP A;  2JE0 A;  4CIL A;  4MN8 B;  4R07 A;  1H6T A;  4CC4 A;  3ULV A;  3BZ5 A;  3RGZ A;  2O6Q A;  4YEB B;  1FS2 A; 
#chains in the Genus database with same CATH homology
 2OMW A;  4U7L A;  4R6J A;  5GS0 A;  4XSQ A;  4Z79 A;  2Z81 A;  4C2A B;  3C6O B;  1KOO A;  4Z8G A;  4IM6 A;  5AWC A;  3DZE A;  2P1Q B;  2RA8 A;  2Y5Q A;  3CVR A;  5CMN A;  3WPE A;  4C2B B;  2V9T B;  5AWD A;  3ZYJ A;  4R5D A;  1XWD C;  4KNG A;  5GMG A;  2Z65 A;  4ECN A;  4R6F A;  3OGL B;  4J0M A;  5B0N A;  4L3A A;  1W8A A;  3WPB A;  4AY9 X;  4J4L A;  4ARN A;  3O6N A;  4AW4 A;  4GT6 A;  3CIY A;  3OGK B;  5IYX C;  1KOH A;  3E6J A;  5IJD A;  1P9A G;  4LSA A;  3O53 A;  1SQ0 B;  2P1O B;  4BSU A;  5B0T A;  3SB4 A;  4BSR A;  1FQV A;  4WYK A;  3ULA A;  1PGV A;  4LSX A;  2R9U A;  1G9U A;  1LTX A;  4Z61 C;  4FS7 A;  4G8A A;  3WPH A;  4P8S A;  5B4P A;  4BV4 R;  4Z64 C;  1OGQ A;  4PSJ A;  3JB9 j;  4LXS A;  2P1N B;  4M7E C;  3REZ A;  4V2C A;  3G06 A;  3UL9 A;  4TZH A;  3ZYI A;  2WQU A;  2XOT A;  2IFG A;  3WPI A;  2Z7X B;  2FT3 A;  4R5C A;  4QBZ A;  4KT1 A;  2Z7X A;  2V70 A;  2Z64 A;  4V2E A;  2A0Z A;  3WPC A;  1XCD A;  4R09 A;  5GS2 B;  3WPF A;  2O6R A;  2Z62 A;  4OQT A;  4QXE A;  3RW7 A;  1OOK G;  2P1M B;  4U09 A;  2UZX A;  4WP6 A;  1JL5 A;  1P8T A;  3P72 A;  4LI2 A;  1O6S A;  4FD0 A;  2P1P B;  5A5C A;  4XGO A;  5AWB A;  2Z66 A;  1ZIW A;  2BEX A;  4PEQ B;  4Y61 B;  3RGX A;  5FTT B;  1GWB A;  3RFJ A;  1D0B A;  2CA6 A;  1QYY A;  4NKH A;  2WQV A;  4H09 A;  4Z94 G;  4L3F A;  3WPD A;  4R6G A;  5HZL B;  3C6N B;  4NKG A;  4Q62 A;  1H6U A;  2RR6 A;  1OTM A;  4CNM A;  4HQ1 A;  2OMV A;  1IO0 A;  3RIZ A;  3ZYN A;  4B8C D;  3E4G A;  3G3A A;  4BSS A;  4QC0 A;  1XEU A;  3W3J A;  2Q4G W;  4RCW A;  1DS9 A;  4FHO A;  1DFJ I;  5HDH A;  2WQX A;  5GMH A;  1YRG A;  4Q3I A;  5D3I A;  1K5G C;  3VQ2 A;  4XOS A;  1OTO A;  2Z82 A;  1DCE A;  1FO1 A;  2OMZ A;  4K17 A;  5AWA A;  1OZN A;  2OMT A;  2O6S A;  2XWT C;  1M9S A;  1M10 B;  1O6T A;  3RFS A;  2OMY A;  2UZY A;  3RJ0 A;  2WFH A;  2AST B;  5LFN A;  3G39 A;  5GQR K;  4EZG A;  4CC4 C;  4FCG A;  3W3M A;  4R08 A;  1Z7X W;  3ULU A;  3W3L A;  3E3Z A;  3OGM B;  3VQ1 A;  3G04 C;  1OTN A;  4PQ8 A;  1P8V A;  3CIG A;  4R6A A;  3W3G A;  4RCA B;  3TSR E;  5GMF A;  5IJB A;  3C6P B;  4LI1 A;  4Q3G A;  4CNC A;  3W3N A;  1A9N A;  4KXF B;  3PMH G;  4P91 A;  3UL8 A;  5IJC A;  4FMZ A;  1XKU A;  2ASS B;  3RW6 A;  1O6V A;  2JQD A;  4R0A A;  2Z63 A;  3M19 A;  3UN9 A;  4I6J B;  3RFE A;  1M0Z A;  1K5D C;  3KJ4 A;  4PKI G;  2OMU A;  3G3B A;  2JE1 A;  2WQW A;  3GOZ A;  4FDW A;  4MQW X;  1U0N D;  4PER A;  1M9L A;  3W3K A;  3A79 B;  4CP6 A;  4LXR A;  4ECO A;  1A4Y A;  3E2J A;  4M7E A;  2BNH A;  1FT8 A;  2ELL A;  4GLP A;  3M18 A;  4V2D A;  5AZ5 A;  4UFR A;  4LSX C;  2V9S A;  4LSC A;  4R58 A;  2OMX A;  2ID5 A;  3OJA B;  3WN4 A;  3WPG A;  4ARR A;  4U06 A;  1XEC A;  4U08 A;  1WWL A;  3FXI A;  3OJA A;  3ZYO A;  3UL7 A;  4RWT C;  5CMP A;  2JE0 A;  4CIL A;  4MN8 B;  4R07 A;  1H6T A;  4CC4 A;  3ULV A;  3BZ5 A;  3RGZ A;  2O6Q A;  4YEB B;  1FS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...