4R6FA

Crystal structure of computational designed protein dlrr_i
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
329
structure length
329
Chain Sequence
b'TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNNIANINDQMLEGLTNLTTLNLSHNNLARLWKHANPGGPIYFLKGLTNLTTLNLSSNGFDEIPREVFKDLTSLTTLNLSNNNIANINDQMLEGLTNLTTLNLSHNNLARLWKHANPGGPIYFLKGLTNLTTLNLSSNGFDEIPREVFKDLTSLTTLNLSNNQLTSLPQGVFERLTNLKTLNLSNNQLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine rich repeat DLRR_I
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 117
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 2014-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r6fA00
2FT3A 4FS7A 5IYXC 5D3IA 3WPDA 3OGKB 4LI1A 3M18A 5AWCA 2OMZA 3E2JA 4FHOA 1Z7XW 2A0ZA 4R6FA 3WN4A 3E4GA 4CNMA 3ZYNA 4R5CA 1ZIWA 5GMGA 5FTTB 1DS9A 4RCAB 4J4LA 5IJBA 4EZGA 4WYKA 5GMFA 4P91A 4R07A 3JB9j 4FD0A 4FMZA 3RJ0A 3CIYA 3W3MA 3G3AA 3ZYOA 4LI2A 3RGZA 3W3KA 4R5DA 3ULVA 2WQWA 1A4YA 2Z62A 3RFEA 3TSRE 3OJAA 1DFJI 3UL8A 3E3ZA 2R9UA 2Z65A 4YEBB 2JE0A 4PEQB 4LSXC 4LSCA 5GQRK 5HDHA 2OMVA 1FT8A 4M7EA 3WPCA 2P1MB 2Z64A 2ID5A 4PERA 4KT1A 2WQUA 1K5GC 4G8AA 3W3JA 4BSRA 4ECNA 3RFSA 1M0ZA 4PKIG 2ASTB 2O6SA 4QC0A 4XSQA 4R0AA 3UN9A 3G39A 3M19A 4R58A 3ZYIA 1OZNA 1YRGA 3REZA 1KOHA 1XECA 3GOZA 1XWDC 2P1OB 4Q3GA 1H6UA 2V9TB 1FQVA 3UL9A 2V70A 3WPHA 3RFJA 1FO1A 1G9UA 4FDWA 3FXIA 1U0ND 4R6AA 4B8CD 4GT6A 3C6PB 4MN8B 4GLPA 4PSJA 2RA8A 4NKHA 2P1PB 5AWAA 2XWTC 1OTMA 3RGXA 2Z81A 3RW6A 3PMHG 4CNCA 2UZXA 2O6QA 4UFRA 4V2EA 3G06A 4C2AB 5LFNA 4XGOA 1O6VA 3A79B 3WPEA 3ULUA 3OJAB 4LXSA 5AWBA 2ASSB 4R6GA 1K5DC 3O53A 2OMTA 1OGQA 5HZLB 5CMPA 1PGVA 2V9SA 4R6JA 3VQ1A 1OTOA 2P1NB 2JE1A 2BNHA 4TZHA 1O6SA 2IFGA 4LXRA 3DZEA 5AWDA 4C2BB 4U06A 4RCWA 4XOSA 1OOKG 4CILA 3P72A 1A9NA 2OMYA 2P1QB 4KNGA 3WPFA 4QXEA 3WPBA 2OMWA 2Z82A 4R09A 2CA6A 3W3GA 2RR6A 3G3BA 2Y5QA 1SQ0B 4LSXA 3CIGA 5GS0A 4J0MA 1LTXA 1WWLA 1OTNA 4Z79A 2ELLA 3W3LA 2BEXA 5A5CA 4K17A 3OGLB 4Z61C 4KXFB 4IM6A 2Z66A 5IJCA 4ARNA 2XOTA 4QBZA 5B4PA 4U7LA 3VQ2A 5CMNA 1XEUA 1M10B 2UZYA 5GS2B 3RW7A 4ECOA 4U08A 4V2CA 4H09A 2Z7XA 3C6OB 4OQTA 3WPGA 1KOOA 4U09A 2OMUA 4R08A 3OGMB 4NKGA 4CC4C 4Z94G 4Y61B 4M7EC 1P9AG 4AY9X 4BSSA 3W3NA 4L3AA 4AW4A 3G04C 1FS2A 5AZ5A 5GMHA 3WPIA 4Z64C 3RIZA 3SB4A 3ZYJA 1QYYA 4HQ1A 4FCGA 1M9SA 2Z63A 4WP6A 3BZ5A 4CC4A 3C6NB 2JQDA 1D0BA 2WQVA 5IJDA 1XKUA 3O6NA 4Q3IA 1DCEA 4Z8GA 1M9LA 3KJ4A 2WQXA 1XCDA 4V2DA 3ULAA 4PQ8A 1GWBA 3E6JA 3UL7A 1IO0A 4BSUA 1P8TA 4I6JB 2O6RA 2WFHA 4P8SA 5B0NA 4ARRA 4BV4R 2OMXA 2Q4GW 4MQWX 4Q62A 1P8VA 4L3FA 3CVRA 1H6TA 5B0TA 4CP6A 4RWTC 1O6TA 1W8AA 4LSAA 2Z7XB 1JL5A
chains in the Genus database with same CATH superfamily
2FT3A 4FS7A 5IYXC 5D3IA 3WPDA 3OGKB 4LI1A 3M18A 5AWCA 2OMZA 3E2JA 4FHOA 1Z7XW 2A0ZA 4R6FA 3WN4A 3E4GA 4CNMA 3ZYNA 4R5CA 1ZIWA 5GMGA 5FTTB 1DS9A 4RCAB 4J4LA 5IJBA 4EZGA 4WYKA 5GMFA 4P91A 4R07A 3JB9j 4FD0A 4FMZA 3RJ0A 3CIYA 3W3MA 3G3AA 3ZYOA 4LI2A 3RGZA 3W3KA 4R5DA 3ULVA 2WQWA 1A4YA 2Z62A 3RFEA 3TSRE 3OJAA 1DFJI 3UL8A 3E3ZA 2R9UA 2Z65A 4YEBB 2JE0A 4PEQB 4LSXC 4LSCA 5GQRK 5HDHA 2OMVA 1FT8A 4M7EA 3WPCA 2P1MB 2Z64A 2ID5A 4PERA 4KT1A 2WQUA 1K5GC 4G8AA 3W3JA 4BSRA 4ECNA 3RFSA 1M0ZA 4PKIG 2ASTB 2O6SA 4QC0A 4XSQA 4NZRM 4R0AA 3UN9A 3G39A 3M19A 4R58A 3ZYIA 1OZNA 1YRGA 3REZA 1KOHA 1XECA 3GOZA 1XWDC 2P1OB 4Q3GA 1H6UA 2V9TB 1FQVA 3UL9A 2V70A 3WPHA 3RFJA 1FO1A 1G9UA 4FDWA 3FXIA 1U0ND 4R6AA 4B8CD 4GT6A 3C6PB 4MN8B 4GLPA 4PSJA 2RA8A 4NKHA 2P1PB 5AWAA 2XWTC 1OTMA 3RGXA 2Z81A 3RW6A 3PMHG 4CNCA 2UZXA 2O6QA 4UFRA 4V2EA 3G06A 4C2AB 5LFNA 4XGOA 1O6VA 3A79B 3WPEA 3ULUA 3OJAB 4LXSA 5AWBA 2ASSB 4R6GA 1K5DC 3O53A 2OMTA 1OGQA 5HZLB 5CMPA 1PGVA 2V9SA 4R6JA 3VQ1A 1OTOA 2P1NB 2JE1A 2BNHA 4TZHA 1O6SA 2IFGA 4LXRA 3DZEA 5AWDA 4C2BB 4U06A 4RCWA 4XOSA 1OOKG 4CILA 3P72A 1A9NA 2OMYA 2P1QB 4KNGA 3WPFA 4QXEA 3WPBA 2OMWA 2Z82A 4R09A 2CA6A 3W3GA 2RR6A 3G3BA 2Y5QA 1SQ0B 4LSXA 3CIGA 5GS0A 4J0MA 1LTXA 1WWLA 1OTNA 4Z79A 2ELLA 3W3LA 2BEXA 5A5CA 4K17A 3OGLB 4Z61C 4KXFB 4IM6A 2Z66A 5IJCA 4ARNA 2XOTA 4QBZA 5B4PA 4U7LA 3VQ2A 5CMNA 1XEUA 1M10B 2UZYA 5GS2B 3RW7A 4ECOA 4U08A 4V2CA 4H09A 2Z7XA 3C6OB 4OQTA 3WPGA 1KOOA 4U09A 2OMUA 4R08A 3OGMB 4NKGA 4CC4C 4Z94G 4Y61B 4M7EC 1P9AG 4AY9X 4BSSA 3W3NA 4L3AA 4AW4A 3G04C 1FS2A 5AZ5A 5GMHA 3WPIA 4Z64C 3RIZA 3SB4A 3ZYJA 1QYYA 4HQ1A 4FCGA 1M9SA 2Z63A 4WP6A 3BZ5A 4CC4A 3C6NB 2JQDA 1D0BA 2WQVA 5IJDA 1XKUA 3O6NA 4Q3IA 1DCEA 4Z8GA 1M9LA 3KJ4A 2WQXA 1XCDA 4V2DA 3ULAA 4PQ8A 1GWBA 3E6JA 3UL7A 1IO0A 4BSUA 1P8TA 4I6JB 2O6RA 2WFHA 4P8SA 5B0NA 4ARRA 4BV4R 2OMXA 2Q4GW 4MQWX 4Q62A 4NZTM 1P8VA 4L3FA 3CVRA 1H6TA 5B0TA 4CP6A 4RWTC 1O6TA 1W8AA 4LSAA 2Z7XB 1JL5A
chains in the Genus database with same CATH topology
2FT3A 4FS7A 5IYXC 5D3IA 3WPDA 3OGKB 4LI1A 3M18A 5AWCA 2OMZA 3E2JA 4FHOA 1Z7XW 2A0ZA 4R6FA 3WN4A 3E4GA 4CNMA 3ZYNA 4R5CA 1ZIWA 5GMGA 5FTTB 1DS9A 4RCAB 4J4LA 5IJBA 4EZGA 4WYKA 5GMFA 4P91A 4R07A 3JB9j 4FD0A 4FMZA 3RJ0A 3CIYA 3W3MA 3G3AA 3ZYOA 4LI2A 3RGZA 3W3KA 4R5DA 3ULVA 2WQWA 1A4YA 2Z62A 3RFEA 3TSRE 3OJAA 1DFJI 3UL8A 3E3ZA 2R9UA 2Z65A 4YEBB 2JE0A 4PEQB 4LSXC 4LSCA 5GQRK 5HDHA 2OMVA 1FT8A 4M7EA 3WPCA 2P1MB 2Z64A 2ID5A 4PERA 4KT1A 2WQUA 1K5GC 4G8AA 3W3JA 4BSRA 4ECNA 3RFSA 1M0ZA 4PKIG 2ASTB 2O6SA 4QC0A 4XSQA 4R0AA 3UN9A 3G39A 3M19A 4R58A 3ZYIA 1OZNA 1YRGA 3REZA 1KOHA 1XECA 3GOZA 1XWDC 2P1OB 4Q3GA 1H6UA 2V9TB 1FQVA 3UL9A 2V70A 3WPHA 3RFJA 1FO1A 1G9UA 4FDWA 3FXIA 1U0ND 4R6AA 4B8CD 4GT6A 3C6PB 4MN8B 4GLPA 4PSJA 2RA8A 4NKHA 2P1PB 5AWAA 2XWTC 1OTMA 3RGXA 2Z81A 3RW6A 3PMHG 4CNCA 2UZXA 2O6QA 4UFRA 4V2EA 3G06A 4C2AB 5LFNA 4XGOA 1O6VA 3A79B 3WPEA 3ULUA 3OJAB 4LXSA 5AWBA 2ASSB 4R6GA 1K5DC 3O53A 2OMTA 1OGQA 5HZLB 5CMPA 1PGVA 2V9SA 4R6JA 3VQ1A 1OTOA 2P1NB 2JE1A 2BNHA 4TZHA 1O6SA 2IFGA 4LXRA 3DZEA 5AWDA 4C2BB 4U06A 4RCWA 4XOSA 1OOKG 4CILA 3P72A 1A9NA 2OMYA 2P1QB 4KNGA 3WPFA 4QXEA 3WPBA 2OMWA 2Z82A 4R09A 2CA6A 3W3GA 2RR6A 3G3BA 2Y5QA 1SQ0B 4LSXA 3CIGA 5GS0A 4J0MA 1LTXA 1WWLA 1OTNA 4Z79A 2ELLA 3W3LA 2BEXA 5A5CA 4K17A 3OGLB 4Z61C 4KXFB 4IM6A 2Z66A 5IJCA 4ARNA 2XOTA 4QBZA 5B4PA 4U7LA 3VQ2A 5CMNA 1XEUA 1M10B 2UZYA 5GS2B 3RW7A 4ECOA 4U08A 4V2CA 4H09A 2Z7XA 3C6OB 4OQTA 3WPGA 1KOOA 4U09A 2OMUA 4R08A 3OGMB 4NKGA 4CC4C 4Z94G 4Y61B 4M7EC 1P9AG 4AY9X 4BSSA 3W3NA 4L3AA 4AW4A 3G04C 1FS2A 5AZ5A 5GMHA 3WPIA 4Z64C 3RIZA 3SB4A 3ZYJA 1QYYA 4HQ1A 4FCGA 1M9SA 2Z63A 4WP6A 3BZ5A 4CC4A 3C6NB 2JQDA 1D0BA 2WQVA 5IJDA 1XKUA 3O6NA 4Q3IA 1DCEA 4Z8GA 1M9LA 3KJ4A 2WQXA 1XCDA 4V2DA 3ULAA 4PQ8A 1GWBA 3E6JA 3UL7A 1IO0A 4BSUA 1P8TA 4I6JB 2O6RA 2WFHA 4P8SA 5B0NA 4ARRA 4BV4R 2OMXA 2Q4GW 4MQWX 4Q62A 1P8VA 4L3FA 3CVRA 1H6TA 5B0TA 4CP6A 4RWTC 1O6TA 1W8AA 4LSAA 2Z7XB 1JL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT3 A;  4FS7 A;  5IYX C;  5D3I A;  3WPD A;  3OGK B;  4LI1 A;  3M18 A;  5AWC A;  2OMZ A;  3E2J A;  4FHO A;  1Z7X W;  2A0Z A;  4R6F A;  3WN4 A;  3E4G A;  4CNM A;  3ZYN A;  4R5C A;  1ZIW A;  5GMG A;  5FTT B;  1DS9 A;  4RCA B;  4J4L A;  5IJB A;  4EZG A;  4WYK A;  5GMF A;  4P91 A;  4R07 A;  3JB9 j;  4FD0 A;  4FMZ A;  3RJ0 A;  3CIY A;  3W3M A;  3G3A A;  3ZYO A;  4LI2 A;  3RGZ A;  3W3K A;  4R5D A;  3ULV A;  2WQW A;  1A4Y A;  2Z62 A;  3RFE A;  3TSR E;  3OJA A;  1DFJ I;  3UL8 A;  3E3Z A;  2R9U A;  2Z65 A;  4YEB B;  2JE0 A;  4PEQ B;  4LSX C;  4LSC A;  5GQR K;  5HDH A;  2OMV A;  1FT8 A;  4M7E A;  3WPC A;  2P1M B;  2Z64 A;  2ID5 A;  4PER A;  4KT1 A;  2WQU A;  1K5G C;  4G8A A;  3W3J A;  4BSR A;  4ECN A;  3RFS A;  1M0Z A;  4PKI G;  2AST B;  2O6S A;  4QC0 A;  4XSQ A;  4R0A A;  3UN9 A;  3G39 A;  3M19 A;  4R58 A;  3ZYI A;  1OZN A;  1YRG A;  3REZ A;  1KOH A;  1XEC A;  3GOZ A;  1XWD C;  2P1O B;  4Q3G A;  1H6U A;  2V9T B;  1FQV A;  3UL9 A;  2V70 A;  3WPH A;  3RFJ A;  1FO1 A;  1G9U A;  4FDW A;  3FXI A;  1U0N D;  4R6A A;  4B8C D;  4GT6 A;  3C6P B;  4MN8 B;  4GLP A;  4PSJ A;  2RA8 A;  4NKH A;  2P1P B;  5AWA A;  2XWT C;  1OTM A;  3RGX A;  2Z81 A;  3RW6 A;  3PMH G;  4CNC A;  2UZX A;  2O6Q A;  4UFR A;  4V2E A;  3G06 A;  4C2A B;  5LFN A;  4XGO A;  1O6V A;  3A79 B;  3WPE A;  3ULU A;  3OJA B;  4LXS A;  5AWB A;  2ASS B;  4R6G A;  1K5D C;  3O53 A;  2OMT A;  1OGQ A;  5HZL B;  5CMP A;  1PGV A;  2V9S A;  4R6J A;  3VQ1 A;  1OTO A;  2P1N B;  2JE1 A;  2BNH A;  4TZH A;  1O6S A;  2IFG A;  4LXR A;  3DZE A;  5AWD A;  4C2B B;  4U06 A;  4RCW A;  4XOS A;  1OOK G;  4CIL A;  3P72 A;  1A9N A;  2OMY A;  2P1Q B;  4KNG A;  3WPF A;  4QXE A;  3WPB A;  2OMW A;  2Z82 A;  4R09 A;  2CA6 A;  3W3G A;  2RR6 A;  3G3B A;  2Y5Q A;  1SQ0 B;  4LSX A;  3CIG A;  5GS0 A;  4J0M A;  1LTX A;  1WWL A;  1OTN A;  4Z79 A;  2ELL A;  3W3L A;  2BEX A;  5A5C A;  4K17 A;  3OGL B;  4Z61 C;  4KXF B;  4IM6 A;  2Z66 A;  5IJC A;  4ARN A;  2XOT A;  4QBZ A;  5B4P A;  4U7L A;  3VQ2 A;  5CMN A;  1XEU A;  1M10 B;  2UZY A;  5GS2 B;  3RW7 A;  4ECO A;  4U08 A;  4V2C A;  4H09 A;  2Z7X A;  3C6O B;  4OQT A;  3WPG A;  1KOO A;  4U09 A;  2OMU A;  4R08 A;  3OGM B;  4NKG A;  4CC4 C;  4Z94 G;  4Y61 B;  4M7E C;  1P9A G;  4AY9 X;  4BSS A;  3W3N A;  4L3A A;  4AW4 A;  3G04 C;  1FS2 A;  5AZ5 A;  5GMH A;  3WPI A;  4Z64 C;  3RIZ A;  3SB4 A;  3ZYJ A;  1QYY A;  4HQ1 A;  4FCG A;  1M9S A;  2Z63 A;  4WP6 A;  3BZ5 A;  4CC4 A;  3C6N B;  2JQD A;  1D0B A;  2WQV A;  5IJD A;  1XKU A;  3O6N A;  4Q3I A;  1DCE A;  4Z8G A;  1M9L A;  3KJ4 A;  2WQX A;  1XCD A;  4V2D A;  3ULA A;  4PQ8 A;  1GWB A;  3E6J A;  3UL7 A;  1IO0 A;  4BSU A;  1P8T A;  4I6J B;  2O6R A;  2WFH A;  4P8S A;  5B0N A;  4ARR A;  4BV4 R;  2OMX A;  2Q4G W;  4MQW X;  4Q62 A;  1P8V A;  4L3F A;  3CVR A;  1H6T A;  5B0T A;  4CP6 A;  4RWT C;  1O6T A;  1W8A A;  4LSA A;  2Z7X B;  1JL5 A; 
#chains in the Genus database with same CATH topology
 2FT3 A;  4FS7 A;  5IYX C;  5D3I A;  3WPD A;  3OGK B;  4LI1 A;  3M18 A;  5AWC A;  2OMZ A;  3E2J A;  4FHO A;  1Z7X W;  2A0Z A;  4R6F A;  3WN4 A;  3E4G A;  4CNM A;  3ZYN A;  4R5C A;  1ZIW A;  5GMG A;  5FTT B;  1DS9 A;  4RCA B;  4J4L A;  5IJB A;  4EZG A;  4WYK A;  5GMF A;  4P91 A;  4R07 A;  3JB9 j;  4FD0 A;  4FMZ A;  3RJ0 A;  3CIY A;  3W3M A;  3G3A A;  3ZYO A;  4LI2 A;  3RGZ A;  3W3K A;  4R5D A;  3ULV A;  2WQW A;  1A4Y A;  2Z62 A;  3RFE A;  3TSR E;  3OJA A;  1DFJ I;  3UL8 A;  3E3Z A;  2R9U A;  2Z65 A;  4YEB B;  2JE0 A;  4PEQ B;  4LSX C;  4LSC A;  5GQR K;  5HDH A;  2OMV A;  1FT8 A;  4M7E A;  3WPC A;  2P1M B;  2Z64 A;  2ID5 A;  4PER A;  4KT1 A;  2WQU A;  1K5G C;  4G8A A;  3W3J A;  4BSR A;  4ECN A;  3RFS A;  1M0Z A;  4PKI G;  2AST B;  2O6S A;  4QC0 A;  4XSQ A;  4NZR M;  4R0A A;  3UN9 A;  3G39 A;  3M19 A;  4R58 A;  3ZYI A;  1OZN A;  1YRG A;  3REZ A;  1KOH A;  1XEC A;  3GOZ A;  1XWD C;  2P1O B;  4Q3G A;  1H6U A;  2V9T B;  1FQV A;  3UL9 A;  2V70 A;  3WPH A;  3RFJ A;  1FO1 A;  1G9U A;  4FDW A;  3FXI A;  1U0N D;  4R6A A;  4B8C D;  4GT6 A;  3C6P B;  4MN8 B;  4GLP A;  4PSJ A;  2RA8 A;  4NKH A;  2P1P B;  5AWA A;  2XWT C;  1OTM A;  3RGX A;  2Z81 A;  3RW6 A;  3PMH G;  4CNC A;  2UZX A;  2O6Q A;  4UFR A;  4V2E A;  3G06 A;  4C2A B;  5LFN A;  4XGO A;  1O6V A;  3A79 B;  3WPE A;  3ULU A;  3OJA B;  4LXS A;  5AWB A;  2ASS B;  4R6G A;  1K5D C;  3O53 A;  2OMT A;  1OGQ A;  5HZL B;  5CMP A;  1PGV A;  2V9S A;  4R6J A;  3VQ1 A;  1OTO A;  2P1N B;  2JE1 A;  2BNH A;  4TZH A;  1O6S A;  2IFG A;  4LXR A;  3DZE A;  5AWD A;  4C2B B;  4U06 A;  4RCW A;  4XOS A;  1OOK G;  4CIL A;  3P72 A;  1A9N A;  2OMY A;  2P1Q B;  4KNG A;  3WPF A;  4QXE A;  3WPB A;  2OMW A;  2Z82 A;  4R09 A;  2CA6 A;  3W3G A;  2RR6 A;  3G3B A;  2Y5Q A;  1SQ0 B;  4LSX A;  3CIG A;  5GS0 A;  4J0M A;  1LTX A;  1WWL A;  1OTN A;  4Z79 A;  2ELL A;  3W3L A;  2BEX A;  5A5C A;  4K17 A;  3OGL B;  4Z61 C;  4KXF B;  4IM6 A;  2Z66 A;  5IJC A;  4ARN A;  2XOT A;  4QBZ A;  5B4P A;  4U7L A;  3VQ2 A;  5CMN A;  1XEU A;  1M10 B;  2UZY A;  5GS2 B;  3RW7 A;  4ECO A;  4U08 A;  4V2C A;  4H09 A;  2Z7X A;  3C6O B;  4OQT A;  3WPG A;  1KOO A;  4U09 A;  2OMU A;  4R08 A;  3OGM B;  4NKG A;  4CC4 C;  4Z94 G;  4Y61 B;  4M7E C;  1P9A G;  4AY9 X;  4BSS A;  3W3N A;  4L3A A;  4AW4 A;  3G04 C;  1FS2 A;  5AZ5 A;  5GMH A;  3WPI A;  4Z64 C;  3RIZ A;  3SB4 A;  3ZYJ A;  1QYY A;  4HQ1 A;  4FCG A;  1M9S A;  2Z63 A;  4WP6 A;  3BZ5 A;  4CC4 A;  3C6N B;  2JQD A;  1D0B A;  2WQV A;  5IJD A;  1XKU A;  3O6N A;  4Q3I A;  1DCE A;  4Z8G A;  1M9L A;  3KJ4 A;  2WQX A;  1XCD A;  4V2D A;  3ULA A;  4PQ8 A;  1GWB A;  3E6J A;  3UL7 A;  1IO0 A;  4BSU A;  1P8T A;  4I6J B;  2O6R A;  2WFH A;  4P8S A;  5B0N A;  4ARR A;  4BV4 R;  2OMX A;  2Q4G W;  4MQW X;  4Q62 A;  4NZT M;  1P8V A;  4L3F A;  3CVR A;  1H6T A;  5B0T A;  4CP6 A;  4RWT C;  1O6T A;  1W8A A;  4LSA A;  2Z7X B;  1JL5 A; 
#chains in the Genus database with same CATH homology
 2FT3 A;  4FS7 A;  5IYX C;  5D3I A;  3WPD A;  3OGK B;  4LI1 A;  3M18 A;  5AWC A;  2OMZ A;  3E2J A;  4FHO A;  1Z7X W;  2A0Z A;  4R6F A;  3WN4 A;  3E4G A;  4CNM A;  3ZYN A;  4R5C A;  1ZIW A;  5GMG A;  5FTT B;  1DS9 A;  4RCA B;  4J4L A;  5IJB A;  4EZG A;  4WYK A;  5GMF A;  4P91 A;  4R07 A;  3JB9 j;  4FD0 A;  4FMZ A;  3RJ0 A;  3CIY A;  3W3M A;  3G3A A;  3ZYO A;  4LI2 A;  3RGZ A;  3W3K A;  4R5D A;  3ULV A;  2WQW A;  1A4Y A;  2Z62 A;  3RFE A;  3TSR E;  3OJA A;  1DFJ I;  3UL8 A;  3E3Z A;  2R9U A;  2Z65 A;  4YEB B;  2JE0 A;  4PEQ B;  4LSX C;  4LSC A;  5GQR K;  5HDH A;  2OMV A;  1FT8 A;  4M7E A;  3WPC A;  2P1M B;  2Z64 A;  2ID5 A;  4PER A;  4KT1 A;  2WQU A;  1K5G C;  4G8A A;  3W3J A;  4BSR A;  4ECN A;  3RFS A;  1M0Z A;  4PKI G;  2AST B;  2O6S A;  4QC0 A;  4XSQ A;  4R0A A;  3UN9 A;  3G39 A;  3M19 A;  4R58 A;  3ZYI A;  1OZN A;  1YRG A;  3REZ A;  1KOH A;  1XEC A;  3GOZ A;  1XWD C;  2P1O B;  4Q3G A;  1H6U A;  2V9T B;  1FQV A;  3UL9 A;  2V70 A;  3WPH A;  3RFJ A;  1FO1 A;  1G9U A;  4FDW A;  3FXI A;  1U0N D;  4R6A A;  4B8C D;  4GT6 A;  3C6P B;  4MN8 B;  4GLP A;  4PSJ A;  2RA8 A;  4NKH A;  2P1P B;  5AWA A;  2XWT C;  1OTM A;  3RGX A;  2Z81 A;  3RW6 A;  3PMH G;  4CNC A;  2UZX A;  2O6Q A;  4UFR A;  4V2E A;  3G06 A;  4C2A B;  5LFN A;  4XGO A;  1O6V A;  3A79 B;  3WPE A;  3ULU A;  3OJA B;  4LXS A;  5AWB A;  2ASS B;  4R6G A;  1K5D C;  3O53 A;  2OMT A;  1OGQ A;  5HZL B;  5CMP A;  1PGV A;  2V9S A;  4R6J A;  3VQ1 A;  1OTO A;  2P1N B;  2JE1 A;  2BNH A;  4TZH A;  1O6S A;  2IFG A;  4LXR A;  3DZE A;  5AWD A;  4C2B B;  4U06 A;  4RCW A;  4XOS A;  1OOK G;  4CIL A;  3P72 A;  1A9N A;  2OMY A;  2P1Q B;  4KNG A;  3WPF A;  4QXE A;  3WPB A;  2OMW A;  2Z82 A;  4R09 A;  2CA6 A;  3W3G A;  2RR6 A;  3G3B A;  2Y5Q A;  1SQ0 B;  4LSX A;  3CIG A;  5GS0 A;  4J0M A;  1LTX A;  1WWL A;  1OTN A;  4Z79 A;  2ELL A;  3W3L A;  2BEX A;  5A5C A;  4K17 A;  3OGL B;  4Z61 C;  4KXF B;  4IM6 A;  2Z66 A;  5IJC A;  4ARN A;  2XOT A;  4QBZ A;  5B4P A;  4U7L A;  3VQ2 A;  5CMN A;  1XEU A;  1M10 B;  2UZY A;  5GS2 B;  3RW7 A;  4ECO A;  4U08 A;  4V2C A;  4H09 A;  2Z7X A;  3C6O B;  4OQT A;  3WPG A;  1KOO A;  4U09 A;  2OMU A;  4R08 A;  3OGM B;  4NKG A;  4CC4 C;  4Z94 G;  4Y61 B;  4M7E C;  1P9A G;  4AY9 X;  4BSS A;  3W3N A;  4L3A A;  4AW4 A;  3G04 C;  1FS2 A;  5AZ5 A;  5GMH A;  3WPI A;  4Z64 C;  3RIZ A;  3SB4 A;  3ZYJ A;  1QYY A;  4HQ1 A;  4FCG A;  1M9S A;  2Z63 A;  4WP6 A;  3BZ5 A;  4CC4 A;  3C6N B;  2JQD A;  1D0B A;  2WQV A;  5IJD A;  1XKU A;  3O6N A;  4Q3I A;  1DCE A;  4Z8G A;  1M9L A;  3KJ4 A;  2WQX A;  1XCD A;  4V2D A;  3ULA A;  4PQ8 A;  1GWB A;  3E6J A;  3UL7 A;  1IO0 A;  4BSU A;  1P8T A;  4I6J B;  2O6R A;  2WFH A;  4P8S A;  5B0N A;  4ARR A;  4BV4 R;  2OMX A;  2Q4G W;  4MQW X;  4Q62 A;  1P8V A;  4L3F A;  3CVR A;  1H6T A;  5B0T A;  4CP6 A;  4RWT C;  1O6T A;  1W8A A;  4LSA A;  2Z7X B;  1JL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...