4R6FA

Crystal structure of computational designed protein dlrr_i
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
329
structure length
329
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNNIANINDQMLEGLTNLTTLNLSHNNLARLWKHANPGGPIYFLKGLTNLTTLNLSSNGFDEIPREVFKDLTSLTTLNLSNNNIANINDQMLEGLTNLTTLNLSHNNLARLWKHANPGGPIYFLKGLTNLTTLNLSSNGFDEIPREVFKDLTSLTTLNLSNNQLTSLPQGVFERLTNLKTLNLSNNQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine rich repeat DLRR_I
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 117
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 2014-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r6fA00
3CIYA 4GT6A 1KOHA 1DFJI 3P72A 5D3IA 4V2DA 3G3BA 5CMNA 1O6TA 2OMWA 4BSRA 3RW7A 2Z66A 4B8CD 3KJ4A 4OQTA 4BSSA 4LSAA 5GMHA 5IJDA 1P8VA 1XECA 4PEQB 2XWTC 2WQUA 4LXRA 4KT1A 4PSJA 3WPEA 5A5CA 1WWLA 2FT3A 4LI2A 4H09A 2Z82A 1K5GC 3OGMB 5GMFA 1U0ND 5HZLB 4FHOA 5B0TA 3RGXA 3RIZA 1M10B 1KOOA 3UN9A 1XKUA 5IYXC 1QYYA 4R5DA 3OGLB 4C2AB 4U09A 4AY9X 1M9LA 4J4LA 3TSRE 2Z7XB 2Z81A 4MQWX 4V2EA 2BNHA 3M19A 1OZNA 4FS7A 3ZYIA 4L3AA 3W3MA 4ECOA 4ECNA 4EZGA 3M18A 3VQ2A 3W3LA 1H6UA 5AZ5A 1XCDA 3G39A 2OMUA 1OGQA 2ELLA 2P1MB 4NKHA 3E3ZA 3DZEA 4IM6A 2Z64A 2P1NB 5GQRK 2P1OB 4LSXA 2Q4GW 4BV4R 5IJBA 4Z94G 5LFNA 1GWBA 4Y61B 3RFEA 4NKGA 2JE0A 2WFHA 3O53A 4KNGA 3W3KA 4UFRA 4R6AA 1Z7XW 4LSXC 4KXFB 1IO0A 1YRGA 3CVRA 3WN4A 3G06A 5HDHA 1FT8A 3OJAA 4XGOA 2Z65A 3A79B 4LXSA 4BSUA 3ZYNA 1OTMA 2P1QB 4XSQA 2O6RA 3E6JA 3UL8A 2P1PB 3RFJA 4HQ1A 3E4GA 4U06A 2Y5QA 3RJ0A 3PMHG 4RCAB 5IJCA 1A9NA 4I6JB 1DS9A 4Q3GA 3GOZA 1D0BA 1H6TA 2OMTA 2V70A 4R5CA 4CC4A 4YEBB 3W3NA 3UL9A 2OMYA 1OOKG 3JB9j 4J0MA 5GMGA 1O6VA 3G3AA 4GLPA 2OMZA 3FXIA 4K17A 4P91A 4ARNA 2ASTB 1M0ZA 4R0AA 4CP6A 4Q62A 1DCEA 4R6GA 4ARRA 3WPCA 4Z61C 3OJAB 1P8TA 2ID5A 3C6OB 4R08A 2BEXA 1XEUA 2UZXA 1FS2A 5B4PA 4FDWA 2A0ZA 3UL7A 4QC0A 5B0NA 2R9UA 5AWDA 4R6FA 1XWDC 3OGKB 4LI1A 3C6PB 2Z62A 3SB4A 4RCWA 3WPFA 3WPGA 3WPIA 3WPBA 1LTXA 4FMZA 1A4YA 4M7EA 4U7LA 3G04C 4R58A 3RGZA 3WPHA 1W8AA 1G9UA 4MN8B 2O6SA 3REZA 1P9AG 3W3GA 4Z8GA 3RFSA 5CMPA 4P8SA 4L3FA 4Q3IA 4AW4A 4M7EC 4QBZA 4WYKA 4TZHA 3E2JA 4CNMA 4PQ8A 5AWBA 4CILA 1M9SA 2RA8A 2JE1A 2WQWA 4RWTC 3VQ1A 4R6JA 1SQ0B 4Z79A 1K5DC 4CNCA 2OMXA 4FD0A 4V2CA 1OTOA 4XOSA 5GS0A 3CIGA 5GS2B 4U08A 3ZYOA 5AWCA 4CC4C 3WPDA 3ZYJA 1ZIWA 4WP6A 2V9TB 4G8AA 2O6QA 4C2BB 2V9SA 2IFGA 4R07A 4Z64C 2JQDA 2WQVA 5FTTB 3ULAA 2UZYA 3BZ5A 4QXEA 3O6NA 1FO1A 2Z63A 1FQVA 3RW6A 4PKIG 4R09A 1JL5A 1PGVA 2RR6A 2ASSB 4FCGA 4LSCA 3W3JA 2XOTA 3ULUA 4PERA 3ULVA 1O6SA 2WQXA 5AWAA 1OTNA 3C6NB 2Z7XA 2CA6A 2OMVA
chains in the Genus database with same CATH superfamily
3CIYA 4GT6A 1KOHA 1DFJI 3P72A 5D3IA 4V2DA 3G3BA 5CMNA 1O6TA 2OMWA 4BSRA 3RW7A 2Z66A 4B8CD 3KJ4A 4OQTA 4BSSA 4LSAA 5GMHA 5IJDA 1P8VA 1XECA 4PEQB 2XWTC 2WQUA 4LXRA 4NZRM 4KT1A 4PSJA 3WPEA 5A5CA 1WWLA 2FT3A 4LI2A 4H09A 2Z82A 1K5GC 3OGMB 5GMFA 1U0ND 5HZLB 4FHOA 5B0TA 3RGXA 3RIZA 1M10B 1KOOA 3UN9A 1XKUA 5IYXC 1QYYA 4R5DA 3OGLB 4C2AB 4U09A 4AY9X 1M9LA 4J4LA 3TSRE 2Z7XB 2Z81A 4MQWX 4V2EA 2BNHA 3M19A 1OZNA 4FS7A 3ZYIA 4L3AA 3W3MA 4ECOA 4ECNA 4EZGA 3M18A 3VQ2A 3W3LA 1H6UA 5AZ5A 1XCDA 3G39A 2OMUA 1OGQA 2ELLA 2P1MB 4NKHA 3E3ZA 3DZEA 4IM6A 2Z64A 2P1NB 5GQRK 2P1OB 4LSXA 2Q4GW 4BV4R 5IJBA 4Z94G 5LFNA 1GWBA 4Y61B 3RFEA 4NKGA 2JE0A 2WFHA 3O53A 4KNGA 3W3KA 4UFRA 4R6AA 1Z7XW 4LSXC 4KXFB 1IO0A 1YRGA 3CVRA 3WN4A 3G06A 5HDHA 1FT8A 3OJAA 4XGOA 2Z65A 3A79B 4LXSA 4BSUA 3ZYNA 1OTMA 2P1QB 4XSQA 2O6RA 3E6JA 3UL8A 2P1PB 3RFJA 4HQ1A 3E4GA 4U06A 2Y5QA 3RJ0A 3PMHG 4RCAB 5IJCA 1A9NA 4I6JB 1DS9A 4Q3GA 3GOZA 1D0BA 1H6TA 2OMTA 2V70A 4R5CA 4CC4A 4YEBB 3W3NA 3UL9A 2OMYA 1OOKG 3JB9j 4J0MA 5GMGA 1O6VA 3G3AA 4GLPA 2OMZA 3FXIA 4K17A 4P91A 4ARNA 2ASTB 1M0ZA 4R0AA 4CP6A 4Q62A 1DCEA 4R6GA 4ARRA 3WPCA 4Z61C 3OJAB 1P8TA 2ID5A 3C6OB 4R08A 2BEXA 1XEUA 2UZXA 1FS2A 5B4PA 4FDWA 2A0ZA 3UL7A 4QC0A 5B0NA 2R9UA 5AWDA 4R6FA 1XWDC 3OGKB 4LI1A 3C6PB 2Z62A 3SB4A 4RCWA 3WPFA 3WPGA 3WPIA 3WPBA 1LTXA 4FMZA 1A4YA 4M7EA 4U7LA 3G04C 4R58A 3RGZA 3WPHA 1W8AA 1G9UA 4MN8B 2O6SA 3REZA 1P9AG 3W3GA 4Z8GA 3RFSA 5CMPA 4P8SA 4L3FA 4Q3IA 4AW4A 4M7EC 4QBZA 4WYKA 4TZHA 3E2JA 4CNMA 4PQ8A 5AWBA 4CILA 1M9SA 2RA8A 2JE1A 2WQWA 4RWTC 3VQ1A 4R6JA 1SQ0B 4Z79A 1K5DC 4CNCA 2OMXA 4FD0A 4V2CA 1OTOA 4XOSA 5GS0A 3CIGA 5GS2B 4U08A 3ZYOA 5AWCA 4CC4C 3WPDA 3ZYJA 1ZIWA 4WP6A 2V9TB 4G8AA 2O6QA 4C2BB 2V9SA 2IFGA 4R07A 4Z64C 2JQDA 2WQVA 5FTTB 3ULAA 2UZYA 3BZ5A 4QXEA 3O6NA 1FO1A 2Z63A 1FQVA 3RW6A 4PKIG 4R09A 1JL5A 1PGVA 2RR6A 2ASSB 4FCGA 4LSCA 3W3JA 4NZTM 2XOTA 3ULUA 4PERA 3ULVA 1O6SA 2WQXA 5AWAA 1OTNA 3C6NB 2Z7XA 2CA6A 2OMVA
chains in the Genus database with same CATH topology
3CIYA 4GT6A 1KOHA 1DFJI 3P72A 5D3IA 4V2DA 3G3BA 5CMNA 1O6TA 2OMWA 4BSRA 3RW7A 2Z66A 4B8CD 3KJ4A 4OQTA 4BSSA 4LSAA 5GMHA 5IJDA 1P8VA 1XECA 4PEQB 2XWTC 2WQUA 4LXRA 4KT1A 4PSJA 3WPEA 5A5CA 1WWLA 2FT3A 4LI2A 4H09A 2Z82A 1K5GC 3OGMB 5GMFA 1U0ND 5HZLB 4FHOA 5B0TA 3RGXA 3RIZA 1M10B 1KOOA 3UN9A 1XKUA 5IYXC 1QYYA 4R5DA 3OGLB 4C2AB 4U09A 4AY9X 1M9LA 4J4LA 3TSRE 2Z7XB 2Z81A 4MQWX 4V2EA 2BNHA 3M19A 1OZNA 4FS7A 3ZYIA 4L3AA 3W3MA 4ECOA 4ECNA 4EZGA 3M18A 3VQ2A 3W3LA 1H6UA 5AZ5A 1XCDA 3G39A 2OMUA 1OGQA 2ELLA 2P1MB 4NKHA 3E3ZA 3DZEA 4IM6A 2Z64A 2P1NB 5GQRK 2P1OB 4LSXA 2Q4GW 4BV4R 5IJBA 4Z94G 5LFNA 1GWBA 4Y61B 3RFEA 4NKGA 2JE0A 2WFHA 3O53A 4KNGA 3W3KA 4UFRA 4R6AA 1Z7XW 4LSXC 4KXFB 1IO0A 1YRGA 3CVRA 3WN4A 3G06A 5HDHA 1FT8A 3OJAA 4XGOA 2Z65A 3A79B 4LXSA 4BSUA 3ZYNA 1OTMA 2P1QB 4XSQA 2O6RA 3E6JA 3UL8A 2P1PB 3RFJA 4HQ1A 3E4GA 4U06A 2Y5QA 3RJ0A 3PMHG 4RCAB 5IJCA 1A9NA 4I6JB 1DS9A 4Q3GA 3GOZA 1D0BA 1H6TA 2OMTA 2V70A 4R5CA 4CC4A 4YEBB 3W3NA 3UL9A 2OMYA 1OOKG 3JB9j 4J0MA 5GMGA 1O6VA 3G3AA 4GLPA 2OMZA 3FXIA 4K17A 4P91A 4ARNA 2ASTB 1M0ZA 4R0AA 4CP6A 4Q62A 1DCEA 4R6GA 4ARRA 3WPCA 4Z61C 3OJAB 1P8TA 2ID5A 3C6OB 4R08A 2BEXA 1XEUA 2UZXA 1FS2A 5B4PA 4FDWA 2A0ZA 3UL7A 4QC0A 5B0NA 2R9UA 5AWDA 4R6FA 1XWDC 3OGKB 4LI1A 3C6PB 2Z62A 3SB4A 4RCWA 3WPFA 3WPGA 3WPIA 3WPBA 1LTXA 4FMZA 1A4YA 4M7EA 4U7LA 3G04C 4R58A 3RGZA 3WPHA 1W8AA 1G9UA 4MN8B 2O6SA 3REZA 1P9AG 3W3GA 4Z8GA 3RFSA 5CMPA 4P8SA 4L3FA 4Q3IA 4AW4A 4M7EC 4QBZA 4WYKA 4TZHA 3E2JA 4CNMA 4PQ8A 5AWBA 4CILA 1M9SA 2RA8A 2JE1A 2WQWA 4RWTC 3VQ1A 4R6JA 1SQ0B 4Z79A 1K5DC 4CNCA 2OMXA 4FD0A 4V2CA 1OTOA 4XOSA 5GS0A 3CIGA 5GS2B 4U08A 3ZYOA 5AWCA 4CC4C 3WPDA 3ZYJA 1ZIWA 4WP6A 2V9TB 4G8AA 2O6QA 4C2BB 2V9SA 2IFGA 4R07A 4Z64C 2JQDA 2WQVA 5FTTB 3ULAA 2UZYA 3BZ5A 4QXEA 3O6NA 1FO1A 2Z63A 1FQVA 3RW6A 4PKIG 4R09A 1JL5A 1PGVA 2RR6A 2ASSB 4FCGA 4LSCA 3W3JA 2XOTA 3ULUA 4PERA 3ULVA 1O6SA 2WQXA 5AWAA 1OTNA 3C6NB 2Z7XA 2CA6A 2OMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIY A;  4GT6 A;  1KOH A;  1DFJ I;  3P72 A;  5D3I A;  4V2D A;  3G3B A;  5CMN A;  1O6T A;  2OMW A;  4BSR A;  3RW7 A;  2Z66 A;  4B8C D;  3KJ4 A;  4OQT A;  4BSS A;  4LSA A;  5GMH A;  5IJD A;  1P8V A;  1XEC A;  4PEQ B;  2XWT C;  2WQU A;  4LXR A;  4KT1 A;  4PSJ A;  3WPE A;  5A5C A;  1WWL A;  2FT3 A;  4LI2 A;  4H09 A;  2Z82 A;  1K5G C;  3OGM B;  5GMF A;  1U0N D;  5HZL B;  4FHO A;  5B0T A;  3RGX A;  3RIZ A;  1M10 B;  1KOO A;  3UN9 A;  1XKU A;  5IYX C;  1QYY A;  4R5D A;  3OGL B;  4C2A B;  4U09 A;  4AY9 X;  1M9L A;  4J4L A;  3TSR E;  2Z7X B;  2Z81 A;  4MQW X;  4V2E A;  2BNH A;  3M19 A;  1OZN A;  4FS7 A;  3ZYI A;  4L3A A;  3W3M A;  4ECO A;  4ECN A;  4EZG A;  3M18 A;  3VQ2 A;  3W3L A;  1H6U A;  5AZ5 A;  1XCD A;  3G39 A;  2OMU A;  1OGQ A;  2ELL A;  2P1M B;  4NKH A;  3E3Z A;  3DZE A;  4IM6 A;  2Z64 A;  2P1N B;  5GQR K;  2P1O B;  4LSX A;  2Q4G W;  4BV4 R;  5IJB A;  4Z94 G;  5LFN A;  1GWB A;  4Y61 B;  3RFE A;  4NKG A;  2JE0 A;  2WFH A;  3O53 A;  4KNG A;  3W3K A;  4UFR A;  4R6A A;  1Z7X W;  4LSX C;  4KXF B;  1IO0 A;  1YRG A;  3CVR A;  3WN4 A;  3G06 A;  5HDH A;  1FT8 A;  3OJA A;  4XGO A;  2Z65 A;  3A79 B;  4LXS A;  4BSU A;  3ZYN A;  1OTM A;  2P1Q B;  4XSQ A;  2O6R A;  3E6J A;  3UL8 A;  2P1P B;  3RFJ A;  4HQ1 A;  3E4G A;  4U06 A;  2Y5Q A;  3RJ0 A;  3PMH G;  4RCA B;  5IJC A;  1A9N A;  4I6J B;  1DS9 A;  4Q3G A;  3GOZ A;  1D0B A;  1H6T A;  2OMT A;  2V70 A;  4R5C A;  4CC4 A;  4YEB B;  3W3N A;  3UL9 A;  2OMY A;  1OOK G;  3JB9 j;  4J0M A;  5GMG A;  1O6V A;  3G3A A;  4GLP A;  2OMZ A;  3FXI A;  4K17 A;  4P91 A;  4ARN A;  2AST B;  1M0Z A;  4R0A A;  4CP6 A;  4Q62 A;  1DCE A;  4R6G A;  4ARR A;  3WPC A;  4Z61 C;  3OJA B;  1P8T A;  2ID5 A;  3C6O B;  4R08 A;  2BEX A;  1XEU A;  2UZX A;  1FS2 A;  5B4P A;  4FDW A;  2A0Z A;  3UL7 A;  4QC0 A;  5B0N A;  2R9U A;  5AWD A;  4R6F A;  1XWD C;  3OGK B;  4LI1 A;  3C6P B;  2Z62 A;  3SB4 A;  4RCW A;  3WPF A;  3WPG A;  3WPI A;  3WPB A;  1LTX A;  4FMZ A;  1A4Y A;  4M7E A;  4U7L A;  3G04 C;  4R58 A;  3RGZ A;  3WPH A;  1W8A A;  1G9U A;  4MN8 B;  2O6S A;  3REZ A;  1P9A G;  3W3G A;  4Z8G A;  3RFS A;  5CMP A;  4P8S A;  4L3F A;  4Q3I A;  4AW4 A;  4M7E C;  4QBZ A;  4WYK A;  4TZH A;  3E2J A;  4CNM A;  4PQ8 A;  5AWB A;  4CIL A;  1M9S A;  2RA8 A;  2JE1 A;  2WQW A;  4RWT C;  3VQ1 A;  4R6J A;  1SQ0 B;  4Z79 A;  1K5D C;  4CNC A;  2OMX A;  4FD0 A;  4V2C A;  1OTO A;  4XOS A;  5GS0 A;  3CIG A;  5GS2 B;  4U08 A;  3ZYO A;  5AWC A;  4CC4 C;  3WPD A;  3ZYJ A;  1ZIW A;  4WP6 A;  2V9T B;  4G8A A;  2O6Q A;  4C2B B;  2V9S A;  2IFG A;  4R07 A;  4Z64 C;  2JQD A;  2WQV A;  5FTT B;  3ULA A;  2UZY A;  3BZ5 A;  4QXE A;  3O6N A;  1FO1 A;  2Z63 A;  1FQV A;  3RW6 A;  4PKI G;  4R09 A;  1JL5 A;  1PGV A;  2RR6 A;  2ASS B;  4FCG A;  4LSC A;  3W3J A;  2XOT A;  3ULU A;  4PER A;  3ULV A;  1O6S A;  2WQX A;  5AWA A;  1OTN A;  3C6N B;  2Z7X A;  2CA6 A;  2OMV A; 
#chains in the Genus database with same CATH topology
 3CIY A;  4GT6 A;  1KOH A;  1DFJ I;  3P72 A;  5D3I A;  4V2D A;  3G3B A;  5CMN A;  1O6T A;  2OMW A;  4BSR A;  3RW7 A;  2Z66 A;  4B8C D;  3KJ4 A;  4OQT A;  4BSS A;  4LSA A;  5GMH A;  5IJD A;  1P8V A;  1XEC A;  4PEQ B;  2XWT C;  2WQU A;  4LXR A;  4NZR M;  4KT1 A;  4PSJ A;  3WPE A;  5A5C A;  1WWL A;  2FT3 A;  4LI2 A;  4H09 A;  2Z82 A;  1K5G C;  3OGM B;  5GMF A;  1U0N D;  5HZL B;  4FHO A;  5B0T A;  3RGX A;  3RIZ A;  1M10 B;  1KOO A;  3UN9 A;  1XKU A;  5IYX C;  1QYY A;  4R5D A;  3OGL B;  4C2A B;  4U09 A;  4AY9 X;  1M9L A;  4J4L A;  3TSR E;  2Z7X B;  2Z81 A;  4MQW X;  4V2E A;  2BNH A;  3M19 A;  1OZN A;  4FS7 A;  3ZYI A;  4L3A A;  3W3M A;  4ECO A;  4ECN A;  4EZG A;  3M18 A;  3VQ2 A;  3W3L A;  1H6U A;  5AZ5 A;  1XCD A;  3G39 A;  2OMU A;  1OGQ A;  2ELL A;  2P1M B;  4NKH A;  3E3Z A;  3DZE A;  4IM6 A;  2Z64 A;  2P1N B;  5GQR K;  2P1O B;  4LSX A;  2Q4G W;  4BV4 R;  5IJB A;  4Z94 G;  5LFN A;  1GWB A;  4Y61 B;  3RFE A;  4NKG A;  2JE0 A;  2WFH A;  3O53 A;  4KNG A;  3W3K A;  4UFR A;  4R6A A;  1Z7X W;  4LSX C;  4KXF B;  1IO0 A;  1YRG A;  3CVR A;  3WN4 A;  3G06 A;  5HDH A;  1FT8 A;  3OJA A;  4XGO A;  2Z65 A;  3A79 B;  4LXS A;  4BSU A;  3ZYN A;  1OTM A;  2P1Q B;  4XSQ A;  2O6R A;  3E6J A;  3UL8 A;  2P1P B;  3RFJ A;  4HQ1 A;  3E4G A;  4U06 A;  2Y5Q A;  3RJ0 A;  3PMH G;  4RCA B;  5IJC A;  1A9N A;  4I6J B;  1DS9 A;  4Q3G A;  3GOZ A;  1D0B A;  1H6T A;  2OMT A;  2V70 A;  4R5C A;  4CC4 A;  4YEB B;  3W3N A;  3UL9 A;  2OMY A;  1OOK G;  3JB9 j;  4J0M A;  5GMG A;  1O6V A;  3G3A A;  4GLP A;  2OMZ A;  3FXI A;  4K17 A;  4P91 A;  4ARN A;  2AST B;  1M0Z A;  4R0A A;  4CP6 A;  4Q62 A;  1DCE A;  4R6G A;  4ARR A;  3WPC A;  4Z61 C;  3OJA B;  1P8T A;  2ID5 A;  3C6O B;  4R08 A;  2BEX A;  1XEU A;  2UZX A;  1FS2 A;  5B4P A;  4FDW A;  2A0Z A;  3UL7 A;  4QC0 A;  5B0N A;  2R9U A;  5AWD A;  4R6F A;  1XWD C;  3OGK B;  4LI1 A;  3C6P B;  2Z62 A;  3SB4 A;  4RCW A;  3WPF A;  3WPG A;  3WPI A;  3WPB A;  1LTX A;  4FMZ A;  1A4Y A;  4M7E A;  4U7L A;  3G04 C;  4R58 A;  3RGZ A;  3WPH A;  1W8A A;  1G9U A;  4MN8 B;  2O6S A;  3REZ A;  1P9A G;  3W3G A;  4Z8G A;  3RFS A;  5CMP A;  4P8S A;  4L3F A;  4Q3I A;  4AW4 A;  4M7E C;  4QBZ A;  4WYK A;  4TZH A;  3E2J A;  4CNM A;  4PQ8 A;  5AWB A;  4CIL A;  1M9S A;  2RA8 A;  2JE1 A;  2WQW A;  4RWT C;  3VQ1 A;  4R6J A;  1SQ0 B;  4Z79 A;  1K5D C;  4CNC A;  2OMX A;  4FD0 A;  4V2C A;  1OTO A;  4XOS A;  5GS0 A;  3CIG A;  5GS2 B;  4U08 A;  3ZYO A;  5AWC A;  4CC4 C;  3WPD A;  3ZYJ A;  1ZIW A;  4WP6 A;  2V9T B;  4G8A A;  2O6Q A;  4C2B B;  2V9S A;  2IFG A;  4R07 A;  4Z64 C;  2JQD A;  2WQV A;  5FTT B;  3ULA A;  2UZY A;  3BZ5 A;  4QXE A;  3O6N A;  1FO1 A;  2Z63 A;  1FQV A;  3RW6 A;  4PKI G;  4R09 A;  1JL5 A;  1PGV A;  2RR6 A;  2ASS B;  4FCG A;  4LSC A;  3W3J A;  4NZT M;  2XOT A;  3ULU A;  4PER A;  3ULV A;  1O6S A;  2WQX A;  5AWA A;  1OTN A;  3C6N B;  2Z7X A;  2CA6 A;  2OMV A; 
#chains in the Genus database with same CATH homology
 3CIY A;  4GT6 A;  1KOH A;  1DFJ I;  3P72 A;  5D3I A;  4V2D A;  3G3B A;  5CMN A;  1O6T A;  2OMW A;  4BSR A;  3RW7 A;  2Z66 A;  4B8C D;  3KJ4 A;  4OQT A;  4BSS A;  4LSA A;  5GMH A;  5IJD A;  1P8V A;  1XEC A;  4PEQ B;  2XWT C;  2WQU A;  4LXR A;  4KT1 A;  4PSJ A;  3WPE A;  5A5C A;  1WWL A;  2FT3 A;  4LI2 A;  4H09 A;  2Z82 A;  1K5G C;  3OGM B;  5GMF A;  1U0N D;  5HZL B;  4FHO A;  5B0T A;  3RGX A;  3RIZ A;  1M10 B;  1KOO A;  3UN9 A;  1XKU A;  5IYX C;  1QYY A;  4R5D A;  3OGL B;  4C2A B;  4U09 A;  4AY9 X;  1M9L A;  4J4L A;  3TSR E;  2Z7X B;  2Z81 A;  4MQW X;  4V2E A;  2BNH A;  3M19 A;  1OZN A;  4FS7 A;  3ZYI A;  4L3A A;  3W3M A;  4ECO A;  4ECN A;  4EZG A;  3M18 A;  3VQ2 A;  3W3L A;  1H6U A;  5AZ5 A;  1XCD A;  3G39 A;  2OMU A;  1OGQ A;  2ELL A;  2P1M B;  4NKH A;  3E3Z A;  3DZE A;  4IM6 A;  2Z64 A;  2P1N B;  5GQR K;  2P1O B;  4LSX A;  2Q4G W;  4BV4 R;  5IJB A;  4Z94 G;  5LFN A;  1GWB A;  4Y61 B;  3RFE A;  4NKG A;  2JE0 A;  2WFH A;  3O53 A;  4KNG A;  3W3K A;  4UFR A;  4R6A A;  1Z7X W;  4LSX C;  4KXF B;  1IO0 A;  1YRG A;  3CVR A;  3WN4 A;  3G06 A;  5HDH A;  1FT8 A;  3OJA A;  4XGO A;  2Z65 A;  3A79 B;  4LXS A;  4BSU A;  3ZYN A;  1OTM A;  2P1Q B;  4XSQ A;  2O6R A;  3E6J A;  3UL8 A;  2P1P B;  3RFJ A;  4HQ1 A;  3E4G A;  4U06 A;  2Y5Q A;  3RJ0 A;  3PMH G;  4RCA B;  5IJC A;  1A9N A;  4I6J B;  1DS9 A;  4Q3G A;  3GOZ A;  1D0B A;  1H6T A;  2OMT A;  2V70 A;  4R5C A;  4CC4 A;  4YEB B;  3W3N A;  3UL9 A;  2OMY A;  1OOK G;  3JB9 j;  4J0M A;  5GMG A;  1O6V A;  3G3A A;  4GLP A;  2OMZ A;  3FXI A;  4K17 A;  4P91 A;  4ARN A;  2AST B;  1M0Z A;  4R0A A;  4CP6 A;  4Q62 A;  1DCE A;  4R6G A;  4ARR A;  3WPC A;  4Z61 C;  3OJA B;  1P8T A;  2ID5 A;  3C6O B;  4R08 A;  2BEX A;  1XEU A;  2UZX A;  1FS2 A;  5B4P A;  4FDW A;  2A0Z A;  3UL7 A;  4QC0 A;  5B0N A;  2R9U A;  5AWD A;  4R6F A;  1XWD C;  3OGK B;  4LI1 A;  3C6P B;  2Z62 A;  3SB4 A;  4RCW A;  3WPF A;  3WPG A;  3WPI A;  3WPB A;  1LTX A;  4FMZ A;  1A4Y A;  4M7E A;  4U7L A;  3G04 C;  4R58 A;  3RGZ A;  3WPH A;  1W8A A;  1G9U A;  4MN8 B;  2O6S A;  3REZ A;  1P9A G;  3W3G A;  4Z8G A;  3RFS A;  5CMP A;  4P8S A;  4L3F A;  4Q3I A;  4AW4 A;  4M7E C;  4QBZ A;  4WYK A;  4TZH A;  3E2J A;  4CNM A;  4PQ8 A;  5AWB A;  4CIL A;  1M9S A;  2RA8 A;  2JE1 A;  2WQW A;  4RWT C;  3VQ1 A;  4R6J A;  1SQ0 B;  4Z79 A;  1K5D C;  4CNC A;  2OMX A;  4FD0 A;  4V2C A;  1OTO A;  4XOS A;  5GS0 A;  3CIG A;  5GS2 B;  4U08 A;  3ZYO A;  5AWC A;  4CC4 C;  3WPD A;  3ZYJ A;  1ZIW A;  4WP6 A;  2V9T B;  4G8A A;  2O6Q A;  4C2B B;  2V9S A;  2IFG A;  4R07 A;  4Z64 C;  2JQD A;  2WQV A;  5FTT B;  3ULA A;  2UZY A;  3BZ5 A;  4QXE A;  3O6N A;  1FO1 A;  2Z63 A;  1FQV A;  3RW6 A;  4PKI G;  4R09 A;  1JL5 A;  1PGV A;  2RR6 A;  2ASS B;  4FCG A;  4LSC A;  3W3J A;  2XOT A;  3ULU A;  4PER A;  3ULV A;  1O6S A;  2WQX A;  5AWA A;  1OTN A;  3C6N B;  2Z7X A;  2CA6 A;  2OMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...