2V9SA

Second lrr domain of human slit2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
206
Chain Sequence
HCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SLIT HOMOLOG 2 PROTEIN N-PRODUCT
publication title Structural Insights Into the Slit-Robo Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 67
structure length 206
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF01463 LRRCT Leucine rich repeat C-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2v9sA00
2JQDA 4BV4R 2V70A 1IO0A 1OTNA 4FCGA 4G8AA 4MQWX 4FHOA 3TSRE 3WN4A 3UL7A 3C6PB 5B4PA 1FT8A 4U09A 4PERA 4WP6A 3RW6A 2ELLA 3WPDA 4GLPA 3ZYOA 3OJAB 4RWTC 2IFGA 4Z64C 3WPEA 3KJ4A 4IM6A 3G04C 5GMHA 1DS9A 4ECOA 1M9LA 3OGMB 3CIYA 4C2AB 4Y61B 5AWAA 2JE0A 1ZIWA 2XWTC 1XWDC 3FXIA 1H6TA 4R6AA 4GT6A 5AWDA 3RIZA 5AWCA 2Z7XA 1OZNA 1LTXA 2O6SA 4LSCA 4LXRA 4AY9X 3W3LA 2RR6A 4Q3IA 1Z7XW 3M19A 4LSXA 1PGVA 2P1NB 4U06A 3M18A 4PEQB 3W3KA 2V9SA 4FS7A 4R0AA 3G06A 3GOZA 3W3JA 4Z79A 4EZGA 4J0MA 5A5CA 4KXFB 3VQ2A 3C6OB 4U7LA 4R6GA 4LSXC 2Z66A 3VQ1A 4V2EA 4M7EC 2OMWA 1FQVA 4R07A 3OGLB 2Z81A 5IJDA 4QBZA 1U0ND 4PKIG 1YRGA 1M9SA 1OTMA 2P1PB 3G3BA 3OJAA 4V2DA 1G9UA 4CNMA 2P1QB 3DZEA 4CILA 4C2BB 5HDHA 1DFJI 3O53A 4CC4A 4Q3GA 4NKHA 2WQWA 5B0NA 4RCAB 4RCWA 1P8VA 1M10B 4P8SA 4L3FA 1OGQA 5IJBA 3RGZA 2P1OB 4BSUA 4Q62A 3ULAA 2OMZA 4V2CA 5GQRK 3UL8A 4LI2A 3E4GA 1K5GC 3OGKB 5CMPA 4CC4C 4QC0A 4Z8GA 4ARRA 4L3AA 2XOTA 4WYKA 3WPBA 4KT1A 3SB4A 2Z62A 3C6NB 2OMTA 2UZYA 2ASSB 2Z64A 4R58A 3E6JA 2A0ZA 1XKUA 2OMVA 3RFSA 4FD0A 4J4LA 1K5DC 1H6UA 2WQVA 2V9TB 4H09A 1JL5A 1SQ0B 3UL9A 4UFRA 5GMGA 5GS2B 2ASTB 3ZYIA 2WQXA 3ULVA 5HZLB 3G3AA 4K17A 1QYYA 3UN9A 2ID5A 2JE1A 1XEUA 4Z94G 5GS0A 3ZYJA 3WPIA 2UZXA 3E2JA 2OMYA 3WPCA 4P91A 4LXSA 1O6TA 3RW7A 4BSSA 5CMNA 4R6JA 1D0BA 2OMUA 3E3ZA 4FMZA 3WPGA 2R9UA 1KOHA 2OMXA 4FDWA 3RFEA 3W3NA 4XSQA 1O6VA 1M0ZA 1OTOA 2Z82A 4AW4A 4R5DA 1A4YA 4PQ8A 3CVRA 5B0TA 2BEXA 4R09A 3W3GA 4XGOA 3A79B 4R08A 2Q4GW 3O6NA 3W3MA 3RFJA 4OQTA 3WPHA 3G39A 1P9AG 2Y5QA 4XOSA 4B8CD 1XECA 3REZA 1P8TA 1A9NA 2RA8A 3PMHG 4HQ1A 4BSRA 5AWBA 4R6FA 1XCDA 4CNCA 5FTTB 3ZYNA 2WFHA 5IJCA 1KOOA 5AZ5A 4I6JB 1GWBA 1DCEA 4LI1A 3WPFA 2BNHA 3JB9j 2Z65A 4QXEA 2Z7XB 4NKGA 4PSJA 2O6RA 1WWLA 3RJ0A 1FO1A 5LFNA 4KNGA 2Z63A 3CIGA 4MN8B 4CP6A 4ECNA 1W8AA 4R5CA 4TZHA 4M7EA 3RGXA 2FT3A 3P72A 4Z61C 2WQUA 4LSAA 4YEBB 2P1MB 4U08A 4ARNA 1FS2A 1O6SA 5IYXC 5D3IA 3BZ5A 5GMFA 1OOKG 2CA6A 2O6QA 3ULUA
chains in the Genus database with same CATH superfamily
2JQDA 4BV4R 2V70A 1IO0A 1OTNA 4FCGA 4G8AA 4MQWX 4FHOA 3TSRE 3WN4A 3UL7A 3C6PB 5B4PA 1FT8A 4U09A 4PERA 4WP6A 3RW6A 2ELLA 3WPDA 4GLPA 3ZYOA 3OJAB 4RWTC 2IFGA 4Z64C 3WPEA 3KJ4A 4IM6A 3G04C 5GMHA 1DS9A 4ECOA 1M9LA 3OGMB 3CIYA 4C2AB 4Y61B 5AWAA 2JE0A 1ZIWA 2XWTC 4NZTM 1XWDC 3FXIA 1H6TA 4R6AA 4GT6A 5AWDA 3RIZA 5AWCA 2Z7XA 1OZNA 1LTXA 2O6SA 4LSCA 4LXRA 4AY9X 3W3LA 2RR6A 4Q3IA 1Z7XW 3M19A 4LSXA 1PGVA 2P1NB 4U06A 3M18A 4PEQB 3W3KA 2V9SA 4FS7A 4R0AA 3G06A 3GOZA 3W3JA 4Z79A 4EZGA 4J0MA 5A5CA 4KXFB 3VQ2A 3C6OB 4U7LA 4R6GA 4LSXC 2Z66A 3VQ1A 4V2EA 4M7EC 2OMWA 1FQVA 4R07A 3OGLB 2Z81A 5IJDA 4QBZA 1U0ND 4PKIG 1YRGA 1M9SA 1OTMA 2P1PB 3G3BA 3OJAA 4V2DA 1G9UA 4CNMA 2P1QB 3DZEA 4CILA 4C2BB 5HDHA 1DFJI 3O53A 4CC4A 4Q3GA 4NKHA 2WQWA 5B0NA 4RCAB 4RCWA 1P8VA 1M10B 4P8SA 4L3FA 1OGQA 5IJBA 3RGZA 2P1OB 4BSUA 4Q62A 3ULAA 2OMZA 4V2CA 5GQRK 3UL8A 4LI2A 3E4GA 1K5GC 3OGKB 5CMPA 4CC4C 4QC0A 4Z8GA 4ARRA 4L3AA 2XOTA 4WYKA 3WPBA 4KT1A 3SB4A 2Z62A 3C6NB 2OMTA 2UZYA 2ASSB 2Z64A 4R58A 3E6JA 2A0ZA 1XKUA 2OMVA 3RFSA 4FD0A 4J4LA 1K5DC 1H6UA 2WQVA 2V9TB 4H09A 1JL5A 1SQ0B 3UL9A 4UFRA 5GMGA 5GS2B 2ASTB 3ZYIA 2WQXA 3ULVA 5HZLB 3G3AA 4K17A 1QYYA 3UN9A 2ID5A 2JE1A 1XEUA 4Z94G 5GS0A 3ZYJA 3WPIA 2UZXA 3E2JA 2OMYA 3WPCA 4P91A 4LXSA 1O6TA 3RW7A 4BSSA 5CMNA 4R6JA 1D0BA 2OMUA 3E3ZA 4FMZA 3WPGA 2R9UA 1KOHA 2OMXA 4FDWA 3RFEA 3W3NA 4XSQA 1O6VA 1M0ZA 1OTOA 2Z82A 4AW4A 4R5DA 1A4YA 4PQ8A 3CVRA 5B0TA 2BEXA 4R09A 3W3GA 4XGOA 3A79B 4R08A 2Q4GW 3O6NA 3W3MA 3RFJA 4OQTA 3WPHA 3G39A 1P9AG 2Y5QA 4XOSA 4B8CD 1XECA 3REZA 1P8TA 4NZRM 1A9NA 2RA8A 3PMHG 4HQ1A 4BSRA 5AWBA 4R6FA 1XCDA 4CNCA 5FTTB 3ZYNA 2WFHA 5IJCA 1KOOA 5AZ5A 4I6JB 1GWBA 1DCEA 4LI1A 3WPFA 2BNHA 3JB9j 2Z65A 4QXEA 2Z7XB 4NKGA 4PSJA 2O6RA 1WWLA 3RJ0A 1FO1A 5LFNA 4KNGA 2Z63A 3CIGA 4MN8B 4CP6A 4ECNA 1W8AA 4R5CA 4TZHA 4M7EA 3RGXA 2FT3A 3P72A 4Z61C 2WQUA 4LSAA 4YEBB 2P1MB 4U08A 4ARNA 1FS2A 1O6SA 5IYXC 5D3IA 3BZ5A 5GMFA 1OOKG 2CA6A 2O6QA 3ULUA
chains in the Genus database with same CATH topology
2JQDA 4BV4R 2V70A 1IO0A 1OTNA 4FCGA 4G8AA 4MQWX 4FHOA 3TSRE 3WN4A 3UL7A 3C6PB 5B4PA 1FT8A 4U09A 4PERA 4WP6A 3RW6A 2ELLA 3WPDA 4GLPA 3ZYOA 3OJAB 4RWTC 2IFGA 4Z64C 3WPEA 3KJ4A 4IM6A 3G04C 5GMHA 1DS9A 4ECOA 1M9LA 3OGMB 3CIYA 4C2AB 4Y61B 5AWAA 2JE0A 1ZIWA 2XWTC 1XWDC 3FXIA 1H6TA 4R6AA 4GT6A 5AWDA 3RIZA 5AWCA 2Z7XA 1OZNA 1LTXA 2O6SA 4LSCA 4LXRA 4AY9X 3W3LA 2RR6A 4Q3IA 1Z7XW 3M19A 4LSXA 1PGVA 2P1NB 4U06A 3M18A 4PEQB 3W3KA 2V9SA 4FS7A 4R0AA 3G06A 3GOZA 3W3JA 4Z79A 4EZGA 4J0MA 5A5CA 4KXFB 3VQ2A 3C6OB 4U7LA 4R6GA 4LSXC 2Z66A 3VQ1A 4V2EA 4M7EC 2OMWA 1FQVA 4R07A 3OGLB 2Z81A 5IJDA 4QBZA 1U0ND 4PKIG 1YRGA 1M9SA 1OTMA 2P1PB 3G3BA 3OJAA 4V2DA 1G9UA 4CNMA 2P1QB 3DZEA 4CILA 4C2BB 5HDHA 1DFJI 3O53A 4CC4A 4Q3GA 4NKHA 2WQWA 5B0NA 4RCAB 4RCWA 1P8VA 1M10B 4P8SA 4L3FA 1OGQA 5IJBA 3RGZA 2P1OB 4BSUA 4Q62A 3ULAA 2OMZA 4V2CA 5GQRK 3UL8A 4LI2A 3E4GA 1K5GC 3OGKB 5CMPA 4CC4C 4QC0A 4Z8GA 4ARRA 4L3AA 2XOTA 4WYKA 3WPBA 4KT1A 3SB4A 2Z62A 3C6NB 2OMTA 2UZYA 2ASSB 2Z64A 4R58A 3E6JA 2A0ZA 1XKUA 2OMVA 3RFSA 4FD0A 4J4LA 1K5DC 1H6UA 2WQVA 2V9TB 4H09A 1JL5A 1SQ0B 3UL9A 4UFRA 5GMGA 5GS2B 2ASTB 3ZYIA 2WQXA 3ULVA 5HZLB 3G3AA 4K17A 1QYYA 3UN9A 2ID5A 2JE1A 1XEUA 4Z94G 5GS0A 3ZYJA 3WPIA 2UZXA 3E2JA 2OMYA 3WPCA 4P91A 4LXSA 1O6TA 3RW7A 4BSSA 5CMNA 4R6JA 1D0BA 2OMUA 3E3ZA 4FMZA 3WPGA 2R9UA 1KOHA 2OMXA 4FDWA 3RFEA 3W3NA 4XSQA 1O6VA 1M0ZA 1OTOA 2Z82A 4AW4A 4R5DA 1A4YA 4PQ8A 3CVRA 5B0TA 2BEXA 4R09A 3W3GA 4XGOA 3A79B 4R08A 2Q4GW 3O6NA 3W3MA 3RFJA 4OQTA 3WPHA 3G39A 1P9AG 2Y5QA 4XOSA 4B8CD 1XECA 3REZA 1P8TA 1A9NA 2RA8A 3PMHG 4HQ1A 4BSRA 5AWBA 4R6FA 1XCDA 4CNCA 5FTTB 3ZYNA 2WFHA 5IJCA 1KOOA 5AZ5A 4I6JB 1GWBA 1DCEA 4LI1A 3WPFA 2BNHA 3JB9j 2Z65A 4QXEA 2Z7XB 4NKGA 4PSJA 2O6RA 1WWLA 3RJ0A 1FO1A 5LFNA 4KNGA 2Z63A 3CIGA 4MN8B 4CP6A 4ECNA 1W8AA 4R5CA 4TZHA 4M7EA 3RGXA 2FT3A 3P72A 4Z61C 2WQUA 4LSAA 4YEBB 2P1MB 4U08A 4ARNA 1FS2A 1O6SA 5IYXC 5D3IA 3BZ5A 5GMFA 1OOKG 2CA6A 2O6QA 3ULUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQD A;  4BV4 R;  2V70 A;  1IO0 A;  1OTN A;  4FCG A;  4G8A A;  4MQW X;  4FHO A;  3TSR E;  3WN4 A;  3UL7 A;  3C6P B;  5B4P A;  1FT8 A;  4U09 A;  4PER A;  4WP6 A;  3RW6 A;  2ELL A;  3WPD A;  4GLP A;  3ZYO A;  3OJA B;  4RWT C;  2IFG A;  4Z64 C;  3WPE A;  3KJ4 A;  4IM6 A;  3G04 C;  5GMH A;  1DS9 A;  4ECO A;  1M9L A;  3OGM B;  3CIY A;  4C2A B;  4Y61 B;  5AWA A;  2JE0 A;  1ZIW A;  2XWT C;  1XWD C;  3FXI A;  1H6T A;  4R6A A;  4GT6 A;  5AWD A;  3RIZ A;  5AWC A;  2Z7X A;  1OZN A;  1LTX A;  2O6S A;  4LSC A;  4LXR A;  4AY9 X;  3W3L A;  2RR6 A;  4Q3I A;  1Z7X W;  3M19 A;  4LSX A;  1PGV A;  2P1N B;  4U06 A;  3M18 A;  4PEQ B;  3W3K A;  2V9S A;  4FS7 A;  4R0A A;  3G06 A;  3GOZ A;  3W3J A;  4Z79 A;  4EZG A;  4J0M A;  5A5C A;  4KXF B;  3VQ2 A;  3C6O B;  4U7L A;  4R6G A;  4LSX C;  2Z66 A;  3VQ1 A;  4V2E A;  4M7E C;  2OMW A;  1FQV A;  4R07 A;  3OGL B;  2Z81 A;  5IJD A;  4QBZ A;  1U0N D;  4PKI G;  1YRG A;  1M9S A;  1OTM A;  2P1P B;  3G3B A;  3OJA A;  4V2D A;  1G9U A;  4CNM A;  2P1Q B;  3DZE A;  4CIL A;  4C2B B;  5HDH A;  1DFJ I;  3O53 A;  4CC4 A;  4Q3G A;  4NKH A;  2WQW A;  5B0N A;  4RCA B;  4RCW A;  1P8V A;  1M10 B;  4P8S A;  4L3F A;  1OGQ A;  5IJB A;  3RGZ A;  2P1O B;  4BSU A;  4Q62 A;  3ULA A;  2OMZ A;  4V2C A;  5GQR K;  3UL8 A;  4LI2 A;  3E4G A;  1K5G C;  3OGK B;  5CMP A;  4CC4 C;  4QC0 A;  4Z8G A;  4ARR A;  4L3A A;  2XOT A;  4WYK A;  3WPB A;  4KT1 A;  3SB4 A;  2Z62 A;  3C6N B;  2OMT A;  2UZY A;  2ASS B;  2Z64 A;  4R58 A;  3E6J A;  2A0Z A;  1XKU A;  2OMV A;  3RFS A;  4FD0 A;  4J4L A;  1K5D C;  1H6U A;  2WQV A;  2V9T B;  4H09 A;  1JL5 A;  1SQ0 B;  3UL9 A;  4UFR A;  5GMG A;  5GS2 B;  2AST B;  3ZYI A;  2WQX A;  3ULV A;  5HZL B;  3G3A A;  4K17 A;  1QYY A;  3UN9 A;  2ID5 A;  2JE1 A;  1XEU A;  4Z94 G;  5GS0 A;  3ZYJ A;  3WPI A;  2UZX A;  3E2J A;  2OMY A;  3WPC A;  4P91 A;  4LXS A;  1O6T A;  3RW7 A;  4BSS A;  5CMN A;  4R6J A;  1D0B A;  2OMU A;  3E3Z A;  4FMZ A;  3WPG A;  2R9U A;  1KOH A;  2OMX A;  4FDW A;  3RFE A;  3W3N A;  4XSQ A;  1O6V A;  1M0Z A;  1OTO A;  2Z82 A;  4AW4 A;  4R5D A;  1A4Y A;  4PQ8 A;  3CVR A;  5B0T A;  2BEX A;  4R09 A;  3W3G A;  4XGO A;  3A79 B;  4R08 A;  2Q4G W;  3O6N A;  3W3M A;  3RFJ A;  4OQT A;  3WPH A;  3G39 A;  1P9A G;  2Y5Q A;  4XOS A;  4B8C D;  1XEC A;  3REZ A;  1P8T A;  1A9N A;  2RA8 A;  3PMH G;  4HQ1 A;  4BSR A;  5AWB A;  4R6F A;  1XCD A;  4CNC A;  5FTT B;  3ZYN A;  2WFH A;  5IJC A;  1KOO A;  5AZ5 A;  4I6J B;  1GWB A;  1DCE A;  4LI1 A;  3WPF A;  2BNH A;  3JB9 j;  2Z65 A;  4QXE A;  2Z7X B;  4NKG A;  4PSJ A;  2O6R A;  1WWL A;  3RJ0 A;  1FO1 A;  5LFN A;  4KNG A;  2Z63 A;  3CIG A;  4MN8 B;  4CP6 A;  4ECN A;  1W8A A;  4R5C A;  4TZH A;  4M7E A;  3RGX A;  2FT3 A;  3P72 A;  4Z61 C;  2WQU A;  4LSA A;  4YEB B;  2P1M B;  4U08 A;  4ARN A;  1FS2 A;  1O6S A;  5IYX C;  5D3I A;  3BZ5 A;  5GMF A;  1OOK G;  2CA6 A;  2O6Q A;  3ULU A; 
#chains in the Genus database with same CATH topology
 2JQD A;  4BV4 R;  2V70 A;  1IO0 A;  1OTN A;  4FCG A;  4G8A A;  4MQW X;  4FHO A;  3TSR E;  3WN4 A;  3UL7 A;  3C6P B;  5B4P A;  1FT8 A;  4U09 A;  4PER A;  4WP6 A;  3RW6 A;  2ELL A;  3WPD A;  4GLP A;  3ZYO A;  3OJA B;  4RWT C;  2IFG A;  4Z64 C;  3WPE A;  3KJ4 A;  4IM6 A;  3G04 C;  5GMH A;  1DS9 A;  4ECO A;  1M9L A;  3OGM B;  3CIY A;  4C2A B;  4Y61 B;  5AWA A;  2JE0 A;  1ZIW A;  2XWT C;  4NZT M;  1XWD C;  3FXI A;  1H6T A;  4R6A A;  4GT6 A;  5AWD A;  3RIZ A;  5AWC A;  2Z7X A;  1OZN A;  1LTX A;  2O6S A;  4LSC A;  4LXR A;  4AY9 X;  3W3L A;  2RR6 A;  4Q3I A;  1Z7X W;  3M19 A;  4LSX A;  1PGV A;  2P1N B;  4U06 A;  3M18 A;  4PEQ B;  3W3K A;  2V9S A;  4FS7 A;  4R0A A;  3G06 A;  3GOZ A;  3W3J A;  4Z79 A;  4EZG A;  4J0M A;  5A5C A;  4KXF B;  3VQ2 A;  3C6O B;  4U7L A;  4R6G A;  4LSX C;  2Z66 A;  3VQ1 A;  4V2E A;  4M7E C;  2OMW A;  1FQV A;  4R07 A;  3OGL B;  2Z81 A;  5IJD A;  4QBZ A;  1U0N D;  4PKI G;  1YRG A;  1M9S A;  1OTM A;  2P1P B;  3G3B A;  3OJA A;  4V2D A;  1G9U A;  4CNM A;  2P1Q B;  3DZE A;  4CIL A;  4C2B B;  5HDH A;  1DFJ I;  3O53 A;  4CC4 A;  4Q3G A;  4NKH A;  2WQW A;  5B0N A;  4RCA B;  4RCW A;  1P8V A;  1M10 B;  4P8S A;  4L3F A;  1OGQ A;  5IJB A;  3RGZ A;  2P1O B;  4BSU A;  4Q62 A;  3ULA A;  2OMZ A;  4V2C A;  5GQR K;  3UL8 A;  4LI2 A;  3E4G A;  1K5G C;  3OGK B;  5CMP A;  4CC4 C;  4QC0 A;  4Z8G A;  4ARR A;  4L3A A;  2XOT A;  4WYK A;  3WPB A;  4KT1 A;  3SB4 A;  2Z62 A;  3C6N B;  2OMT A;  2UZY A;  2ASS B;  2Z64 A;  4R58 A;  3E6J A;  2A0Z A;  1XKU A;  2OMV A;  3RFS A;  4FD0 A;  4J4L A;  1K5D C;  1H6U A;  2WQV A;  2V9T B;  4H09 A;  1JL5 A;  1SQ0 B;  3UL9 A;  4UFR A;  5GMG A;  5GS2 B;  2AST B;  3ZYI A;  2WQX A;  3ULV A;  5HZL B;  3G3A A;  4K17 A;  1QYY A;  3UN9 A;  2ID5 A;  2JE1 A;  1XEU A;  4Z94 G;  5GS0 A;  3ZYJ A;  3WPI A;  2UZX A;  3E2J A;  2OMY A;  3WPC A;  4P91 A;  4LXS A;  1O6T A;  3RW7 A;  4BSS A;  5CMN A;  4R6J A;  1D0B A;  2OMU A;  3E3Z A;  4FMZ A;  3WPG A;  2R9U A;  1KOH A;  2OMX A;  4FDW A;  3RFE A;  3W3N A;  4XSQ A;  1O6V A;  1M0Z A;  1OTO A;  2Z82 A;  4AW4 A;  4R5D A;  1A4Y A;  4PQ8 A;  3CVR A;  5B0T A;  2BEX A;  4R09 A;  3W3G A;  4XGO A;  3A79 B;  4R08 A;  2Q4G W;  3O6N A;  3W3M A;  3RFJ A;  4OQT A;  3WPH A;  3G39 A;  1P9A G;  2Y5Q A;  4XOS A;  4B8C D;  1XEC A;  3REZ A;  1P8T A;  4NZR M;  1A9N A;  2RA8 A;  3PMH G;  4HQ1 A;  4BSR A;  5AWB A;  4R6F A;  1XCD A;  4CNC A;  5FTT B;  3ZYN A;  2WFH A;  5IJC A;  1KOO A;  5AZ5 A;  4I6J B;  1GWB A;  1DCE A;  4LI1 A;  3WPF A;  2BNH A;  3JB9 j;  2Z65 A;  4QXE A;  2Z7X B;  4NKG A;  4PSJ A;  2O6R A;  1WWL A;  3RJ0 A;  1FO1 A;  5LFN A;  4KNG A;  2Z63 A;  3CIG A;  4MN8 B;  4CP6 A;  4ECN A;  1W8A A;  4R5C A;  4TZH A;  4M7E A;  3RGX A;  2FT3 A;  3P72 A;  4Z61 C;  2WQU A;  4LSA A;  4YEB B;  2P1M B;  4U08 A;  4ARN A;  1FS2 A;  1O6S A;  5IYX C;  5D3I A;  3BZ5 A;  5GMF A;  1OOK G;  2CA6 A;  2O6Q A;  3ULU A; 
#chains in the Genus database with same CATH homology
 2JQD A;  4BV4 R;  2V70 A;  1IO0 A;  1OTN A;  4FCG A;  4G8A A;  4MQW X;  4FHO A;  3TSR E;  3WN4 A;  3UL7 A;  3C6P B;  5B4P A;  1FT8 A;  4U09 A;  4PER A;  4WP6 A;  3RW6 A;  2ELL A;  3WPD A;  4GLP A;  3ZYO A;  3OJA B;  4RWT C;  2IFG A;  4Z64 C;  3WPE A;  3KJ4 A;  4IM6 A;  3G04 C;  5GMH A;  1DS9 A;  4ECO A;  1M9L A;  3OGM B;  3CIY A;  4C2A B;  4Y61 B;  5AWA A;  2JE0 A;  1ZIW A;  2XWT C;  1XWD C;  3FXI A;  1H6T A;  4R6A A;  4GT6 A;  5AWD A;  3RIZ A;  5AWC A;  2Z7X A;  1OZN A;  1LTX A;  2O6S A;  4LSC A;  4LXR A;  4AY9 X;  3W3L A;  2RR6 A;  4Q3I A;  1Z7X W;  3M19 A;  4LSX A;  1PGV A;  2P1N B;  4U06 A;  3M18 A;  4PEQ B;  3W3K A;  2V9S A;  4FS7 A;  4R0A A;  3G06 A;  3GOZ A;  3W3J A;  4Z79 A;  4EZG A;  4J0M A;  5A5C A;  4KXF B;  3VQ2 A;  3C6O B;  4U7L A;  4R6G A;  4LSX C;  2Z66 A;  3VQ1 A;  4V2E A;  4M7E C;  2OMW A;  1FQV A;  4R07 A;  3OGL B;  2Z81 A;  5IJD A;  4QBZ A;  1U0N D;  4PKI G;  1YRG A;  1M9S A;  1OTM A;  2P1P B;  3G3B A;  3OJA A;  4V2D A;  1G9U A;  4CNM A;  2P1Q B;  3DZE A;  4CIL A;  4C2B B;  5HDH A;  1DFJ I;  3O53 A;  4CC4 A;  4Q3G A;  4NKH A;  2WQW A;  5B0N A;  4RCA B;  4RCW A;  1P8V A;  1M10 B;  4P8S A;  4L3F A;  1OGQ A;  5IJB A;  3RGZ A;  2P1O B;  4BSU A;  4Q62 A;  3ULA A;  2OMZ A;  4V2C A;  5GQR K;  3UL8 A;  4LI2 A;  3E4G A;  1K5G C;  3OGK B;  5CMP A;  4CC4 C;  4QC0 A;  4Z8G A;  4ARR A;  4L3A A;  2XOT A;  4WYK A;  3WPB A;  4KT1 A;  3SB4 A;  2Z62 A;  3C6N B;  2OMT A;  2UZY A;  2ASS B;  2Z64 A;  4R58 A;  3E6J A;  2A0Z A;  1XKU A;  2OMV A;  3RFS A;  4FD0 A;  4J4L A;  1K5D C;  1H6U A;  2WQV A;  2V9T B;  4H09 A;  1JL5 A;  1SQ0 B;  3UL9 A;  4UFR A;  5GMG A;  5GS2 B;  2AST B;  3ZYI A;  2WQX A;  3ULV A;  5HZL B;  3G3A A;  4K17 A;  1QYY A;  3UN9 A;  2ID5 A;  2JE1 A;  1XEU A;  4Z94 G;  5GS0 A;  3ZYJ A;  3WPI A;  2UZX A;  3E2J A;  2OMY A;  3WPC A;  4P91 A;  4LXS A;  1O6T A;  3RW7 A;  4BSS A;  5CMN A;  4R6J A;  1D0B A;  2OMU A;  3E3Z A;  4FMZ A;  3WPG A;  2R9U A;  1KOH A;  2OMX A;  4FDW A;  3RFE A;  3W3N A;  4XSQ A;  1O6V A;  1M0Z A;  1OTO A;  2Z82 A;  4AW4 A;  4R5D A;  1A4Y A;  4PQ8 A;  3CVR A;  5B0T A;  2BEX A;  4R09 A;  3W3G A;  4XGO A;  3A79 B;  4R08 A;  2Q4G W;  3O6N A;  3W3M A;  3RFJ A;  4OQT A;  3WPH A;  3G39 A;  1P9A G;  2Y5Q A;  4XOS A;  4B8C D;  1XEC A;  3REZ A;  1P8T A;  1A9N A;  2RA8 A;  3PMH G;  4HQ1 A;  4BSR A;  5AWB A;  4R6F A;  1XCD A;  4CNC A;  5FTT B;  3ZYN A;  2WFH A;  5IJC A;  1KOO A;  5AZ5 A;  4I6J B;  1GWB A;  1DCE A;  4LI1 A;  3WPF A;  2BNH A;  3JB9 j;  2Z65 A;  4QXE A;  2Z7X B;  4NKG A;  4PSJ A;  2O6R A;  1WWL A;  3RJ0 A;  1FO1 A;  5LFN A;  4KNG A;  2Z63 A;  3CIG A;  4MN8 B;  4CP6 A;  4ECN A;  1W8A A;  4R5C A;  4TZH A;  4M7E A;  3RGX A;  2FT3 A;  3P72 A;  4Z61 C;  2WQU A;  4LSA A;  4YEB B;  2P1M B;  4U08 A;  4ARN A;  1FS2 A;  1O6S A;  5IYX C;  5D3I A;  3BZ5 A;  5GMF A;  1OOK G;  2CA6 A;  2O6Q A;  3ULU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...