3E2JA

Crystal structure of bovine coupling factor b
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
FWGWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit s, mitochondrial
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 60
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3e2jA00
3RGXA 5AWAA 2OMTA 4FDWA 2WQWA 3E3ZA 1XEUA 4GLPA 4RWTC 3TSRE 4CILA 5IJDA 4FD0A 3WN4A 1FS2A 2A0ZA 4Z61C 1FO1A 3RFSA 3G3BA 1OOKG 5CMPA 5LFNA 1O6TA 2RA8A 4M7EA 1DCEA 3WPDA 3W3KA 1LTXA 4R6FA 3C6PB 4R5CA 2UZYA 1H6TA 3BZ5A 4Q62A 2P1QB 4AW4A 4ECOA 1OTOA 2Z65A 4Q3IA 3WPGA 4R0AA 3M19A 2P1NB 4IM6A 3OJAA 5AWDA 5B4PA 3C6OB 1M9LA 4I6JB 4R6GA 1WWLA 1XECA 4NKGA 2Z81A 4XOSA 1OZNA 4R07A 1OTNA 4BSRA 3ULUA 3E6JA 1XKUA 1U0ND 1XWDC 4KT1A 4AY9X 4U08A 2RR6A 4GT6A 1PGVA 1W8AA 2WFHA 3WPEA 1YRGA 3C6NB 4C2AB 4QXEA 3UL8A 3JB9j 5CMNA 2WQVA 2Y5QA 3OJAB 2FT3A 5GMHA 3CVRA 4CNCA 2OMXA 3UN9A 1G9UA 1M0ZA 4Z79A 3DZEA 1FT8A 1O6VA 3WPFA 1FQVA 4CC4C 2BNHA 4ARRA 4FS7A 3REZA 3CIGA 4R6JA 1P8VA 4L3FA 4LSCA 1KOOA 5IJCA 4ECNA 4LI1A 1DS9A 4H09A 5GMGA 3RIZA 3G3AA 4WP6A 4KNGA 3ZYIA 1ZIWA 3W3JA 1GWBA 3WPIA 3G06A 3WPHA 4P91A 4R08A 5FTTB 2IFGA 3ULAA 4G8AA 3G39A 3RW7A 1Z7XW 4K17A 4PKIG 1M10B 3P72A 1D0BA 4LSXC 4FHOA 4BV4R 3ZYJA 5GMFA 3E4GA 5AWBA 4RCAB 2P1PB 2JE1A 1QYYA 2JQDA 3G04C 4PQ8A 4BSUA 2Z82A 4R5DA 4V2CA 2WQUA 1JL5A 1H6UA 4V2DA 4CNMA 2Z66A 4KXFB 2Q4GW 4UFRA 3E2JA 4OQTA 2OMVA 3GOZA 1OGQA 4J4LA 4U09A 1DFJI 4LXRA 4MN8B 2ID5A 2Z62A 3OGMB 3RJ0A 3W3GA 1OTMA 3RFJA 5IJBA 2ASSB 1P9AG 4V2EA 3W3MA 5HDHA 1KOHA 4QBZA 4R58A 2ELLA 3RGZA 5HZLB 4P8SA 4J0MA 4B8CD 1SQ0B 1XCDA 5B0NA 4R6AA 2V70A 4PERA 3WPBA 3O53A 4L3AA 4LXSA 3OGLB 3ULVA 1O6SA 1A9NA 4Q3GA 4QC0A 4Z94G 3OGKB 4CC4A 4XGOA 3W3NA 5A5CA 4M7EC 4NKHA 4HQ1A 4YEBB 3O6NA 4WYKA 4ARNA 2Z7XA 3UL7A 4FMZA 4MQWX 5AZ5A 2Z63A 5AWCA 4U7LA 3W3LA 2XWTC 4U06A 3CIYA 2O6RA 3VQ1A 3ZYOA 3M18A 4XSQA 3A79B 4Z64C 1A4YA 3PMHG 3WPCA 2WQXA 3UL9A 2OMWA 4LI2A 1M9SA 2V9TB 2BEXA 2V9SA 2P1OB 1K5GC 2Z7XB 3FXIA 4LSXA 2R9UA 4LSAA 2JE0A 3VQ2A 4PEQB 2OMUA 2OMZA 2O6SA 1P8TA 2P1MB 3RFEA 2Z64A 2ASTB 2XOTA 5GS0A 4EZGA 3KJ4A 5GQRK 5GS2B 4C2BB 3RW6A 3SB4A 1K5DC 4RCWA 2O6QA 2CA6A 4CP6A 5D3IA 2UZXA 5B0TA 3ZYNA 5IYXC 4PSJA 4Y61B 4FCGA 4Z8GA 1IO0A 4TZHA 2OMYA 4BSSA 4R09A
chains in the Genus database with same CATH superfamily
3RGXA 5AWAA 2OMTA 4FDWA 2WQWA 3E3ZA 1XEUA 4GLPA 4RWTC 3TSRE 4CILA 5IJDA 4FD0A 3WN4A 1FS2A 2A0ZA 4Z61C 1FO1A 3RFSA 3G3BA 1OOKG 5CMPA 5LFNA 1O6TA 2RA8A 4M7EA 1DCEA 3WPDA 3W3KA 1LTXA 4R6FA 3C6PB 4R5CA 2UZYA 1H6TA 3BZ5A 4Q62A 2P1QB 4AW4A 4ECOA 1OTOA 2Z65A 4Q3IA 3WPGA 4R0AA 3M19A 2P1NB 4IM6A 3OJAA 5AWDA 5B4PA 3C6OB 1M9LA 4I6JB 4R6GA 1WWLA 1XECA 4NKGA 2Z81A 4XOSA 1OZNA 4R07A 1OTNA 4BSRA 3ULUA 3E6JA 1XKUA 1U0ND 1XWDC 4KT1A 4AY9X 4U08A 2RR6A 4GT6A 1PGVA 1W8AA 2WFHA 3WPEA 1YRGA 3C6NB 4C2AB 4QXEA 3UL8A 3JB9j 5CMNA 2WQVA 2Y5QA 3OJAB 2FT3A 5GMHA 3CVRA 4CNCA 2OMXA 3UN9A 1G9UA 1M0ZA 4Z79A 3DZEA 1FT8A 1O6VA 3WPFA 1FQVA 4CC4C 2BNHA 4ARRA 4FS7A 3REZA 3CIGA 4R6JA 1P8VA 4L3FA 4LSCA 1KOOA 5IJCA 4ECNA 4LI1A 1DS9A 4H09A 5GMGA 3RIZA 3G3AA 4WP6A 4KNGA 3ZYIA 1ZIWA 3W3JA 1GWBA 3WPIA 3G06A 3WPHA 4P91A 4R08A 5FTTB 2IFGA 3ULAA 4G8AA 3G39A 3RW7A 1Z7XW 4K17A 4PKIG 1M10B 3P72A 1D0BA 4LSXC 4FHOA 4BV4R 3ZYJA 5GMFA 3E4GA 5AWBA 4RCAB 2P1PB 2JE1A 1QYYA 2JQDA 3G04C 4PQ8A 4NZRM 4BSUA 2Z82A 4R5DA 4V2CA 2WQUA 1JL5A 1H6UA 4V2DA 4CNMA 2Z66A 4KXFB 2Q4GW 4UFRA 3E2JA 4OQTA 2OMVA 3GOZA 1OGQA 4J4LA 4U09A 1DFJI 4LXRA 4MN8B 2ID5A 2Z62A 3OGMB 3RJ0A 3W3GA 1OTMA 3RFJA 5IJBA 2ASSB 1P9AG 4V2EA 3W3MA 5HDHA 1KOHA 4QBZA 4R58A 2ELLA 3RGZA 5HZLB 4P8SA 4J0MA 4B8CD 1SQ0B 1XCDA 5B0NA 4R6AA 2V70A 4PERA 3WPBA 3O53A 4L3AA 4LXSA 3OGLB 3ULVA 1O6SA 1A9NA 4Q3GA 4QC0A 4Z94G 3OGKB 4CC4A 4XGOA 3W3NA 5A5CA 4M7EC 4NKHA 4HQ1A 4YEBB 3O6NA 4WYKA 4ARNA 2Z7XA 3UL7A 4FMZA 4MQWX 5AZ5A 2Z63A 5AWCA 4U7LA 3W3LA 2XWTC 4U06A 3CIYA 2O6RA 3VQ1A 3ZYOA 3M18A 4XSQA 3A79B 4Z64C 1A4YA 3PMHG 3WPCA 2WQXA 3UL9A 2OMWA 4LI2A 1M9SA 2V9TB 2BEXA 2V9SA 2P1OB 1K5GC 2Z7XB 3FXIA 4LSXA 2R9UA 4LSAA 2JE0A 3VQ2A 4PEQB 2OMUA 2OMZA 2O6SA 1P8TA 2P1MB 3RFEA 2Z64A 2ASTB 2XOTA 5GS0A 4EZGA 3KJ4A 5GQRK 5GS2B 4C2BB 3RW6A 3SB4A 1K5DC 4RCWA 2O6QA 2CA6A 4CP6A 5D3IA 2UZXA 5B0TA 3ZYNA 5IYXC 4PSJA 4Y61B 4FCGA 4Z8GA 1IO0A 4TZHA 2OMYA 4NZTM 4BSSA 4R09A
chains in the Genus database with same CATH topology
3RGXA 5AWAA 2OMTA 4FDWA 2WQWA 3E3ZA 1XEUA 4GLPA 4RWTC 3TSRE 4CILA 5IJDA 4FD0A 3WN4A 1FS2A 2A0ZA 4Z61C 1FO1A 3RFSA 3G3BA 1OOKG 5CMPA 5LFNA 1O6TA 2RA8A 4M7EA 1DCEA 3WPDA 3W3KA 1LTXA 4R6FA 3C6PB 4R5CA 2UZYA 1H6TA 3BZ5A 4Q62A 2P1QB 4AW4A 4ECOA 1OTOA 2Z65A 4Q3IA 3WPGA 4R0AA 3M19A 2P1NB 4IM6A 3OJAA 5AWDA 5B4PA 3C6OB 1M9LA 4I6JB 4R6GA 1WWLA 1XECA 4NKGA 2Z81A 4XOSA 1OZNA 4R07A 1OTNA 4BSRA 3ULUA 3E6JA 1XKUA 1U0ND 1XWDC 4KT1A 4AY9X 4U08A 2RR6A 4GT6A 1PGVA 1W8AA 2WFHA 3WPEA 1YRGA 3C6NB 4C2AB 4QXEA 3UL8A 3JB9j 5CMNA 2WQVA 2Y5QA 3OJAB 2FT3A 5GMHA 3CVRA 4CNCA 2OMXA 3UN9A 1G9UA 1M0ZA 4Z79A 3DZEA 1FT8A 1O6VA 3WPFA 1FQVA 4CC4C 2BNHA 4ARRA 4FS7A 3REZA 3CIGA 4R6JA 1P8VA 4L3FA 4LSCA 1KOOA 5IJCA 4ECNA 4LI1A 1DS9A 4H09A 5GMGA 3RIZA 3G3AA 4WP6A 4KNGA 3ZYIA 1ZIWA 3W3JA 1GWBA 3WPIA 3G06A 3WPHA 4P91A 4R08A 5FTTB 2IFGA 3ULAA 4G8AA 3G39A 3RW7A 1Z7XW 4K17A 4PKIG 1M10B 3P72A 1D0BA 4LSXC 4FHOA 4BV4R 3ZYJA 5GMFA 3E4GA 5AWBA 4RCAB 2P1PB 2JE1A 1QYYA 2JQDA 3G04C 4PQ8A 4BSUA 2Z82A 4R5DA 4V2CA 2WQUA 1JL5A 1H6UA 4V2DA 4CNMA 2Z66A 4KXFB 2Q4GW 4UFRA 3E2JA 4OQTA 2OMVA 3GOZA 1OGQA 4J4LA 4U09A 1DFJI 4LXRA 4MN8B 2ID5A 2Z62A 3OGMB 3RJ0A 3W3GA 1OTMA 3RFJA 5IJBA 2ASSB 1P9AG 4V2EA 3W3MA 5HDHA 1KOHA 4QBZA 4R58A 2ELLA 3RGZA 5HZLB 4P8SA 4J0MA 4B8CD 1SQ0B 1XCDA 5B0NA 4R6AA 2V70A 4PERA 3WPBA 3O53A 4L3AA 4LXSA 3OGLB 3ULVA 1O6SA 1A9NA 4Q3GA 4QC0A 4Z94G 3OGKB 4CC4A 4XGOA 3W3NA 5A5CA 4M7EC 4NKHA 4HQ1A 4YEBB 3O6NA 4WYKA 4ARNA 2Z7XA 3UL7A 4FMZA 4MQWX 5AZ5A 2Z63A 5AWCA 4U7LA 3W3LA 2XWTC 4U06A 3CIYA 2O6RA 3VQ1A 3ZYOA 3M18A 4XSQA 3A79B 4Z64C 1A4YA 3PMHG 3WPCA 2WQXA 3UL9A 2OMWA 4LI2A 1M9SA 2V9TB 2BEXA 2V9SA 2P1OB 1K5GC 2Z7XB 3FXIA 4LSXA 2R9UA 4LSAA 2JE0A 3VQ2A 4PEQB 2OMUA 2OMZA 2O6SA 1P8TA 2P1MB 3RFEA 2Z64A 2ASTB 2XOTA 5GS0A 4EZGA 3KJ4A 5GQRK 5GS2B 4C2BB 3RW6A 3SB4A 1K5DC 4RCWA 2O6QA 2CA6A 4CP6A 5D3IA 2UZXA 5B0TA 3ZYNA 5IYXC 4PSJA 4Y61B 4FCGA 4Z8GA 1IO0A 4TZHA 2OMYA 4BSSA 4R09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGX A;  5AWA A;  2OMT A;  4FDW A;  2WQW A;  3E3Z A;  1XEU A;  4GLP A;  4RWT C;  3TSR E;  4CIL A;  5IJD A;  4FD0 A;  3WN4 A;  1FS2 A;  2A0Z A;  4Z61 C;  1FO1 A;  3RFS A;  3G3B A;  1OOK G;  5CMP A;  5LFN A;  1O6T A;  2RA8 A;  4M7E A;  1DCE A;  3WPD A;  3W3K A;  1LTX A;  4R6F A;  3C6P B;  4R5C A;  2UZY A;  1H6T A;  3BZ5 A;  4Q62 A;  2P1Q B;  4AW4 A;  4ECO A;  1OTO A;  2Z65 A;  4Q3I A;  3WPG A;  4R0A A;  3M19 A;  2P1N B;  4IM6 A;  3OJA A;  5AWD A;  5B4P A;  3C6O B;  1M9L A;  4I6J B;  4R6G A;  1WWL A;  1XEC A;  4NKG A;  2Z81 A;  4XOS A;  1OZN A;  4R07 A;  1OTN A;  4BSR A;  3ULU A;  3E6J A;  1XKU A;  1U0N D;  1XWD C;  4KT1 A;  4AY9 X;  4U08 A;  2RR6 A;  4GT6 A;  1PGV A;  1W8A A;  2WFH A;  3WPE A;  1YRG A;  3C6N B;  4C2A B;  4QXE A;  3UL8 A;  3JB9 j;  5CMN A;  2WQV A;  2Y5Q A;  3OJA B;  2FT3 A;  5GMH A;  3CVR A;  4CNC A;  2OMX A;  3UN9 A;  1G9U A;  1M0Z A;  4Z79 A;  3DZE A;  1FT8 A;  1O6V A;  3WPF A;  1FQV A;  4CC4 C;  2BNH A;  4ARR A;  4FS7 A;  3REZ A;  3CIG A;  4R6J A;  1P8V A;  4L3F A;  4LSC A;  1KOO A;  5IJC A;  4ECN A;  4LI1 A;  1DS9 A;  4H09 A;  5GMG A;  3RIZ A;  3G3A A;  4WP6 A;  4KNG A;  3ZYI A;  1ZIW A;  3W3J A;  1GWB A;  3WPI A;  3G06 A;  3WPH A;  4P91 A;  4R08 A;  5FTT B;  2IFG A;  3ULA A;  4G8A A;  3G39 A;  3RW7 A;  1Z7X W;  4K17 A;  4PKI G;  1M10 B;  3P72 A;  1D0B A;  4LSX C;  4FHO A;  4BV4 R;  3ZYJ A;  5GMF A;  3E4G A;  5AWB A;  4RCA B;  2P1P B;  2JE1 A;  1QYY A;  2JQD A;  3G04 C;  4PQ8 A;  4BSU A;  2Z82 A;  4R5D A;  4V2C A;  2WQU A;  1JL5 A;  1H6U A;  4V2D A;  4CNM A;  2Z66 A;  4KXF B;  2Q4G W;  4UFR A;  3E2J A;  4OQT A;  2OMV A;  3GOZ A;  1OGQ A;  4J4L A;  4U09 A;  1DFJ I;  4LXR A;  4MN8 B;  2ID5 A;  2Z62 A;  3OGM B;  3RJ0 A;  3W3G A;  1OTM A;  3RFJ A;  5IJB A;  2ASS B;  1P9A G;  4V2E A;  3W3M A;  5HDH A;  1KOH A;  4QBZ A;  4R58 A;  2ELL A;  3RGZ A;  5HZL B;  4P8S A;  4J0M A;  4B8C D;  1SQ0 B;  1XCD A;  5B0N A;  4R6A A;  2V70 A;  4PER A;  3WPB A;  3O53 A;  4L3A A;  4LXS A;  3OGL B;  3ULV A;  1O6S A;  1A9N A;  4Q3G A;  4QC0 A;  4Z94 G;  3OGK B;  4CC4 A;  4XGO A;  3W3N A;  5A5C A;  4M7E C;  4NKH A;  4HQ1 A;  4YEB B;  3O6N A;  4WYK A;  4ARN A;  2Z7X A;  3UL7 A;  4FMZ A;  4MQW X;  5AZ5 A;  2Z63 A;  5AWC A;  4U7L A;  3W3L A;  2XWT C;  4U06 A;  3CIY A;  2O6R A;  3VQ1 A;  3ZYO A;  3M18 A;  4XSQ A;  3A79 B;  4Z64 C;  1A4Y A;  3PMH G;  3WPC A;  2WQX A;  3UL9 A;  2OMW A;  4LI2 A;  1M9S A;  2V9T B;  2BEX A;  2V9S A;  2P1O B;  1K5G C;  2Z7X B;  3FXI A;  4LSX A;  2R9U A;  4LSA A;  2JE0 A;  3VQ2 A;  4PEQ B;  2OMU A;  2OMZ A;  2O6S A;  1P8T A;  2P1M B;  3RFE A;  2Z64 A;  2AST B;  2XOT A;  5GS0 A;  4EZG A;  3KJ4 A;  5GQR K;  5GS2 B;  4C2B B;  3RW6 A;  3SB4 A;  1K5D C;  4RCW A;  2O6Q A;  2CA6 A;  4CP6 A;  5D3I A;  2UZX A;  5B0T A;  3ZYN A;  5IYX C;  4PSJ A;  4Y61 B;  4FCG A;  4Z8G A;  1IO0 A;  4TZH A;  2OMY A;  4BSS A;  4R09 A; 
#chains in the Genus database with same CATH topology
 3RGX A;  5AWA A;  2OMT A;  4FDW A;  2WQW A;  3E3Z A;  1XEU A;  4GLP A;  4RWT C;  3TSR E;  4CIL A;  5IJD A;  4FD0 A;  3WN4 A;  1FS2 A;  2A0Z A;  4Z61 C;  1FO1 A;  3RFS A;  3G3B A;  1OOK G;  5CMP A;  5LFN A;  1O6T A;  2RA8 A;  4M7E A;  1DCE A;  3WPD A;  3W3K A;  1LTX A;  4R6F A;  3C6P B;  4R5C A;  2UZY A;  1H6T A;  3BZ5 A;  4Q62 A;  2P1Q B;  4AW4 A;  4ECO A;  1OTO A;  2Z65 A;  4Q3I A;  3WPG A;  4R0A A;  3M19 A;  2P1N B;  4IM6 A;  3OJA A;  5AWD A;  5B4P A;  3C6O B;  1M9L A;  4I6J B;  4R6G A;  1WWL A;  1XEC A;  4NKG A;  2Z81 A;  4XOS A;  1OZN A;  4R07 A;  1OTN A;  4BSR A;  3ULU A;  3E6J A;  1XKU A;  1U0N D;  1XWD C;  4KT1 A;  4AY9 X;  4U08 A;  2RR6 A;  4GT6 A;  1PGV A;  1W8A A;  2WFH A;  3WPE A;  1YRG A;  3C6N B;  4C2A B;  4QXE A;  3UL8 A;  3JB9 j;  5CMN A;  2WQV A;  2Y5Q A;  3OJA B;  2FT3 A;  5GMH A;  3CVR A;  4CNC A;  2OMX A;  3UN9 A;  1G9U A;  1M0Z A;  4Z79 A;  3DZE A;  1FT8 A;  1O6V A;  3WPF A;  1FQV A;  4CC4 C;  2BNH A;  4ARR A;  4FS7 A;  3REZ A;  3CIG A;  4R6J A;  1P8V A;  4L3F A;  4LSC A;  1KOO A;  5IJC A;  4ECN A;  4LI1 A;  1DS9 A;  4H09 A;  5GMG A;  3RIZ A;  3G3A A;  4WP6 A;  4KNG A;  3ZYI A;  1ZIW A;  3W3J A;  1GWB A;  3WPI A;  3G06 A;  3WPH A;  4P91 A;  4R08 A;  5FTT B;  2IFG A;  3ULA A;  4G8A A;  3G39 A;  3RW7 A;  1Z7X W;  4K17 A;  4PKI G;  1M10 B;  3P72 A;  1D0B A;  4LSX C;  4FHO A;  4BV4 R;  3ZYJ A;  5GMF A;  3E4G A;  5AWB A;  4RCA B;  2P1P B;  2JE1 A;  1QYY A;  2JQD A;  3G04 C;  4PQ8 A;  4NZR M;  4BSU A;  2Z82 A;  4R5D A;  4V2C A;  2WQU A;  1JL5 A;  1H6U A;  4V2D A;  4CNM A;  2Z66 A;  4KXF B;  2Q4G W;  4UFR A;  3E2J A;  4OQT A;  2OMV A;  3GOZ A;  1OGQ A;  4J4L A;  4U09 A;  1DFJ I;  4LXR A;  4MN8 B;  2ID5 A;  2Z62 A;  3OGM B;  3RJ0 A;  3W3G A;  1OTM A;  3RFJ A;  5IJB A;  2ASS B;  1P9A G;  4V2E A;  3W3M A;  5HDH A;  1KOH A;  4QBZ A;  4R58 A;  2ELL A;  3RGZ A;  5HZL B;  4P8S A;  4J0M A;  4B8C D;  1SQ0 B;  1XCD A;  5B0N A;  4R6A A;  2V70 A;  4PER A;  3WPB A;  3O53 A;  4L3A A;  4LXS A;  3OGL B;  3ULV A;  1O6S A;  1A9N A;  4Q3G A;  4QC0 A;  4Z94 G;  3OGK B;  4CC4 A;  4XGO A;  3W3N A;  5A5C A;  4M7E C;  4NKH A;  4HQ1 A;  4YEB B;  3O6N A;  4WYK A;  4ARN A;  2Z7X A;  3UL7 A;  4FMZ A;  4MQW X;  5AZ5 A;  2Z63 A;  5AWC A;  4U7L A;  3W3L A;  2XWT C;  4U06 A;  3CIY A;  2O6R A;  3VQ1 A;  3ZYO A;  3M18 A;  4XSQ A;  3A79 B;  4Z64 C;  1A4Y A;  3PMH G;  3WPC A;  2WQX A;  3UL9 A;  2OMW A;  4LI2 A;  1M9S A;  2V9T B;  2BEX A;  2V9S A;  2P1O B;  1K5G C;  2Z7X B;  3FXI A;  4LSX A;  2R9U A;  4LSA A;  2JE0 A;  3VQ2 A;  4PEQ B;  2OMU A;  2OMZ A;  2O6S A;  1P8T A;  2P1M B;  3RFE A;  2Z64 A;  2AST B;  2XOT A;  5GS0 A;  4EZG A;  3KJ4 A;  5GQR K;  5GS2 B;  4C2B B;  3RW6 A;  3SB4 A;  1K5D C;  4RCW A;  2O6Q A;  2CA6 A;  4CP6 A;  5D3I A;  2UZX A;  5B0T A;  3ZYN A;  5IYX C;  4PSJ A;  4Y61 B;  4FCG A;  4Z8G A;  1IO0 A;  4TZH A;  2OMY A;  4NZT M;  4BSS A;  4R09 A; 
#chains in the Genus database with same CATH homology
 3RGX A;  5AWA A;  2OMT A;  4FDW A;  2WQW A;  3E3Z A;  1XEU A;  4GLP A;  4RWT C;  3TSR E;  4CIL A;  5IJD A;  4FD0 A;  3WN4 A;  1FS2 A;  2A0Z A;  4Z61 C;  1FO1 A;  3RFS A;  3G3B A;  1OOK G;  5CMP A;  5LFN A;  1O6T A;  2RA8 A;  4M7E A;  1DCE A;  3WPD A;  3W3K A;  1LTX A;  4R6F A;  3C6P B;  4R5C A;  2UZY A;  1H6T A;  3BZ5 A;  4Q62 A;  2P1Q B;  4AW4 A;  4ECO A;  1OTO A;  2Z65 A;  4Q3I A;  3WPG A;  4R0A A;  3M19 A;  2P1N B;  4IM6 A;  3OJA A;  5AWD A;  5B4P A;  3C6O B;  1M9L A;  4I6J B;  4R6G A;  1WWL A;  1XEC A;  4NKG A;  2Z81 A;  4XOS A;  1OZN A;  4R07 A;  1OTN A;  4BSR A;  3ULU A;  3E6J A;  1XKU A;  1U0N D;  1XWD C;  4KT1 A;  4AY9 X;  4U08 A;  2RR6 A;  4GT6 A;  1PGV A;  1W8A A;  2WFH A;  3WPE A;  1YRG A;  3C6N B;  4C2A B;  4QXE A;  3UL8 A;  3JB9 j;  5CMN A;  2WQV A;  2Y5Q A;  3OJA B;  2FT3 A;  5GMH A;  3CVR A;  4CNC A;  2OMX A;  3UN9 A;  1G9U A;  1M0Z A;  4Z79 A;  3DZE A;  1FT8 A;  1O6V A;  3WPF A;  1FQV A;  4CC4 C;  2BNH A;  4ARR A;  4FS7 A;  3REZ A;  3CIG A;  4R6J A;  1P8V A;  4L3F A;  4LSC A;  1KOO A;  5IJC A;  4ECN A;  4LI1 A;  1DS9 A;  4H09 A;  5GMG A;  3RIZ A;  3G3A A;  4WP6 A;  4KNG A;  3ZYI A;  1ZIW A;  3W3J A;  1GWB A;  3WPI A;  3G06 A;  3WPH A;  4P91 A;  4R08 A;  5FTT B;  2IFG A;  3ULA A;  4G8A A;  3G39 A;  3RW7 A;  1Z7X W;  4K17 A;  4PKI G;  1M10 B;  3P72 A;  1D0B A;  4LSX C;  4FHO A;  4BV4 R;  3ZYJ A;  5GMF A;  3E4G A;  5AWB A;  4RCA B;  2P1P B;  2JE1 A;  1QYY A;  2JQD A;  3G04 C;  4PQ8 A;  4BSU A;  2Z82 A;  4R5D A;  4V2C A;  2WQU A;  1JL5 A;  1H6U A;  4V2D A;  4CNM A;  2Z66 A;  4KXF B;  2Q4G W;  4UFR A;  3E2J A;  4OQT A;  2OMV A;  3GOZ A;  1OGQ A;  4J4L A;  4U09 A;  1DFJ I;  4LXR A;  4MN8 B;  2ID5 A;  2Z62 A;  3OGM B;  3RJ0 A;  3W3G A;  1OTM A;  3RFJ A;  5IJB A;  2ASS B;  1P9A G;  4V2E A;  3W3M A;  5HDH A;  1KOH A;  4QBZ A;  4R58 A;  2ELL A;  3RGZ A;  5HZL B;  4P8S A;  4J0M A;  4B8C D;  1SQ0 B;  1XCD A;  5B0N A;  4R6A A;  2V70 A;  4PER A;  3WPB A;  3O53 A;  4L3A A;  4LXS A;  3OGL B;  3ULV A;  1O6S A;  1A9N A;  4Q3G A;  4QC0 A;  4Z94 G;  3OGK B;  4CC4 A;  4XGO A;  3W3N A;  5A5C A;  4M7E C;  4NKH A;  4HQ1 A;  4YEB B;  3O6N A;  4WYK A;  4ARN A;  2Z7X A;  3UL7 A;  4FMZ A;  4MQW X;  5AZ5 A;  2Z63 A;  5AWC A;  4U7L A;  3W3L A;  2XWT C;  4U06 A;  3CIY A;  2O6R A;  3VQ1 A;  3ZYO A;  3M18 A;  4XSQ A;  3A79 B;  4Z64 C;  1A4Y A;  3PMH G;  3WPC A;  2WQX A;  3UL9 A;  2OMW A;  4LI2 A;  1M9S A;  2V9T B;  2BEX A;  2V9S A;  2P1O B;  1K5G C;  2Z7X B;  3FXI A;  4LSX A;  2R9U A;  4LSA A;  2JE0 A;  3VQ2 A;  4PEQ B;  2OMU A;  2OMZ A;  2O6S A;  1P8T A;  2P1M B;  3RFE A;  2Z64 A;  2AST B;  2XOT A;  5GS0 A;  4EZG A;  3KJ4 A;  5GQR K;  5GS2 B;  4C2B B;  3RW6 A;  3SB4 A;  1K5D C;  4RCW A;  2O6Q A;  2CA6 A;  4CP6 A;  5D3I A;  2UZX A;  5B0T A;  3ZYN A;  5IYX C;  4PSJ A;  4Y61 B;  4FCG A;  4Z8G A;  1IO0 A;  4TZH A;  2OMY A;  4BSS A;  4R09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...