4R6FA

Crystal structure of computational designed protein dlrr_i
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
329
structure length
329
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNNIANINDQMLEGLTNLTTLNLSHNNLARLWKHANPGGPIYFLKGLTNLTTLNLSSNGFDEIPREVFKDLTSLTTLNLSNNNIANINDQMLEGLTNLTTLNLSHNNLARLWKHANPGGPIYFLKGLTNLTTLNLSSNGFDEIPREVFKDLTSLTTLNLSNNQLTSLPQGVFERLTNLKTLNLSNNQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags De novo protein
molecule keywords Leucine rich repeat DLRR_I
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
total genus 117
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 2014-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r6fA00
3CIGA 4LI1A 5AWAA 4BSRA 4MQWX 1FT8A 3W3JA 3RFSA 5FTTB 4LSXA 1H6TA 5GMHA 2WFHA 4FS7A 4CC4A 2Z64A 1FQVA 3OJAA 5B4PA 4M7EA 3O53A 2WQWA 3G04C 2CA6A 1FS2A 3C6NB 3P72A 4U06A 2Z63A 1YRGA 3RGZA 4BSSA 1W8AA 3W3LA 2BEXA 2OMTA 4Z79A 1QYYA 2A0ZA 4PEQB 1O6SA 4R08A 4H09A 4KXFB 3WPBA 4Q62A 3PMHG 1M0ZA 1A4YA 1K5DC 3M18A 3JB9j 1SQ0B 3A79B 4BV4R 4B8CD 3UL9A 4UFRA 4ARRA 1DFJI 3OJAB 3WPHA 3CIYA 4BSUA 4V2EA 1M9LA 5HDHA 4AY9X 1OOKG 3RFEA 1P9AG 2OMVA 1D0BA 3E2JA 4R6FA 3WPGA 4R5DA 5LFNA 4J0MA 3ZYNA 2RR6A 2JE1A 4XSQA 3OGMB 5GS0A 4R6GA 5B0NA 3G06A 1FO1A 2WQUA 3BZ5A 4V2CA 1GWBA 2OMYA 5GQRK 4LSAA 2OMXA 3E6JA 3ULVA 3VQ2A 4LXRA 3OGKB 4WP6A 1G9UA 5GMGA 4Z61C 2R9UA 2Z62A 1OTMA 2IFGA 4CP6A 2Z81A 3G3BA 4WYKA 2FT3A 1XKUA 3RW6A 5D3IA 1M9SA 5AZ5A 3C6PB 2OMUA 4RCWA 1WWLA 1U0ND 1LTXA 4J4LA 4V2DA 3ZYIA 4QC0A 4FCGA 2UZXA 4U08A 2Q4GW 4C2BB 5GMFA 4PSJA 4Q3IA 2P1QB 4P8SA 3VQ1A 4NKGA 1PGVA 3W3GA 4KNGA 5IJCA 3WPCA 1A9NA 1KOHA 2OMZA 1P8TA 1IO0A 4L3AA 3M19A 1XEUA 4CNCA 2RA8A 4G8AA 5CMPA 1DCEA 1H6UA 2XOTA 3FXIA 5CMNA 4R07A 3W3MA 4Z94G 4OQTA 4KT1A 4ECNA 4CILA 2ASSB 4PKIG 4Y61B 5B0TA 2WQXA 4FD0A 3WPDA 4ECOA 5IJDA 3ULAA 4FDWA 3WPIA 1P8VA 1M10B 3G3AA 1OZNA 3E3ZA 4XOSA 4I6JB 3O6NA 2Z7XA 3RFJA 2JE0A 2O6RA 2O6SA 4HQ1A 2O6QA 2P1MB 4LSCA 3REZA 4PQ8A 4PERA 1DS9A 5AWDA 1O6TA 3E4GA 2Z82A 2V9TB 4CNMA 4Z8GA 4ARNA 1XWDC 4GLPA 4LSXC 3RGXA 1JL5A 1K5GC 4U7LA 2P1NB 4CC4C 3ZYJA 4K17A 3RJ0A 3UN9A 3W3NA 3C6OB 2XWTC 4M7EC 4L3FA 4R6AA 4R5CA 5AWBA 4RWTC 2UZYA 3UL8A 4R0AA 4Q3GA 1XCDA 4TZHA 4MN8B 5IJBA 1OTNA 2Z7XB 2V9SA 2BNHA 2JQDA 2P1OB 2P1PB 4EZGA 3ZYOA 5A5CA 1KOOA 1Z7XW 2ASTB 4C2AB 4RCAB 3G39A 4QBZA 3W3KA 2OMWA 3OGLB 4IM6A 4Z64C 2V70A 4R6JA 1O6VA 3RW7A 5IYXC 3UL7A 1XECA 3KJ4A 1OTOA 4LXSA 3SB4A 3RIZA 4R58A 2ELLA 4XGOA 4LI2A 2ID5A 3ULUA 4QXEA 3TSRE 4U09A 3WPFA 5HZLB 4FHOA 2Z66A 3GOZA 2Y5QA 4P91A 4GT6A 4FMZA 1ZIWA 4R09A 4NKHA 3CVRA 3WN4A 5GS2B 2WQVA 3DZEA 5AWCA 1OGQA 2Z65A 3WPEA 4YEBB 4AW4A
chains in the Genus database with same CATH superfamily
3CIGA 4LI1A 5AWAA 4BSRA 4MQWX 1FT8A 3W3JA 3RFSA 5FTTB 4LSXA 1H6TA 5GMHA 2WFHA 4FS7A 4CC4A 2Z64A 1FQVA 3OJAA 5B4PA 4M7EA 3O53A 2WQWA 3G04C 2CA6A 1FS2A 3C6NB 3P72A 4U06A 2Z63A 1YRGA 3RGZA 4BSSA 1W8AA 3W3LA 2BEXA 2OMTA 4Z79A 1QYYA 2A0ZA 4PEQB 1O6SA 4R08A 4H09A 4KXFB 3WPBA 4Q62A 3PMHG 1M0ZA 1A4YA 1K5DC 3M18A 3JB9j 1SQ0B 3A79B 4BV4R 4B8CD 3UL9A 4UFRA 4ARRA 1DFJI 3OJAB 3WPHA 3CIYA 4BSUA 4V2EA 1M9LA 5HDHA 4AY9X 1OOKG 3RFEA 1P9AG 2OMVA 1D0BA 3E2JA 4R6FA 3WPGA 4R5DA 5LFNA 4J0MA 3ZYNA 2RR6A 2JE1A 4XSQA 3OGMB 5GS0A 4R6GA 5B0NA 3G06A 1FO1A 2WQUA 3BZ5A 4V2CA 1GWBA 2OMYA 5GQRK 4LSAA 2OMXA 3E6JA 3ULVA 3VQ2A 4LXRA 3OGKB 4WP6A 1G9UA 5GMGA 4Z61C 2R9UA 2Z62A 1OTMA 2IFGA 4CP6A 2Z81A 3G3BA 4WYKA 2FT3A 1XKUA 3RW6A 5D3IA 1M9SA 5AZ5A 3C6PB 2OMUA 4RCWA 1WWLA 1U0ND 1LTXA 4J4LA 4V2DA 3ZYIA 4QC0A 4FCGA 2UZXA 4U08A 2Q4GW 4C2BB 5GMFA 4PSJA 4Q3IA 2P1QB 4NZRM 4P8SA 3VQ1A 4NKGA 1PGVA 3W3GA 4KNGA 5IJCA 3WPCA 1A9NA 1KOHA 2OMZA 1P8TA 1IO0A 4L3AA 3M19A 1XEUA 4CNCA 2RA8A 4G8AA 5CMPA 1DCEA 1H6UA 2XOTA 3FXIA 5CMNA 4R07A 3W3MA 4Z94G 4OQTA 4KT1A 4ECNA 4CILA 2ASSB 4PKIG 4Y61B 5B0TA 2WQXA 4FD0A 3WPDA 4ECOA 5IJDA 3ULAA 4FDWA 3WPIA 1P8VA 1M10B 3G3AA 1OZNA 4NZTM 3E3ZA 4XOSA 4I6JB 3O6NA 2Z7XA 3RFJA 2JE0A 2O6RA 2O6SA 4HQ1A 2O6QA 2P1MB 4LSCA 3REZA 4PQ8A 4PERA 1DS9A 5AWDA 1O6TA 3E4GA 2Z82A 2V9TB 4CNMA 4Z8GA 4ARNA 1XWDC 4GLPA 4LSXC 3RGXA 1JL5A 1K5GC 4U7LA 2P1NB 4CC4C 3ZYJA 4K17A 3RJ0A 3UN9A 3W3NA 3C6OB 2XWTC 4M7EC 4L3FA 4R6AA 4R5CA 5AWBA 4RWTC 2UZYA 3UL8A 4R0AA 4Q3GA 1XCDA 4TZHA 4MN8B 5IJBA 1OTNA 2Z7XB 2V9SA 2BNHA 2JQDA 2P1OB 2P1PB 4EZGA 3ZYOA 5A5CA 1KOOA 1Z7XW 2ASTB 4C2AB 4RCAB 3G39A 4QBZA 3W3KA 2OMWA 3OGLB 4IM6A 4Z64C 2V70A 4R6JA 1O6VA 3RW7A 5IYXC 3UL7A 1XECA 3KJ4A 1OTOA 4LXSA 3SB4A 3RIZA 4R58A 2ELLA 4XGOA 4LI2A 2ID5A 3ULUA 4QXEA 3TSRE 4U09A 3WPFA 5HZLB 4FHOA 2Z66A 3GOZA 2Y5QA 4P91A 4GT6A 4FMZA 1ZIWA 4R09A 4NKHA 3CVRA 3WN4A 5GS2B 2WQVA 3DZEA 5AWCA 1OGQA 2Z65A 3WPEA 4YEBB 4AW4A
chains in the Genus database with same CATH topology
3CIGA 4LI1A 5AWAA 4BSRA 4MQWX 1FT8A 3W3JA 3RFSA 5FTTB 4LSXA 1H6TA 5GMHA 2WFHA 4FS7A 4CC4A 2Z64A 1FQVA 3OJAA 5B4PA 4M7EA 3O53A 2WQWA 3G04C 2CA6A 1FS2A 3C6NB 3P72A 4U06A 2Z63A 1YRGA 3RGZA 4BSSA 1W8AA 3W3LA 2BEXA 2OMTA 4Z79A 1QYYA 2A0ZA 4PEQB 1O6SA 4R08A 4H09A 4KXFB 3WPBA 4Q62A 3PMHG 1M0ZA 1A4YA 1K5DC 3M18A 3JB9j 1SQ0B 3A79B 4BV4R 4B8CD 3UL9A 4UFRA 4ARRA 1DFJI 3OJAB 3WPHA 3CIYA 4BSUA 4V2EA 1M9LA 5HDHA 4AY9X 1OOKG 3RFEA 1P9AG 2OMVA 1D0BA 3E2JA 4R6FA 3WPGA 4R5DA 5LFNA 4J0MA 3ZYNA 2RR6A 2JE1A 4XSQA 3OGMB 5GS0A 4R6GA 5B0NA 3G06A 1FO1A 2WQUA 3BZ5A 4V2CA 1GWBA 2OMYA 5GQRK 4LSAA 2OMXA 3E6JA 3ULVA 3VQ2A 4LXRA 3OGKB 4WP6A 1G9UA 5GMGA 4Z61C 2R9UA 2Z62A 1OTMA 2IFGA 4CP6A 2Z81A 3G3BA 4WYKA 2FT3A 1XKUA 3RW6A 5D3IA 1M9SA 5AZ5A 3C6PB 2OMUA 4RCWA 1WWLA 1U0ND 1LTXA 4J4LA 4V2DA 3ZYIA 4QC0A 4FCGA 2UZXA 4U08A 2Q4GW 4C2BB 5GMFA 4PSJA 4Q3IA 2P1QB 4P8SA 3VQ1A 4NKGA 1PGVA 3W3GA 4KNGA 5IJCA 3WPCA 1A9NA 1KOHA 2OMZA 1P8TA 1IO0A 4L3AA 3M19A 1XEUA 4CNCA 2RA8A 4G8AA 5CMPA 1DCEA 1H6UA 2XOTA 3FXIA 5CMNA 4R07A 3W3MA 4Z94G 4OQTA 4KT1A 4ECNA 4CILA 2ASSB 4PKIG 4Y61B 5B0TA 2WQXA 4FD0A 3WPDA 4ECOA 5IJDA 3ULAA 4FDWA 3WPIA 1P8VA 1M10B 3G3AA 1OZNA 3E3ZA 4XOSA 4I6JB 3O6NA 2Z7XA 3RFJA 2JE0A 2O6RA 2O6SA 4HQ1A 2O6QA 2P1MB 4LSCA 3REZA 4PQ8A 4PERA 1DS9A 5AWDA 1O6TA 3E4GA 2Z82A 2V9TB 4CNMA 4Z8GA 4ARNA 1XWDC 4GLPA 4LSXC 3RGXA 1JL5A 1K5GC 4U7LA 2P1NB 4CC4C 3ZYJA 4K17A 3RJ0A 3UN9A 3W3NA 3C6OB 2XWTC 4M7EC 4L3FA 4R6AA 4R5CA 5AWBA 4RWTC 2UZYA 3UL8A 4R0AA 4Q3GA 1XCDA 4TZHA 4MN8B 5IJBA 1OTNA 2Z7XB 2V9SA 2BNHA 2JQDA 2P1OB 2P1PB 4EZGA 3ZYOA 5A5CA 1KOOA 1Z7XW 2ASTB 4C2AB 4RCAB 3G39A 4QBZA 3W3KA 2OMWA 3OGLB 4IM6A 4Z64C 2V70A 4R6JA 1O6VA 3RW7A 5IYXC 3UL7A 1XECA 3KJ4A 1OTOA 4LXSA 3SB4A 3RIZA 4R58A 2ELLA 4XGOA 4LI2A 2ID5A 3ULUA 4QXEA 3TSRE 4U09A 3WPFA 5HZLB 4FHOA 2Z66A 3GOZA 2Y5QA 4P91A 4GT6A 4FMZA 1ZIWA 4R09A 4NKHA 3CVRA 3WN4A 5GS2B 2WQVA 3DZEA 5AWCA 1OGQA 2Z65A 3WPEA 4YEBB 4AW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIG A;  4LI1 A;  5AWA A;  4BSR A;  4MQW X;  1FT8 A;  3W3J A;  3RFS A;  5FTT B;  4LSX A;  1H6T A;  5GMH A;  2WFH A;  4FS7 A;  4CC4 A;  2Z64 A;  1FQV A;  3OJA A;  5B4P A;  4M7E A;  3O53 A;  2WQW A;  3G04 C;  2CA6 A;  1FS2 A;  3C6N B;  3P72 A;  4U06 A;  2Z63 A;  1YRG A;  3RGZ A;  4BSS A;  1W8A A;  3W3L A;  2BEX A;  2OMT A;  4Z79 A;  1QYY A;  2A0Z A;  4PEQ B;  1O6S A;  4R08 A;  4H09 A;  4KXF B;  3WPB A;  4Q62 A;  3PMH G;  1M0Z A;  1A4Y A;  1K5D C;  3M18 A;  3JB9 j;  1SQ0 B;  3A79 B;  4BV4 R;  4B8C D;  3UL9 A;  4UFR A;  4ARR A;  1DFJ I;  3OJA B;  3WPH A;  3CIY A;  4BSU A;  4V2E A;  1M9L A;  5HDH A;  4AY9 X;  1OOK G;  3RFE A;  1P9A G;  2OMV A;  1D0B A;  3E2J A;  4R6F A;  3WPG A;  4R5D A;  5LFN A;  4J0M A;  3ZYN A;  2RR6 A;  2JE1 A;  4XSQ A;  3OGM B;  5GS0 A;  4R6G A;  5B0N A;  3G06 A;  1FO1 A;  2WQU A;  3BZ5 A;  4V2C A;  1GWB A;  2OMY A;  5GQR K;  4LSA A;  2OMX A;  3E6J A;  3ULV A;  3VQ2 A;  4LXR A;  3OGK B;  4WP6 A;  1G9U A;  5GMG A;  4Z61 C;  2R9U A;  2Z62 A;  1OTM A;  2IFG A;  4CP6 A;  2Z81 A;  3G3B A;  4WYK A;  2FT3 A;  1XKU A;  3RW6 A;  5D3I A;  1M9S A;  5AZ5 A;  3C6P B;  2OMU A;  4RCW A;  1WWL A;  1U0N D;  1LTX A;  4J4L A;  4V2D A;  3ZYI A;  4QC0 A;  4FCG A;  2UZX A;  4U08 A;  2Q4G W;  4C2B B;  5GMF A;  4PSJ A;  4Q3I A;  2P1Q B;  4P8S A;  3VQ1 A;  4NKG A;  1PGV A;  3W3G A;  4KNG A;  5IJC A;  3WPC A;  1A9N A;  1KOH A;  2OMZ A;  1P8T A;  1IO0 A;  4L3A A;  3M19 A;  1XEU A;  4CNC A;  2RA8 A;  4G8A A;  5CMP A;  1DCE A;  1H6U A;  2XOT A;  3FXI A;  5CMN A;  4R07 A;  3W3M A;  4Z94 G;  4OQT A;  4KT1 A;  4ECN A;  4CIL A;  2ASS B;  4PKI G;  4Y61 B;  5B0T A;  2WQX A;  4FD0 A;  3WPD A;  4ECO A;  5IJD A;  3ULA A;  4FDW A;  3WPI A;  1P8V A;  1M10 B;  3G3A A;  1OZN A;  3E3Z A;  4XOS A;  4I6J B;  3O6N A;  2Z7X A;  3RFJ A;  2JE0 A;  2O6R A;  2O6S A;  4HQ1 A;  2O6Q A;  2P1M B;  4LSC A;  3REZ A;  4PQ8 A;  4PER A;  1DS9 A;  5AWD A;  1O6T A;  3E4G A;  2Z82 A;  2V9T B;  4CNM A;  4Z8G A;  4ARN A;  1XWD C;  4GLP A;  4LSX C;  3RGX A;  1JL5 A;  1K5G C;  4U7L A;  2P1N B;  4CC4 C;  3ZYJ A;  4K17 A;  3RJ0 A;  3UN9 A;  3W3N A;  3C6O B;  2XWT C;  4M7E C;  4L3F A;  4R6A A;  4R5C A;  5AWB A;  4RWT C;  2UZY A;  3UL8 A;  4R0A A;  4Q3G A;  1XCD A;  4TZH A;  4MN8 B;  5IJB A;  1OTN A;  2Z7X B;  2V9S A;  2BNH A;  2JQD A;  2P1O B;  2P1P B;  4EZG A;  3ZYO A;  5A5C A;  1KOO A;  1Z7X W;  2AST B;  4C2A B;  4RCA B;  3G39 A;  4QBZ A;  3W3K A;  2OMW A;  3OGL B;  4IM6 A;  4Z64 C;  2V70 A;  4R6J A;  1O6V A;  3RW7 A;  5IYX C;  3UL7 A;  1XEC A;  3KJ4 A;  1OTO A;  4LXS A;  3SB4 A;  3RIZ A;  4R58 A;  2ELL A;  4XGO A;  4LI2 A;  2ID5 A;  3ULU A;  4QXE A;  3TSR E;  4U09 A;  3WPF A;  5HZL B;  4FHO A;  2Z66 A;  3GOZ A;  2Y5Q A;  4P91 A;  4GT6 A;  4FMZ A;  1ZIW A;  4R09 A;  4NKH A;  3CVR A;  3WN4 A;  5GS2 B;  2WQV A;  3DZE A;  5AWC A;  1OGQ A;  2Z65 A;  3WPE A;  4YEB B;  4AW4 A; 
#chains in the Genus database with same CATH topology
 3CIG A;  4LI1 A;  5AWA A;  4BSR A;  4MQW X;  1FT8 A;  3W3J A;  3RFS A;  5FTT B;  4LSX A;  1H6T A;  5GMH A;  2WFH A;  4FS7 A;  4CC4 A;  2Z64 A;  1FQV A;  3OJA A;  5B4P A;  4M7E A;  3O53 A;  2WQW A;  3G04 C;  2CA6 A;  1FS2 A;  3C6N B;  3P72 A;  4U06 A;  2Z63 A;  1YRG A;  3RGZ A;  4BSS A;  1W8A A;  3W3L A;  2BEX A;  2OMT A;  4Z79 A;  1QYY A;  2A0Z A;  4PEQ B;  1O6S A;  4R08 A;  4H09 A;  4KXF B;  3WPB A;  4Q62 A;  3PMH G;  1M0Z A;  1A4Y A;  1K5D C;  3M18 A;  3JB9 j;  1SQ0 B;  3A79 B;  4BV4 R;  4B8C D;  3UL9 A;  4UFR A;  4ARR A;  1DFJ I;  3OJA B;  3WPH A;  3CIY A;  4BSU A;  4V2E A;  1M9L A;  5HDH A;  4AY9 X;  1OOK G;  3RFE A;  1P9A G;  2OMV A;  1D0B A;  3E2J A;  4R6F A;  3WPG A;  4R5D A;  5LFN A;  4J0M A;  3ZYN A;  2RR6 A;  2JE1 A;  4XSQ A;  3OGM B;  5GS0 A;  4R6G A;  5B0N A;  3G06 A;  1FO1 A;  2WQU A;  3BZ5 A;  4V2C A;  1GWB A;  2OMY A;  5GQR K;  4LSA A;  2OMX A;  3E6J A;  3ULV A;  3VQ2 A;  4LXR A;  3OGK B;  4WP6 A;  1G9U A;  5GMG A;  4Z61 C;  2R9U A;  2Z62 A;  1OTM A;  2IFG A;  4CP6 A;  2Z81 A;  3G3B A;  4WYK A;  2FT3 A;  1XKU A;  3RW6 A;  5D3I A;  1M9S A;  5AZ5 A;  3C6P B;  2OMU A;  4RCW A;  1WWL A;  1U0N D;  1LTX A;  4J4L A;  4V2D A;  3ZYI A;  4QC0 A;  4FCG A;  2UZX A;  4U08 A;  2Q4G W;  4C2B B;  5GMF A;  4PSJ A;  4Q3I A;  2P1Q B;  4NZR M;  4P8S A;  3VQ1 A;  4NKG A;  1PGV A;  3W3G A;  4KNG A;  5IJC A;  3WPC A;  1A9N A;  1KOH A;  2OMZ A;  1P8T A;  1IO0 A;  4L3A A;  3M19 A;  1XEU A;  4CNC A;  2RA8 A;  4G8A A;  5CMP A;  1DCE A;  1H6U A;  2XOT A;  3FXI A;  5CMN A;  4R07 A;  3W3M A;  4Z94 G;  4OQT A;  4KT1 A;  4ECN A;  4CIL A;  2ASS B;  4PKI G;  4Y61 B;  5B0T A;  2WQX A;  4FD0 A;  3WPD A;  4ECO A;  5IJD A;  3ULA A;  4FDW A;  3WPI A;  1P8V A;  1M10 B;  3G3A A;  1OZN A;  4NZT M;  3E3Z A;  4XOS A;  4I6J B;  3O6N A;  2Z7X A;  3RFJ A;  2JE0 A;  2O6R A;  2O6S A;  4HQ1 A;  2O6Q A;  2P1M B;  4LSC A;  3REZ A;  4PQ8 A;  4PER A;  1DS9 A;  5AWD A;  1O6T A;  3E4G A;  2Z82 A;  2V9T B;  4CNM A;  4Z8G A;  4ARN A;  1XWD C;  4GLP A;  4LSX C;  3RGX A;  1JL5 A;  1K5G C;  4U7L A;  2P1N B;  4CC4 C;  3ZYJ A;  4K17 A;  3RJ0 A;  3UN9 A;  3W3N A;  3C6O B;  2XWT C;  4M7E C;  4L3F A;  4R6A A;  4R5C A;  5AWB A;  4RWT C;  2UZY A;  3UL8 A;  4R0A A;  4Q3G A;  1XCD A;  4TZH A;  4MN8 B;  5IJB A;  1OTN A;  2Z7X B;  2V9S A;  2BNH A;  2JQD A;  2P1O B;  2P1P B;  4EZG A;  3ZYO A;  5A5C A;  1KOO A;  1Z7X W;  2AST B;  4C2A B;  4RCA B;  3G39 A;  4QBZ A;  3W3K A;  2OMW A;  3OGL B;  4IM6 A;  4Z64 C;  2V70 A;  4R6J A;  1O6V A;  3RW7 A;  5IYX C;  3UL7 A;  1XEC A;  3KJ4 A;  1OTO A;  4LXS A;  3SB4 A;  3RIZ A;  4R58 A;  2ELL A;  4XGO A;  4LI2 A;  2ID5 A;  3ULU A;  4QXE A;  3TSR E;  4U09 A;  3WPF A;  5HZL B;  4FHO A;  2Z66 A;  3GOZ A;  2Y5Q A;  4P91 A;  4GT6 A;  4FMZ A;  1ZIW A;  4R09 A;  4NKH A;  3CVR A;  3WN4 A;  5GS2 B;  2WQV A;  3DZE A;  5AWC A;  1OGQ A;  2Z65 A;  3WPE A;  4YEB B;  4AW4 A; 
#chains in the Genus database with same CATH homology
 3CIG A;  4LI1 A;  5AWA A;  4BSR A;  4MQW X;  1FT8 A;  3W3J A;  3RFS A;  5FTT B;  4LSX A;  1H6T A;  5GMH A;  2WFH A;  4FS7 A;  4CC4 A;  2Z64 A;  1FQV A;  3OJA A;  5B4P A;  4M7E A;  3O53 A;  2WQW A;  3G04 C;  2CA6 A;  1FS2 A;  3C6N B;  3P72 A;  4U06 A;  2Z63 A;  1YRG A;  3RGZ A;  4BSS A;  1W8A A;  3W3L A;  2BEX A;  2OMT A;  4Z79 A;  1QYY A;  2A0Z A;  4PEQ B;  1O6S A;  4R08 A;  4H09 A;  4KXF B;  3WPB A;  4Q62 A;  3PMH G;  1M0Z A;  1A4Y A;  1K5D C;  3M18 A;  3JB9 j;  1SQ0 B;  3A79 B;  4BV4 R;  4B8C D;  3UL9 A;  4UFR A;  4ARR A;  1DFJ I;  3OJA B;  3WPH A;  3CIY A;  4BSU A;  4V2E A;  1M9L A;  5HDH A;  4AY9 X;  1OOK G;  3RFE A;  1P9A G;  2OMV A;  1D0B A;  3E2J A;  4R6F A;  3WPG A;  4R5D A;  5LFN A;  4J0M A;  3ZYN A;  2RR6 A;  2JE1 A;  4XSQ A;  3OGM B;  5GS0 A;  4R6G A;  5B0N A;  3G06 A;  1FO1 A;  2WQU A;  3BZ5 A;  4V2C A;  1GWB A;  2OMY A;  5GQR K;  4LSA A;  2OMX A;  3E6J A;  3ULV A;  3VQ2 A;  4LXR A;  3OGK B;  4WP6 A;  1G9U A;  5GMG A;  4Z61 C;  2R9U A;  2Z62 A;  1OTM A;  2IFG A;  4CP6 A;  2Z81 A;  3G3B A;  4WYK A;  2FT3 A;  1XKU A;  3RW6 A;  5D3I A;  1M9S A;  5AZ5 A;  3C6P B;  2OMU A;  4RCW A;  1WWL A;  1U0N D;  1LTX A;  4J4L A;  4V2D A;  3ZYI A;  4QC0 A;  4FCG A;  2UZX A;  4U08 A;  2Q4G W;  4C2B B;  5GMF A;  4PSJ A;  4Q3I A;  2P1Q B;  4P8S A;  3VQ1 A;  4NKG A;  1PGV A;  3W3G A;  4KNG A;  5IJC A;  3WPC A;  1A9N A;  1KOH A;  2OMZ A;  1P8T A;  1IO0 A;  4L3A A;  3M19 A;  1XEU A;  4CNC A;  2RA8 A;  4G8A A;  5CMP A;  1DCE A;  1H6U A;  2XOT A;  3FXI A;  5CMN A;  4R07 A;  3W3M A;  4Z94 G;  4OQT A;  4KT1 A;  4ECN A;  4CIL A;  2ASS B;  4PKI G;  4Y61 B;  5B0T A;  2WQX A;  4FD0 A;  3WPD A;  4ECO A;  5IJD A;  3ULA A;  4FDW A;  3WPI A;  1P8V A;  1M10 B;  3G3A A;  1OZN A;  3E3Z A;  4XOS A;  4I6J B;  3O6N A;  2Z7X A;  3RFJ A;  2JE0 A;  2O6R A;  2O6S A;  4HQ1 A;  2O6Q A;  2P1M B;  4LSC A;  3REZ A;  4PQ8 A;  4PER A;  1DS9 A;  5AWD A;  1O6T A;  3E4G A;  2Z82 A;  2V9T B;  4CNM A;  4Z8G A;  4ARN A;  1XWD C;  4GLP A;  4LSX C;  3RGX A;  1JL5 A;  1K5G C;  4U7L A;  2P1N B;  4CC4 C;  3ZYJ A;  4K17 A;  3RJ0 A;  3UN9 A;  3W3N A;  3C6O B;  2XWT C;  4M7E C;  4L3F A;  4R6A A;  4R5C A;  5AWB A;  4RWT C;  2UZY A;  3UL8 A;  4R0A A;  4Q3G A;  1XCD A;  4TZH A;  4MN8 B;  5IJB A;  1OTN A;  2Z7X B;  2V9S A;  2BNH A;  2JQD A;  2P1O B;  2P1P B;  4EZG A;  3ZYO A;  5A5C A;  1KOO A;  1Z7X W;  2AST B;  4C2A B;  4RCA B;  3G39 A;  4QBZ A;  3W3K A;  2OMW A;  3OGL B;  4IM6 A;  4Z64 C;  2V70 A;  4R6J A;  1O6V A;  3RW7 A;  5IYX C;  3UL7 A;  1XEC A;  3KJ4 A;  1OTO A;  4LXS A;  3SB4 A;  3RIZ A;  4R58 A;  2ELL A;  4XGO A;  4LI2 A;  2ID5 A;  3ULU A;  4QXE A;  3TSR E;  4U09 A;  3WPF A;  5HZL B;  4FHO A;  2Z66 A;  3GOZ A;  2Y5Q A;  4P91 A;  4GT6 A;  4FMZ A;  1ZIW A;  4R09 A;  4NKH A;  3CVR A;  3WN4 A;  5GS2 B;  2WQV A;  3DZE A;  5AWC A;  1OGQ A;  2Z65 A;  3WPE A;  4YEB B;  4AW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...