3E2JA

Crystal structure of bovine coupling factor b
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
FWGWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords ATP synthase subunit s, mitochondrial
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
source organism Bos taurus
total genus 60
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3e2jA00
3ULVA 4PEQB 4B8CD 5IJCA 4ARRA 1XEUA 2RR6A 2RA8A 2WQUA 3W3JA 4R5DA 4M7EC 5A5CA 3OGKB 2OMTA 5AWAA 2OMWA 3FXIA 2ELLA 4LSAA 5IJDA 1FQVA 1G9UA 1K5DC 3WPIA 2Z81A 2FT3A 1DS9A 4PQ8A 4ECNA 2Q4GW 2Z66A 2O6QA 5IYXC 2Z63A 4FDWA 2R9UA 5GS0A 2BEXA 2WQVA 3O53A 3SB4A 4LXRA 1FO1A 4R58A 4Z64C 2O6SA 3G06A 4CC4A 4HQ1A 3E6JA 2JE0A 4YEBB 1ZIWA 1H6UA 1Z7XW 3RW6A 2Y5QA 1P8VA 3RFSA 2OMVA 3UL8A 4NKGA 4V2CA 1QYYA 5HDHA 4GT6A 4FMZA 4Z61C 1OZNA 1W8AA 3WPGA 4U09A 3E4GA 3W3NA 3OGLB 2ASTB 4FHOA 5GMFA 2OMUA 1JL5A 5AZ5A 1KOOA 4CILA 3W3MA 4C2BB 2UZYA 4PERA 3ZYOA 4R6FA 2OMXA 1SQ0B 1OTMA 2Z7XA 5AWBA 4CP6A 4RWTC 4R0AA 2P1QB 1XECA 3W3KA 4IM6A 4M7EA 4BV4R 4TZHA 3C6OB 4H09A 1M9LA 1FT8A 5FTTB 4U06A 5GS2B 3WPBA 4QC0A 2JQDA 5B4PA 1P9AG 3WPHA 1P8TA 3RFEA 4AY9X 2UZXA 2ASSB 2A0ZA 4LSCA 3ULUA 4U7LA 4CNCA 3UL9A 4AW4A 3RGZA 1XWDC 4LXSA 4Q62A 1A4YA 3ULAA 1OTNA 4PKIG 2WQXA 5CMNA 3TSRE 3RIZA 2Z82A 3W3LA 2O6RA 5HZLB 4FCGA 1DFJI 2V9TB 4J0MA 5AWDA 4LSXC 3G3AA 3OJAA 4P8SA 4OQTA 4BSRA 1GWBA 3KJ4A 4R08A 1DCEA 3PMHG 4C2AB 1FS2A 3ZYJA 5AWCA 4Q3GA 3RW7A 5GQRK 4QBZA 3ZYIA 3RGXA 4RCAB 3WN4A 2XOTA 4V2DA 4XGOA 2CA6A 3M19A 3REZA 1M0ZA 3G3BA 1M9SA 1WWLA 4Z8GA 3GOZA 3WPCA 2WQWA 2P1NB 2Z64A 4Z79A 4QXEA 2V9SA 4MN8B 4PSJA 3DZEA 2JE1A 5B0NA 3C6PB 4R09A 4R5CA 4WYKA 3P72A 2WFHA 4R6GA 3WPFA 4EZGA 4FS7A 3E2JA 4ARNA 4R07A 1XCDA 1PGVA 2OMYA 3JB9j 1OOKG 3G39A 4KT1A 1K5GC 5B0TA 1OTOA 4ECOA 4G8AA 2Z7XB 4P91A 3RJ0A 1H6TA 4CNMA 1O6VA 3E3ZA 1O6SA 5CMPA 2Z62A 3C6NB 3OGMB 1OGQA 4NKHA 2P1PB 4R6AA 1KOHA 3VQ1A 3RFJA 4RCWA 4L3FA 2Z65A 4GLPA 4J4LA 3UN9A 5D3IA 1LTXA 1O6TA 4Q3IA 3VQ2A 3CVRA 4Z94G 4XOSA 2OMZA 4LSXA 5LFNA 3CIYA 2P1OB 4V2EA 1XKUA 3W3GA 4R6JA 4XSQA 4CC4C 2XWTC 3M18A 1A9NA 3BZ5A 4FD0A 3O6NA 5GMGA 4LI2A 2IFGA 4L3AA 3OJAB 1D0BA 4UFRA 4Y61B 4LI1A 5GMHA 5IJBA 2BNHA 3G04C 4BSUA 4U08A 3ZYNA 2V70A 4I6JB 4BSSA 4MQWX 4KXFB 2ID5A 1U0ND 4KNGA 1IO0A 3WPEA 4WP6A 1YRGA 3UL7A 4K17A 2P1MB 3WPDA 1M10B 3A79B 3CIGA
chains in the Genus database with same CATH superfamily
3ULVA 4PEQB 4B8CD 5IJCA 4ARRA 1XEUA 2RR6A 2RA8A 2WQUA 3W3JA 4R5DA 4M7EC 5A5CA 3OGKB 2OMTA 5AWAA 2OMWA 3FXIA 2ELLA 4LSAA 5IJDA 1FQVA 1G9UA 1K5DC 3WPIA 2Z81A 2FT3A 1DS9A 4PQ8A 4ECNA 2Q4GW 4NZTM 2Z66A 2O6QA 5IYXC 2Z63A 4FDWA 2R9UA 5GS0A 2BEXA 2WQVA 3O53A 3SB4A 4LXRA 1FO1A 4R58A 4Z64C 2O6SA 3G06A 4CC4A 4HQ1A 3E6JA 2JE0A 4YEBB 1ZIWA 1H6UA 1Z7XW 3RW6A 2Y5QA 1P8VA 3RFSA 2OMVA 3UL8A 4NKGA 4V2CA 1QYYA 5HDHA 4GT6A 4FMZA 4Z61C 1OZNA 1W8AA 3WPGA 4U09A 3E4GA 3W3NA 3OGLB 2ASTB 4FHOA 5GMFA 2OMUA 1JL5A 5AZ5A 1KOOA 4CILA 3W3MA 4C2BB 2UZYA 4PERA 3ZYOA 4R6FA 2OMXA 1SQ0B 1OTMA 2Z7XA 5AWBA 4CP6A 4RWTC 4R0AA 2P1QB 1XECA 3W3KA 4IM6A 4M7EA 4BV4R 4TZHA 3C6OB 4H09A 1M9LA 1FT8A 5FTTB 4U06A 5GS2B 3WPBA 4QC0A 2JQDA 5B4PA 1P9AG 3WPHA 1P8TA 3RFEA 4AY9X 2UZXA 2ASSB 2A0ZA 4LSCA 3ULUA 4U7LA 4CNCA 3UL9A 4AW4A 3RGZA 1XWDC 4LXSA 4Q62A 1A4YA 3ULAA 1OTNA 4PKIG 2WQXA 5CMNA 3TSRE 3RIZA 2Z82A 3W3LA 2O6RA 5HZLB 4FCGA 1DFJI 2V9TB 4J0MA 5AWDA 4LSXC 3G3AA 3OJAA 4P8SA 4OQTA 4BSRA 1GWBA 3KJ4A 4R08A 1DCEA 3PMHG 4C2AB 1FS2A 3ZYJA 5AWCA 4Q3GA 3RW7A 5GQRK 4QBZA 3ZYIA 3RGXA 4RCAB 4NZRM 3WN4A 2XOTA 4V2DA 4XGOA 2CA6A 3M19A 3REZA 1M0ZA 3G3BA 1M9SA 1WWLA 4Z8GA 3GOZA 3WPCA 2WQWA 2P1NB 2Z64A 4Z79A 4QXEA 2V9SA 4MN8B 4PSJA 3DZEA 2JE1A 5B0NA 3C6PB 4R09A 4R5CA 4WYKA 3P72A 2WFHA 4R6GA 3WPFA 4EZGA 4FS7A 3E2JA 4ARNA 4R07A 1XCDA 1PGVA 2OMYA 3JB9j 1OOKG 3G39A 4KT1A 1K5GC 5B0TA 1OTOA 4ECOA 4G8AA 2Z7XB 4P91A 3RJ0A 1H6TA 4CNMA 1O6VA 3E3ZA 1O6SA 5CMPA 2Z62A 3C6NB 3OGMB 1OGQA 4NKHA 2P1PB 4R6AA 1KOHA 3VQ1A 3RFJA 4RCWA 4L3FA 2Z65A 4GLPA 4J4LA 3UN9A 5D3IA 1LTXA 1O6TA 4Q3IA 3VQ2A 3CVRA 4Z94G 4XOSA 2OMZA 4LSXA 5LFNA 3CIYA 2P1OB 4V2EA 1XKUA 3W3GA 4R6JA 4XSQA 4CC4C 2XWTC 3M18A 1A9NA 3BZ5A 4FD0A 3O6NA 5GMGA 4LI2A 2IFGA 4L3AA 3OJAB 1D0BA 4UFRA 4Y61B 4LI1A 5GMHA 5IJBA 2BNHA 3G04C 4BSUA 4U08A 3ZYNA 2V70A 4I6JB 4BSSA 4MQWX 4KXFB 2ID5A 1U0ND 4KNGA 1IO0A 3WPEA 4WP6A 1YRGA 3UL7A 4K17A 2P1MB 3WPDA 1M10B 3A79B 3CIGA
chains in the Genus database with same CATH topology
3ULVA 4PEQB 4B8CD 5IJCA 4ARRA 1XEUA 2RR6A 2RA8A 2WQUA 3W3JA 4R5DA 4M7EC 5A5CA 3OGKB 2OMTA 5AWAA 2OMWA 3FXIA 2ELLA 4LSAA 5IJDA 1FQVA 1G9UA 1K5DC 3WPIA 2Z81A 2FT3A 1DS9A 4PQ8A 4ECNA 2Q4GW 2Z66A 2O6QA 5IYXC 2Z63A 4FDWA 2R9UA 5GS0A 2BEXA 2WQVA 3O53A 3SB4A 4LXRA 1FO1A 4R58A 4Z64C 2O6SA 3G06A 4CC4A 4HQ1A 3E6JA 2JE0A 4YEBB 1ZIWA 1H6UA 1Z7XW 3RW6A 2Y5QA 1P8VA 3RFSA 2OMVA 3UL8A 4NKGA 4V2CA 1QYYA 5HDHA 4GT6A 4FMZA 4Z61C 1OZNA 1W8AA 3WPGA 4U09A 3E4GA 3W3NA 3OGLB 2ASTB 4FHOA 5GMFA 2OMUA 1JL5A 5AZ5A 1KOOA 4CILA 3W3MA 4C2BB 2UZYA 4PERA 3ZYOA 4R6FA 2OMXA 1SQ0B 1OTMA 2Z7XA 5AWBA 4CP6A 4RWTC 4R0AA 2P1QB 1XECA 3W3KA 4IM6A 4M7EA 4BV4R 4TZHA 3C6OB 4H09A 1M9LA 1FT8A 5FTTB 4U06A 5GS2B 3WPBA 4QC0A 2JQDA 5B4PA 1P9AG 3WPHA 1P8TA 3RFEA 4AY9X 2UZXA 2ASSB 2A0ZA 4LSCA 3ULUA 4U7LA 4CNCA 3UL9A 4AW4A 3RGZA 1XWDC 4LXSA 4Q62A 1A4YA 3ULAA 1OTNA 4PKIG 2WQXA 5CMNA 3TSRE 3RIZA 2Z82A 3W3LA 2O6RA 5HZLB 4FCGA 1DFJI 2V9TB 4J0MA 5AWDA 4LSXC 3G3AA 3OJAA 4P8SA 4OQTA 4BSRA 1GWBA 3KJ4A 4R08A 1DCEA 3PMHG 4C2AB 1FS2A 3ZYJA 5AWCA 4Q3GA 3RW7A 5GQRK 4QBZA 3ZYIA 3RGXA 4RCAB 3WN4A 2XOTA 4V2DA 4XGOA 2CA6A 3M19A 3REZA 1M0ZA 3G3BA 1M9SA 1WWLA 4Z8GA 3GOZA 3WPCA 2WQWA 2P1NB 2Z64A 4Z79A 4QXEA 2V9SA 4MN8B 4PSJA 3DZEA 2JE1A 5B0NA 3C6PB 4R09A 4R5CA 4WYKA 3P72A 2WFHA 4R6GA 3WPFA 4EZGA 4FS7A 3E2JA 4ARNA 4R07A 1XCDA 1PGVA 2OMYA 3JB9j 1OOKG 3G39A 4KT1A 1K5GC 5B0TA 1OTOA 4ECOA 4G8AA 2Z7XB 4P91A 3RJ0A 1H6TA 4CNMA 1O6VA 3E3ZA 1O6SA 5CMPA 2Z62A 3C6NB 3OGMB 1OGQA 4NKHA 2P1PB 4R6AA 1KOHA 3VQ1A 3RFJA 4RCWA 4L3FA 2Z65A 4GLPA 4J4LA 3UN9A 5D3IA 1LTXA 1O6TA 4Q3IA 3VQ2A 3CVRA 4Z94G 4XOSA 2OMZA 4LSXA 5LFNA 3CIYA 2P1OB 4V2EA 1XKUA 3W3GA 4R6JA 4XSQA 4CC4C 2XWTC 3M18A 1A9NA 3BZ5A 4FD0A 3O6NA 5GMGA 4LI2A 2IFGA 4L3AA 3OJAB 1D0BA 4UFRA 4Y61B 4LI1A 5GMHA 5IJBA 2BNHA 3G04C 4BSUA 4U08A 3ZYNA 2V70A 4I6JB 4BSSA 4MQWX 4KXFB 2ID5A 1U0ND 4KNGA 1IO0A 3WPEA 4WP6A 1YRGA 3UL7A 4K17A 2P1MB 3WPDA 1M10B 3A79B 3CIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULV A;  4PEQ B;  4B8C D;  5IJC A;  4ARR A;  1XEU A;  2RR6 A;  2RA8 A;  2WQU A;  3W3J A;  4R5D A;  4M7E C;  5A5C A;  3OGK B;  2OMT A;  5AWA A;  2OMW A;  3FXI A;  2ELL A;  4LSA A;  5IJD A;  1FQV A;  1G9U A;  1K5D C;  3WPI A;  2Z81 A;  2FT3 A;  1DS9 A;  4PQ8 A;  4ECN A;  2Q4G W;  2Z66 A;  2O6Q A;  5IYX C;  2Z63 A;  4FDW A;  2R9U A;  5GS0 A;  2BEX A;  2WQV A;  3O53 A;  3SB4 A;  4LXR A;  1FO1 A;  4R58 A;  4Z64 C;  2O6S A;  3G06 A;  4CC4 A;  4HQ1 A;  3E6J A;  2JE0 A;  4YEB B;  1ZIW A;  1H6U A;  1Z7X W;  3RW6 A;  2Y5Q A;  1P8V A;  3RFS A;  2OMV A;  3UL8 A;  4NKG A;  4V2C A;  1QYY A;  5HDH A;  4GT6 A;  4FMZ A;  4Z61 C;  1OZN A;  1W8A A;  3WPG A;  4U09 A;  3E4G A;  3W3N A;  3OGL B;  2AST B;  4FHO A;  5GMF A;  2OMU A;  1JL5 A;  5AZ5 A;  1KOO A;  4CIL A;  3W3M A;  4C2B B;  2UZY A;  4PER A;  3ZYO A;  4R6F A;  2OMX A;  1SQ0 B;  1OTM A;  2Z7X A;  5AWB A;  4CP6 A;  4RWT C;  4R0A A;  2P1Q B;  1XEC A;  3W3K A;  4IM6 A;  4M7E A;  4BV4 R;  4TZH A;  3C6O B;  4H09 A;  1M9L A;  1FT8 A;  5FTT B;  4U06 A;  5GS2 B;  3WPB A;  4QC0 A;  2JQD A;  5B4P A;  1P9A G;  3WPH A;  1P8T A;  3RFE A;  4AY9 X;  2UZX A;  2ASS B;  2A0Z A;  4LSC A;  3ULU A;  4U7L A;  4CNC A;  3UL9 A;  4AW4 A;  3RGZ A;  1XWD C;  4LXS A;  4Q62 A;  1A4Y A;  3ULA A;  1OTN A;  4PKI G;  2WQX A;  5CMN A;  3TSR E;  3RIZ A;  2Z82 A;  3W3L A;  2O6R A;  5HZL B;  4FCG A;  1DFJ I;  2V9T B;  4J0M A;  5AWD A;  4LSX C;  3G3A A;  3OJA A;  4P8S A;  4OQT A;  4BSR A;  1GWB A;  3KJ4 A;  4R08 A;  1DCE A;  3PMH G;  4C2A B;  1FS2 A;  3ZYJ A;  5AWC A;  4Q3G A;  3RW7 A;  5GQR K;  4QBZ A;  3ZYI A;  3RGX A;  4RCA B;  3WN4 A;  2XOT A;  4V2D A;  4XGO A;  2CA6 A;  3M19 A;  3REZ A;  1M0Z A;  3G3B A;  1M9S A;  1WWL A;  4Z8G A;  3GOZ A;  3WPC A;  2WQW A;  2P1N B;  2Z64 A;  4Z79 A;  4QXE A;  2V9S A;  4MN8 B;  4PSJ A;  3DZE A;  2JE1 A;  5B0N A;  3C6P B;  4R09 A;  4R5C A;  4WYK A;  3P72 A;  2WFH A;  4R6G A;  3WPF A;  4EZG A;  4FS7 A;  3E2J A;  4ARN A;  4R07 A;  1XCD A;  1PGV A;  2OMY A;  3JB9 j;  1OOK G;  3G39 A;  4KT1 A;  1K5G C;  5B0T A;  1OTO A;  4ECO A;  4G8A A;  2Z7X B;  4P91 A;  3RJ0 A;  1H6T A;  4CNM A;  1O6V A;  3E3Z A;  1O6S A;  5CMP A;  2Z62 A;  3C6N B;  3OGM B;  1OGQ A;  4NKH A;  2P1P B;  4R6A A;  1KOH A;  3VQ1 A;  3RFJ A;  4RCW A;  4L3F A;  2Z65 A;  4GLP A;  4J4L A;  3UN9 A;  5D3I A;  1LTX A;  1O6T A;  4Q3I A;  3VQ2 A;  3CVR A;  4Z94 G;  4XOS A;  2OMZ A;  4LSX A;  5LFN A;  3CIY A;  2P1O B;  4V2E A;  1XKU A;  3W3G A;  4R6J A;  4XSQ A;  4CC4 C;  2XWT C;  3M18 A;  1A9N A;  3BZ5 A;  4FD0 A;  3O6N A;  5GMG A;  4LI2 A;  2IFG A;  4L3A A;  3OJA B;  1D0B A;  4UFR A;  4Y61 B;  4LI1 A;  5GMH A;  5IJB A;  2BNH A;  3G04 C;  4BSU A;  4U08 A;  3ZYN A;  2V70 A;  4I6J B;  4BSS A;  4MQW X;  4KXF B;  2ID5 A;  1U0N D;  4KNG A;  1IO0 A;  3WPE A;  4WP6 A;  1YRG A;  3UL7 A;  4K17 A;  2P1M B;  3WPD A;  1M10 B;  3A79 B;  3CIG A; 
#chains in the Genus database with same CATH topology
 3ULV A;  4PEQ B;  4B8C D;  5IJC A;  4ARR A;  1XEU A;  2RR6 A;  2RA8 A;  2WQU A;  3W3J A;  4R5D A;  4M7E C;  5A5C A;  3OGK B;  2OMT A;  5AWA A;  2OMW A;  3FXI A;  2ELL A;  4LSA A;  5IJD A;  1FQV A;  1G9U A;  1K5D C;  3WPI A;  2Z81 A;  2FT3 A;  1DS9 A;  4PQ8 A;  4ECN A;  2Q4G W;  4NZT M;  2Z66 A;  2O6Q A;  5IYX C;  2Z63 A;  4FDW A;  2R9U A;  5GS0 A;  2BEX A;  2WQV A;  3O53 A;  3SB4 A;  4LXR A;  1FO1 A;  4R58 A;  4Z64 C;  2O6S A;  3G06 A;  4CC4 A;  4HQ1 A;  3E6J A;  2JE0 A;  4YEB B;  1ZIW A;  1H6U A;  1Z7X W;  3RW6 A;  2Y5Q A;  1P8V A;  3RFS A;  2OMV A;  3UL8 A;  4NKG A;  4V2C A;  1QYY A;  5HDH A;  4GT6 A;  4FMZ A;  4Z61 C;  1OZN A;  1W8A A;  3WPG A;  4U09 A;  3E4G A;  3W3N A;  3OGL B;  2AST B;  4FHO A;  5GMF A;  2OMU A;  1JL5 A;  5AZ5 A;  1KOO A;  4CIL A;  3W3M A;  4C2B B;  2UZY A;  4PER A;  3ZYO A;  4R6F A;  2OMX A;  1SQ0 B;  1OTM A;  2Z7X A;  5AWB A;  4CP6 A;  4RWT C;  4R0A A;  2P1Q B;  1XEC A;  3W3K A;  4IM6 A;  4M7E A;  4BV4 R;  4TZH A;  3C6O B;  4H09 A;  1M9L A;  1FT8 A;  5FTT B;  4U06 A;  5GS2 B;  3WPB A;  4QC0 A;  2JQD A;  5B4P A;  1P9A G;  3WPH A;  1P8T A;  3RFE A;  4AY9 X;  2UZX A;  2ASS B;  2A0Z A;  4LSC A;  3ULU A;  4U7L A;  4CNC A;  3UL9 A;  4AW4 A;  3RGZ A;  1XWD C;  4LXS A;  4Q62 A;  1A4Y A;  3ULA A;  1OTN A;  4PKI G;  2WQX A;  5CMN A;  3TSR E;  3RIZ A;  2Z82 A;  3W3L A;  2O6R A;  5HZL B;  4FCG A;  1DFJ I;  2V9T B;  4J0M A;  5AWD A;  4LSX C;  3G3A A;  3OJA A;  4P8S A;  4OQT A;  4BSR A;  1GWB A;  3KJ4 A;  4R08 A;  1DCE A;  3PMH G;  4C2A B;  1FS2 A;  3ZYJ A;  5AWC A;  4Q3G A;  3RW7 A;  5GQR K;  4QBZ A;  3ZYI A;  3RGX A;  4RCA B;  4NZR M;  3WN4 A;  2XOT A;  4V2D A;  4XGO A;  2CA6 A;  3M19 A;  3REZ A;  1M0Z A;  3G3B A;  1M9S A;  1WWL A;  4Z8G A;  3GOZ A;  3WPC A;  2WQW A;  2P1N B;  2Z64 A;  4Z79 A;  4QXE A;  2V9S A;  4MN8 B;  4PSJ A;  3DZE A;  2JE1 A;  5B0N A;  3C6P B;  4R09 A;  4R5C A;  4WYK A;  3P72 A;  2WFH A;  4R6G A;  3WPF A;  4EZG A;  4FS7 A;  3E2J A;  4ARN A;  4R07 A;  1XCD A;  1PGV A;  2OMY A;  3JB9 j;  1OOK G;  3G39 A;  4KT1 A;  1K5G C;  5B0T A;  1OTO A;  4ECO A;  4G8A A;  2Z7X B;  4P91 A;  3RJ0 A;  1H6T A;  4CNM A;  1O6V A;  3E3Z A;  1O6S A;  5CMP A;  2Z62 A;  3C6N B;  3OGM B;  1OGQ A;  4NKH A;  2P1P B;  4R6A A;  1KOH A;  3VQ1 A;  3RFJ A;  4RCW A;  4L3F A;  2Z65 A;  4GLP A;  4J4L A;  3UN9 A;  5D3I A;  1LTX A;  1O6T A;  4Q3I A;  3VQ2 A;  3CVR A;  4Z94 G;  4XOS A;  2OMZ A;  4LSX A;  5LFN A;  3CIY A;  2P1O B;  4V2E A;  1XKU A;  3W3G A;  4R6J A;  4XSQ A;  4CC4 C;  2XWT C;  3M18 A;  1A9N A;  3BZ5 A;  4FD0 A;  3O6N A;  5GMG A;  4LI2 A;  2IFG A;  4L3A A;  3OJA B;  1D0B A;  4UFR A;  4Y61 B;  4LI1 A;  5GMH A;  5IJB A;  2BNH A;  3G04 C;  4BSU A;  4U08 A;  3ZYN A;  2V70 A;  4I6J B;  4BSS A;  4MQW X;  4KXF B;  2ID5 A;  1U0N D;  4KNG A;  1IO0 A;  3WPE A;  4WP6 A;  1YRG A;  3UL7 A;  4K17 A;  2P1M B;  3WPD A;  1M10 B;  3A79 B;  3CIG A; 
#chains in the Genus database with same CATH homology
 3ULV A;  4PEQ B;  4B8C D;  5IJC A;  4ARR A;  1XEU A;  2RR6 A;  2RA8 A;  2WQU A;  3W3J A;  4R5D A;  4M7E C;  5A5C A;  3OGK B;  2OMT A;  5AWA A;  2OMW A;  3FXI A;  2ELL A;  4LSA A;  5IJD A;  1FQV A;  1G9U A;  1K5D C;  3WPI A;  2Z81 A;  2FT3 A;  1DS9 A;  4PQ8 A;  4ECN A;  2Q4G W;  2Z66 A;  2O6Q A;  5IYX C;  2Z63 A;  4FDW A;  2R9U A;  5GS0 A;  2BEX A;  2WQV A;  3O53 A;  3SB4 A;  4LXR A;  1FO1 A;  4R58 A;  4Z64 C;  2O6S A;  3G06 A;  4CC4 A;  4HQ1 A;  3E6J A;  2JE0 A;  4YEB B;  1ZIW A;  1H6U A;  1Z7X W;  3RW6 A;  2Y5Q A;  1P8V A;  3RFS A;  2OMV A;  3UL8 A;  4NKG A;  4V2C A;  1QYY A;  5HDH A;  4GT6 A;  4FMZ A;  4Z61 C;  1OZN A;  1W8A A;  3WPG A;  4U09 A;  3E4G A;  3W3N A;  3OGL B;  2AST B;  4FHO A;  5GMF A;  2OMU A;  1JL5 A;  5AZ5 A;  1KOO A;  4CIL A;  3W3M A;  4C2B B;  2UZY A;  4PER A;  3ZYO A;  4R6F A;  2OMX A;  1SQ0 B;  1OTM A;  2Z7X A;  5AWB A;  4CP6 A;  4RWT C;  4R0A A;  2P1Q B;  1XEC A;  3W3K A;  4IM6 A;  4M7E A;  4BV4 R;  4TZH A;  3C6O B;  4H09 A;  1M9L A;  1FT8 A;  5FTT B;  4U06 A;  5GS2 B;  3WPB A;  4QC0 A;  2JQD A;  5B4P A;  1P9A G;  3WPH A;  1P8T A;  3RFE A;  4AY9 X;  2UZX A;  2ASS B;  2A0Z A;  4LSC A;  3ULU A;  4U7L A;  4CNC A;  3UL9 A;  4AW4 A;  3RGZ A;  1XWD C;  4LXS A;  4Q62 A;  1A4Y A;  3ULA A;  1OTN A;  4PKI G;  2WQX A;  5CMN A;  3TSR E;  3RIZ A;  2Z82 A;  3W3L A;  2O6R A;  5HZL B;  4FCG A;  1DFJ I;  2V9T B;  4J0M A;  5AWD A;  4LSX C;  3G3A A;  3OJA A;  4P8S A;  4OQT A;  4BSR A;  1GWB A;  3KJ4 A;  4R08 A;  1DCE A;  3PMH G;  4C2A B;  1FS2 A;  3ZYJ A;  5AWC A;  4Q3G A;  3RW7 A;  5GQR K;  4QBZ A;  3ZYI A;  3RGX A;  4RCA B;  3WN4 A;  2XOT A;  4V2D A;  4XGO A;  2CA6 A;  3M19 A;  3REZ A;  1M0Z A;  3G3B A;  1M9S A;  1WWL A;  4Z8G A;  3GOZ A;  3WPC A;  2WQW A;  2P1N B;  2Z64 A;  4Z79 A;  4QXE A;  2V9S A;  4MN8 B;  4PSJ A;  3DZE A;  2JE1 A;  5B0N A;  3C6P B;  4R09 A;  4R5C A;  4WYK A;  3P72 A;  2WFH A;  4R6G A;  3WPF A;  4EZG A;  4FS7 A;  3E2J A;  4ARN A;  4R07 A;  1XCD A;  1PGV A;  2OMY A;  3JB9 j;  1OOK G;  3G39 A;  4KT1 A;  1K5G C;  5B0T A;  1OTO A;  4ECO A;  4G8A A;  2Z7X B;  4P91 A;  3RJ0 A;  1H6T A;  4CNM A;  1O6V A;  3E3Z A;  1O6S A;  5CMP A;  2Z62 A;  3C6N B;  3OGM B;  1OGQ A;  4NKH A;  2P1P B;  4R6A A;  1KOH A;  3VQ1 A;  3RFJ A;  4RCW A;  4L3F A;  2Z65 A;  4GLP A;  4J4L A;  3UN9 A;  5D3I A;  1LTX A;  1O6T A;  4Q3I A;  3VQ2 A;  3CVR A;  4Z94 G;  4XOS A;  2OMZ A;  4LSX A;  5LFN A;  3CIY A;  2P1O B;  4V2E A;  1XKU A;  3W3G A;  4R6J A;  4XSQ A;  4CC4 C;  2XWT C;  3M18 A;  1A9N A;  3BZ5 A;  4FD0 A;  3O6N A;  5GMG A;  4LI2 A;  2IFG A;  4L3A A;  3OJA B;  1D0B A;  4UFR A;  4Y61 B;  4LI1 A;  5GMH A;  5IJB A;  2BNH A;  3G04 C;  4BSU A;  4U08 A;  3ZYN A;  2V70 A;  4I6J B;  4BSS A;  4MQW X;  4KXF B;  2ID5 A;  1U0N D;  4KNG A;  1IO0 A;  3WPE A;  4WP6 A;  1YRG A;  3UL7 A;  4K17 A;  2P1M B;  3WPD A;  1M10 B;  3A79 B;  3CIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...