1IO0A

Crystal structure of tropomodulin c-terminal half
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
166
structure length
166
Chain Sequence
NSTDVEETLKRIQNNDPDLEEVNLNNIMNIPVPTLKACAEALKTNTYVKKFSIVGTRSNDPVAFALAEMLKVNNTLKSLNVESNFISGSGILALVEALQSNTSLIELRIDNQSQPLGNNVEMEIANMLEKNTTLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords TROPOMODULIN
publication title Crystal structure of the C-terminal half of tropomodulin and structural basis of actin filament pointed-end capping
pubmed rcsb
source organism Gallus gallus
total genus 68
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1io0A00
1FS2A 3G39A 4PQ8A 1Z7XW 3OGLB 3JB9j 5B0NA 4RCWA 3RIZA 2Z7XB 4QC0A 3RGZA 4FMZA 4R0AA 2Z81A 5CMNA 4AW4A 4QXEA 4R5DA 2O6RA 1XCDA 4R09A 4RWTC 2WQUA 4NKGA 2WQVA 3WPBA 3UN9A 4R6JA 2WQWA 4LXRA 3WPIA 4EZGA 1XEUA 2FT3A 3W3JA 4BSRA 2RA8A 4BSUA 1DFJI 5HZLB 1KOOA 3E6JA 4LSAA 3KJ4A 1P9AG 1D0BA 3RFJA 3G3BA 1M0ZA 5GMHA 1KOHA 1YRGA 4FD0A 4CC4C 4R58A 5GMGA 1FT8A 3CVRA 3M18A 2XOTA 4CC4A 5IJBA 1XECA 4WYKA 4PSJA 2V9SA 3ULVA 4C2BB 4J4LA 4V2EA 4L3AA 3ZYJA 1W8AA 4GLPA 4LXSA 4AY9X 2BEXA 4IM6A 2BNHA 5GQRK 3W3NA 4Q3IA 4M7EC 2Z7XA 4Z61C 3TSRE 4Z8GA 2Y5QA 4M7EA 4U06A 4OQTA 5D3IA 1M9SA 4FCGA 5B0TA 1DS9A 4LSXC 3A79B 4R6AA 4ECNA 4U08A 3RJ0A 3RFSA 4LSXA 4MQWX 3G04C 3ULAA 2Z63A 5LFNA 2WFHA 4TZHA 2ELLA 3PMHG 3UL8A 3VQ2A 3W3MA 4YEBB 1FQVA 4MN8B 4FS7A 2XWTC 3UL7A 3WPCA 4R07A 3RW7A 4U09A 4B8CD 2P1QB 1OTOA 3E4GA 3W3KA 4U7LA 4KT1A 3C6OB 4BV4R 2WQXA 1O6VA 2V9TB 3WPHA 4CNMA 4Z79A 3G06A 1OZNA 3BZ5A 5IJDA 1WWLA 4H09A 4GT6A 2OMZA 1OGQA 4J0MA 3OJAB 1M9LA 2A0ZA 1K5GC 1A4YA 2JE0A 3W3GA 1H6UA 1OOKG 1ZIWA 4XSQA 3SB4A 1GWBA 2Q4GW 3ZYOA 4BSSA 1FO1A 3ZYIA 4Z64C 3P72A 3FXIA 3GOZA 2OMWA 5FTTB 2P1OB 2OMXA 4FHOA 2Z82A 1O6SA 1U0ND 4P91A 1XKUA 3E2JA 2Z64A 4Q62A 1G9UA 3W3LA 4G8AA 2UZXA 2P1PB 3WPFA 2CA6A 1QYYA 3OGMB 2R9UA 4R5CA 3WPGA 2OMTA 4XGOA 2Z62A 4PKIG 4FDWA 4ARRA 1JL5A 1OTNA 4NKHA 3OJAA 5CMPA 5AZ5A 3C6PB 5GS0A 3REZA 2P1NB 2OMUA 3O53A 5AWAA 1P8TA 1M10B 4PERA 1IO0A 3ULUA 5GS2B 4P8SA 4V2DA 4R6GA 3ZYNA 2Z66A 1H6TA 4CP6A 2OMYA 4LI1A 4Y61B 4HQ1A 4L3FA 1A9NA 4ARNA 2Z65A 4CILA 4V2CA 4I6JB 1P8VA 5AWCA 4LI2A 4UFRA 1SQ0B 3VQ1A 5AWDA 3C6NB 3M19A 4QBZA 4K17A 3G3AA 5GMFA 4ECOA 2UZYA 2IFGA 2P1MB 1K5DC 3WN4A 4PEQB 4CNCA 3O6NA 4Z94G 1PGVA 4KXFB 4R6FA 3CIGA 2JQDA 2ID5A 3WPDA 5A5CA 3RFEA 4R08A 5IYXC 4KNGA 2O6SA 5B4PA 3OGKB 2OMVA 4LSCA 1O6TA 3DZEA 3RGXA 2JE1A 3WPEA 2V70A 3UL9A 3E3ZA 5IJCA 1LTXA 2O6QA 5AWBA 2ASTB 2ASSB 2RR6A 4WP6A 1XWDC 3CIYA 4Q3GA 3RW6A 4C2AB 1OTMA 1DCEA 4RCAB 5HDHA 4XOSA
chains in the Genus database with same CATH superfamily
1FS2A 3G39A 4PQ8A 1Z7XW 3OGLB 3JB9j 5B0NA 4RCWA 3RIZA 2Z7XB 4QC0A 3RGZA 4FMZA 4R0AA 2Z81A 5CMNA 4AW4A 4QXEA 4R5DA 2O6RA 1XCDA 4R09A 4RWTC 2WQUA 4NKGA 2WQVA 3WPBA 3UN9A 4R6JA 2WQWA 4LXRA 3WPIA 4EZGA 1XEUA 2FT3A 3W3JA 4BSRA 2RA8A 4BSUA 1DFJI 5HZLB 1KOOA 3E6JA 4LSAA 4NZRM 3KJ4A 1P9AG 4NZTM 1D0BA 3RFJA 3G3BA 1M0ZA 5GMHA 1KOHA 1YRGA 4FD0A 4CC4C 4R58A 5GMGA 1FT8A 3CVRA 3M18A 2XOTA 4CC4A 5IJBA 1XECA 4WYKA 4PSJA 2V9SA 3ULVA 4C2BB 4J4LA 4V2EA 4L3AA 3ZYJA 1W8AA 4GLPA 4LXSA 4AY9X 2BEXA 4IM6A 2BNHA 5GQRK 3W3NA 4Q3IA 4M7EC 2Z7XA 4Z61C 3TSRE 4Z8GA 2Y5QA 4M7EA 4U06A 4OQTA 5D3IA 1M9SA 4FCGA 5B0TA 1DS9A 4LSXC 3A79B 4R6AA 4ECNA 4U08A 3RJ0A 3RFSA 4LSXA 4MQWX 3G04C 3ULAA 2Z63A 5LFNA 2WFHA 4TZHA 2ELLA 3PMHG 3UL8A 3VQ2A 3W3MA 4YEBB 1FQVA 4MN8B 4FS7A 2XWTC 3UL7A 3WPCA 4R07A 3RW7A 4U09A 4B8CD 2P1QB 1OTOA 3E4GA 3W3KA 4U7LA 4KT1A 3C6OB 4BV4R 2WQXA 1O6VA 2V9TB 3WPHA 4CNMA 4Z79A 3G06A 1OZNA 3BZ5A 5IJDA 1WWLA 4H09A 4GT6A 2OMZA 1OGQA 4J0MA 3OJAB 1M9LA 2A0ZA 1K5GC 1A4YA 2JE0A 3W3GA 1H6UA 1OOKG 1ZIWA 4XSQA 3SB4A 1GWBA 2Q4GW 3ZYOA 4BSSA 1FO1A 3ZYIA 4Z64C 3P72A 3FXIA 3GOZA 2OMWA 5FTTB 2P1OB 2OMXA 4FHOA 2Z82A 1O6SA 1U0ND 4P91A 1XKUA 3E2JA 2Z64A 4Q62A 1G9UA 3W3LA 4G8AA 2UZXA 2P1PB 3WPFA 2CA6A 1QYYA 3OGMB 2R9UA 4R5CA 3WPGA 2OMTA 4XGOA 2Z62A 4PKIG 4FDWA 4ARRA 1JL5A 1OTNA 4NKHA 3OJAA 5CMPA 5AZ5A 3C6PB 5GS0A 3REZA 2P1NB 2OMUA 3O53A 5AWAA 1P8TA 1M10B 4PERA 1IO0A 3ULUA 5GS2B 4P8SA 4V2DA 4R6GA 3ZYNA 2Z66A 1H6TA 4CP6A 2OMYA 4LI1A 4Y61B 4HQ1A 4L3FA 1A9NA 4ARNA 2Z65A 4CILA 4V2CA 4I6JB 1P8VA 5AWCA 4LI2A 4UFRA 1SQ0B 3VQ1A 5AWDA 3C6NB 3M19A 4QBZA 4K17A 3G3AA 5GMFA 4ECOA 2UZYA 2IFGA 2P1MB 1K5DC 3WN4A 4PEQB 4CNCA 3O6NA 4Z94G 1PGVA 4KXFB 4R6FA 3CIGA 2JQDA 2ID5A 3WPDA 5A5CA 3RFEA 4R08A 5IYXC 4KNGA 2O6SA 5B4PA 3OGKB 2OMVA 4LSCA 1O6TA 3DZEA 3RGXA 2JE1A 3WPEA 2V70A 3UL9A 3E3ZA 5IJCA 1LTXA 2O6QA 5AWBA 2ASTB 2ASSB 2RR6A 4WP6A 1XWDC 3CIYA 4Q3GA 3RW6A 4C2AB 1OTMA 1DCEA 4RCAB 5HDHA 4XOSA
chains in the Genus database with same CATH topology
1FS2A 3G39A 4PQ8A 1Z7XW 3OGLB 3JB9j 5B0NA 4RCWA 3RIZA 2Z7XB 4QC0A 3RGZA 4FMZA 4R0AA 2Z81A 5CMNA 4AW4A 4QXEA 4R5DA 2O6RA 1XCDA 4R09A 4RWTC 2WQUA 4NKGA 2WQVA 3WPBA 3UN9A 4R6JA 2WQWA 4LXRA 3WPIA 4EZGA 1XEUA 2FT3A 3W3JA 4BSRA 2RA8A 4BSUA 1DFJI 5HZLB 1KOOA 3E6JA 4LSAA 3KJ4A 1P9AG 1D0BA 3RFJA 3G3BA 1M0ZA 5GMHA 1KOHA 1YRGA 4FD0A 4CC4C 4R58A 5GMGA 1FT8A 3CVRA 3M18A 2XOTA 4CC4A 5IJBA 1XECA 4WYKA 4PSJA 2V9SA 3ULVA 4C2BB 4J4LA 4V2EA 4L3AA 3ZYJA 1W8AA 4GLPA 4LXSA 4AY9X 2BEXA 4IM6A 2BNHA 5GQRK 3W3NA 4Q3IA 4M7EC 2Z7XA 4Z61C 3TSRE 4Z8GA 2Y5QA 4M7EA 4U06A 4OQTA 5D3IA 1M9SA 4FCGA 5B0TA 1DS9A 4LSXC 3A79B 4R6AA 4ECNA 4U08A 3RJ0A 3RFSA 4LSXA 4MQWX 3G04C 3ULAA 2Z63A 5LFNA 2WFHA 4TZHA 2ELLA 3PMHG 3UL8A 3VQ2A 3W3MA 4YEBB 1FQVA 4MN8B 4FS7A 2XWTC 3UL7A 3WPCA 4R07A 3RW7A 4U09A 4B8CD 2P1QB 1OTOA 3E4GA 3W3KA 4U7LA 4KT1A 3C6OB 4BV4R 2WQXA 1O6VA 2V9TB 3WPHA 4CNMA 4Z79A 3G06A 1OZNA 3BZ5A 5IJDA 1WWLA 4H09A 4GT6A 2OMZA 1OGQA 4J0MA 3OJAB 1M9LA 2A0ZA 1K5GC 1A4YA 2JE0A 3W3GA 1H6UA 1OOKG 1ZIWA 4XSQA 3SB4A 1GWBA 2Q4GW 3ZYOA 4BSSA 1FO1A 3ZYIA 4Z64C 3P72A 3FXIA 3GOZA 2OMWA 5FTTB 2P1OB 2OMXA 4FHOA 2Z82A 1O6SA 1U0ND 4P91A 1XKUA 3E2JA 2Z64A 4Q62A 1G9UA 3W3LA 4G8AA 2UZXA 2P1PB 3WPFA 2CA6A 1QYYA 3OGMB 2R9UA 4R5CA 3WPGA 2OMTA 4XGOA 2Z62A 4PKIG 4FDWA 4ARRA 1JL5A 1OTNA 4NKHA 3OJAA 5CMPA 5AZ5A 3C6PB 5GS0A 3REZA 2P1NB 2OMUA 3O53A 5AWAA 1P8TA 1M10B 4PERA 1IO0A 3ULUA 5GS2B 4P8SA 4V2DA 4R6GA 3ZYNA 2Z66A 1H6TA 4CP6A 2OMYA 4LI1A 4Y61B 4HQ1A 4L3FA 1A9NA 4ARNA 2Z65A 4CILA 4V2CA 4I6JB 1P8VA 5AWCA 4LI2A 4UFRA 1SQ0B 3VQ1A 5AWDA 3C6NB 3M19A 4QBZA 4K17A 3G3AA 5GMFA 4ECOA 2UZYA 2IFGA 2P1MB 1K5DC 3WN4A 4PEQB 4CNCA 3O6NA 4Z94G 1PGVA 4KXFB 4R6FA 3CIGA 2JQDA 2ID5A 3WPDA 5A5CA 3RFEA 4R08A 5IYXC 4KNGA 2O6SA 5B4PA 3OGKB 2OMVA 4LSCA 1O6TA 3DZEA 3RGXA 2JE1A 3WPEA 2V70A 3UL9A 3E3ZA 5IJCA 1LTXA 2O6QA 5AWBA 2ASTB 2ASSB 2RR6A 4WP6A 1XWDC 3CIYA 4Q3GA 3RW6A 4C2AB 1OTMA 1DCEA 4RCAB 5HDHA 4XOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FS2 A;  3G39 A;  4PQ8 A;  1Z7X W;  3OGL B;  3JB9 j;  5B0N A;  4RCW A;  3RIZ A;  2Z7X B;  4QC0 A;  3RGZ A;  4FMZ A;  4R0A A;  2Z81 A;  5CMN A;  4AW4 A;  4QXE A;  4R5D A;  2O6R A;  1XCD A;  4R09 A;  4RWT C;  2WQU A;  4NKG A;  2WQV A;  3WPB A;  3UN9 A;  4R6J A;  2WQW A;  4LXR A;  3WPI A;  4EZG A;  1XEU A;  2FT3 A;  3W3J A;  4BSR A;  2RA8 A;  4BSU A;  1DFJ I;  5HZL B;  1KOO A;  3E6J A;  4LSA A;  3KJ4 A;  1P9A G;  1D0B A;  3RFJ A;  3G3B A;  1M0Z A;  5GMH A;  1KOH A;  1YRG A;  4FD0 A;  4CC4 C;  4R58 A;  5GMG A;  1FT8 A;  3CVR A;  3M18 A;  2XOT A;  4CC4 A;  5IJB A;  1XEC A;  4WYK A;  4PSJ A;  2V9S A;  3ULV A;  4C2B B;  4J4L A;  4V2E A;  4L3A A;  3ZYJ A;  1W8A A;  4GLP A;  4LXS A;  4AY9 X;  2BEX A;  4IM6 A;  2BNH A;  5GQR K;  3W3N A;  4Q3I A;  4M7E C;  2Z7X A;  4Z61 C;  3TSR E;  4Z8G A;  2Y5Q A;  4M7E A;  4U06 A;  4OQT A;  5D3I A;  1M9S A;  4FCG A;  5B0T A;  1DS9 A;  4LSX C;  3A79 B;  4R6A A;  4ECN A;  4U08 A;  3RJ0 A;  3RFS A;  4LSX A;  4MQW X;  3G04 C;  3ULA A;  2Z63 A;  5LFN A;  2WFH A;  4TZH A;  2ELL A;  3PMH G;  3UL8 A;  3VQ2 A;  3W3M A;  4YEB B;  1FQV A;  4MN8 B;  4FS7 A;  2XWT C;  3UL7 A;  3WPC A;  4R07 A;  3RW7 A;  4U09 A;  4B8C D;  2P1Q B;  1OTO A;  3E4G A;  3W3K A;  4U7L A;  4KT1 A;  3C6O B;  4BV4 R;  2WQX A;  1O6V A;  2V9T B;  3WPH A;  4CNM A;  4Z79 A;  3G06 A;  1OZN A;  3BZ5 A;  5IJD A;  1WWL A;  4H09 A;  4GT6 A;  2OMZ A;  1OGQ A;  4J0M A;  3OJA B;  1M9L A;  2A0Z A;  1K5G C;  1A4Y A;  2JE0 A;  3W3G A;  1H6U A;  1OOK G;  1ZIW A;  4XSQ A;  3SB4 A;  1GWB A;  2Q4G W;  3ZYO A;  4BSS A;  1FO1 A;  3ZYI A;  4Z64 C;  3P72 A;  3FXI A;  3GOZ A;  2OMW A;  5FTT B;  2P1O B;  2OMX A;  4FHO A;  2Z82 A;  1O6S A;  1U0N D;  4P91 A;  1XKU A;  3E2J A;  2Z64 A;  4Q62 A;  1G9U A;  3W3L A;  4G8A A;  2UZX A;  2P1P B;  3WPF A;  2CA6 A;  1QYY A;  3OGM B;  2R9U A;  4R5C A;  3WPG A;  2OMT A;  4XGO A;  2Z62 A;  4PKI G;  4FDW A;  4ARR A;  1JL5 A;  1OTN A;  4NKH A;  3OJA A;  5CMP A;  5AZ5 A;  3C6P B;  5GS0 A;  3REZ A;  2P1N B;  2OMU A;  3O53 A;  5AWA A;  1P8T A;  1M10 B;  4PER A;  1IO0 A;  3ULU A;  5GS2 B;  4P8S A;  4V2D A;  4R6G A;  3ZYN A;  2Z66 A;  1H6T A;  4CP6 A;  2OMY A;  4LI1 A;  4Y61 B;  4HQ1 A;  4L3F A;  1A9N A;  4ARN A;  2Z65 A;  4CIL A;  4V2C A;  4I6J B;  1P8V A;  5AWC A;  4LI2 A;  4UFR A;  1SQ0 B;  3VQ1 A;  5AWD A;  3C6N B;  3M19 A;  4QBZ A;  4K17 A;  3G3A A;  5GMF A;  4ECO A;  2UZY A;  2IFG A;  2P1M B;  1K5D C;  3WN4 A;  4PEQ B;  4CNC A;  3O6N A;  4Z94 G;  1PGV A;  4KXF B;  4R6F A;  3CIG A;  2JQD A;  2ID5 A;  3WPD A;  5A5C A;  3RFE A;  4R08 A;  5IYX C;  4KNG A;  2O6S A;  5B4P A;  3OGK B;  2OMV A;  4LSC A;  1O6T A;  3DZE A;  3RGX A;  2JE1 A;  3WPE A;  2V70 A;  3UL9 A;  3E3Z A;  5IJC A;  1LTX A;  2O6Q A;  5AWB A;  2AST B;  2ASS B;  2RR6 A;  4WP6 A;  1XWD C;  3CIY A;  4Q3G A;  3RW6 A;  4C2A B;  1OTM A;  1DCE A;  4RCA B;  5HDH A;  4XOS A; 
#chains in the Genus database with same CATH topology
 1FS2 A;  3G39 A;  4PQ8 A;  1Z7X W;  3OGL B;  3JB9 j;  5B0N A;  4RCW A;  3RIZ A;  2Z7X B;  4QC0 A;  3RGZ A;  4FMZ A;  4R0A A;  2Z81 A;  5CMN A;  4AW4 A;  4QXE A;  4R5D A;  2O6R A;  1XCD A;  4R09 A;  4RWT C;  2WQU A;  4NKG A;  2WQV A;  3WPB A;  3UN9 A;  4R6J A;  2WQW A;  4LXR A;  3WPI A;  4EZG A;  1XEU A;  2FT3 A;  3W3J A;  4BSR A;  2RA8 A;  4BSU A;  1DFJ I;  5HZL B;  1KOO A;  3E6J A;  4LSA A;  4NZR M;  3KJ4 A;  1P9A G;  4NZT M;  1D0B A;  3RFJ A;  3G3B A;  1M0Z A;  5GMH A;  1KOH A;  1YRG A;  4FD0 A;  4CC4 C;  4R58 A;  5GMG A;  1FT8 A;  3CVR A;  3M18 A;  2XOT A;  4CC4 A;  5IJB A;  1XEC A;  4WYK A;  4PSJ A;  2V9S A;  3ULV A;  4C2B B;  4J4L A;  4V2E A;  4L3A A;  3ZYJ A;  1W8A A;  4GLP A;  4LXS A;  4AY9 X;  2BEX A;  4IM6 A;  2BNH A;  5GQR K;  3W3N A;  4Q3I A;  4M7E C;  2Z7X A;  4Z61 C;  3TSR E;  4Z8G A;  2Y5Q A;  4M7E A;  4U06 A;  4OQT A;  5D3I A;  1M9S A;  4FCG A;  5B0T A;  1DS9 A;  4LSX C;  3A79 B;  4R6A A;  4ECN A;  4U08 A;  3RJ0 A;  3RFS A;  4LSX A;  4MQW X;  3G04 C;  3ULA A;  2Z63 A;  5LFN A;  2WFH A;  4TZH A;  2ELL A;  3PMH G;  3UL8 A;  3VQ2 A;  3W3M A;  4YEB B;  1FQV A;  4MN8 B;  4FS7 A;  2XWT C;  3UL7 A;  3WPC A;  4R07 A;  3RW7 A;  4U09 A;  4B8C D;  2P1Q B;  1OTO A;  3E4G A;  3W3K A;  4U7L A;  4KT1 A;  3C6O B;  4BV4 R;  2WQX A;  1O6V A;  2V9T B;  3WPH A;  4CNM A;  4Z79 A;  3G06 A;  1OZN A;  3BZ5 A;  5IJD A;  1WWL A;  4H09 A;  4GT6 A;  2OMZ A;  1OGQ A;  4J0M A;  3OJA B;  1M9L A;  2A0Z A;  1K5G C;  1A4Y A;  2JE0 A;  3W3G A;  1H6U A;  1OOK G;  1ZIW A;  4XSQ A;  3SB4 A;  1GWB A;  2Q4G W;  3ZYO A;  4BSS A;  1FO1 A;  3ZYI A;  4Z64 C;  3P72 A;  3FXI A;  3GOZ A;  2OMW A;  5FTT B;  2P1O B;  2OMX A;  4FHO A;  2Z82 A;  1O6S A;  1U0N D;  4P91 A;  1XKU A;  3E2J A;  2Z64 A;  4Q62 A;  1G9U A;  3W3L A;  4G8A A;  2UZX A;  2P1P B;  3WPF A;  2CA6 A;  1QYY A;  3OGM B;  2R9U A;  4R5C A;  3WPG A;  2OMT A;  4XGO A;  2Z62 A;  4PKI G;  4FDW A;  4ARR A;  1JL5 A;  1OTN A;  4NKH A;  3OJA A;  5CMP A;  5AZ5 A;  3C6P B;  5GS0 A;  3REZ A;  2P1N B;  2OMU A;  3O53 A;  5AWA A;  1P8T A;  1M10 B;  4PER A;  1IO0 A;  3ULU A;  5GS2 B;  4P8S A;  4V2D A;  4R6G A;  3ZYN A;  2Z66 A;  1H6T A;  4CP6 A;  2OMY A;  4LI1 A;  4Y61 B;  4HQ1 A;  4L3F A;  1A9N A;  4ARN A;  2Z65 A;  4CIL A;  4V2C A;  4I6J B;  1P8V A;  5AWC A;  4LI2 A;  4UFR A;  1SQ0 B;  3VQ1 A;  5AWD A;  3C6N B;  3M19 A;  4QBZ A;  4K17 A;  3G3A A;  5GMF A;  4ECO A;  2UZY A;  2IFG A;  2P1M B;  1K5D C;  3WN4 A;  4PEQ B;  4CNC A;  3O6N A;  4Z94 G;  1PGV A;  4KXF B;  4R6F A;  3CIG A;  2JQD A;  2ID5 A;  3WPD A;  5A5C A;  3RFE A;  4R08 A;  5IYX C;  4KNG A;  2O6S A;  5B4P A;  3OGK B;  2OMV A;  4LSC A;  1O6T A;  3DZE A;  3RGX A;  2JE1 A;  3WPE A;  2V70 A;  3UL9 A;  3E3Z A;  5IJC A;  1LTX A;  2O6Q A;  5AWB A;  2AST B;  2ASS B;  2RR6 A;  4WP6 A;  1XWD C;  3CIY A;  4Q3G A;  3RW6 A;  4C2A B;  1OTM A;  1DCE A;  4RCA B;  5HDH A;  4XOS A; 
#chains in the Genus database with same CATH homology
 1FS2 A;  3G39 A;  4PQ8 A;  1Z7X W;  3OGL B;  3JB9 j;  5B0N A;  4RCW A;  3RIZ A;  2Z7X B;  4QC0 A;  3RGZ A;  4FMZ A;  4R0A A;  2Z81 A;  5CMN A;  4AW4 A;  4QXE A;  4R5D A;  2O6R A;  1XCD A;  4R09 A;  4RWT C;  2WQU A;  4NKG A;  2WQV A;  3WPB A;  3UN9 A;  4R6J A;  2WQW A;  4LXR A;  3WPI A;  4EZG A;  1XEU A;  2FT3 A;  3W3J A;  4BSR A;  2RA8 A;  4BSU A;  1DFJ I;  5HZL B;  1KOO A;  3E6J A;  4LSA A;  3KJ4 A;  1P9A G;  1D0B A;  3RFJ A;  3G3B A;  1M0Z A;  5GMH A;  1KOH A;  1YRG A;  4FD0 A;  4CC4 C;  4R58 A;  5GMG A;  1FT8 A;  3CVR A;  3M18 A;  2XOT A;  4CC4 A;  5IJB A;  1XEC A;  4WYK A;  4PSJ A;  2V9S A;  3ULV A;  4C2B B;  4J4L A;  4V2E A;  4L3A A;  3ZYJ A;  1W8A A;  4GLP A;  4LXS A;  4AY9 X;  2BEX A;  4IM6 A;  2BNH A;  5GQR K;  3W3N A;  4Q3I A;  4M7E C;  2Z7X A;  4Z61 C;  3TSR E;  4Z8G A;  2Y5Q A;  4M7E A;  4U06 A;  4OQT A;  5D3I A;  1M9S A;  4FCG A;  5B0T A;  1DS9 A;  4LSX C;  3A79 B;  4R6A A;  4ECN A;  4U08 A;  3RJ0 A;  3RFS A;  4LSX A;  4MQW X;  3G04 C;  3ULA A;  2Z63 A;  5LFN A;  2WFH A;  4TZH A;  2ELL A;  3PMH G;  3UL8 A;  3VQ2 A;  3W3M A;  4YEB B;  1FQV A;  4MN8 B;  4FS7 A;  2XWT C;  3UL7 A;  3WPC A;  4R07 A;  3RW7 A;  4U09 A;  4B8C D;  2P1Q B;  1OTO A;  3E4G A;  3W3K A;  4U7L A;  4KT1 A;  3C6O B;  4BV4 R;  2WQX A;  1O6V A;  2V9T B;  3WPH A;  4CNM A;  4Z79 A;  3G06 A;  1OZN A;  3BZ5 A;  5IJD A;  1WWL A;  4H09 A;  4GT6 A;  2OMZ A;  1OGQ A;  4J0M A;  3OJA B;  1M9L A;  2A0Z A;  1K5G C;  1A4Y A;  2JE0 A;  3W3G A;  1H6U A;  1OOK G;  1ZIW A;  4XSQ A;  3SB4 A;  1GWB A;  2Q4G W;  3ZYO A;  4BSS A;  1FO1 A;  3ZYI A;  4Z64 C;  3P72 A;  3FXI A;  3GOZ A;  2OMW A;  5FTT B;  2P1O B;  2OMX A;  4FHO A;  2Z82 A;  1O6S A;  1U0N D;  4P91 A;  1XKU A;  3E2J A;  2Z64 A;  4Q62 A;  1G9U A;  3W3L A;  4G8A A;  2UZX A;  2P1P B;  3WPF A;  2CA6 A;  1QYY A;  3OGM B;  2R9U A;  4R5C A;  3WPG A;  2OMT A;  4XGO A;  2Z62 A;  4PKI G;  4FDW A;  4ARR A;  1JL5 A;  1OTN A;  4NKH A;  3OJA A;  5CMP A;  5AZ5 A;  3C6P B;  5GS0 A;  3REZ A;  2P1N B;  2OMU A;  3O53 A;  5AWA A;  1P8T A;  1M10 B;  4PER A;  1IO0 A;  3ULU A;  5GS2 B;  4P8S A;  4V2D A;  4R6G A;  3ZYN A;  2Z66 A;  1H6T A;  4CP6 A;  2OMY A;  4LI1 A;  4Y61 B;  4HQ1 A;  4L3F A;  1A9N A;  4ARN A;  2Z65 A;  4CIL A;  4V2C A;  4I6J B;  1P8V A;  5AWC A;  4LI2 A;  4UFR A;  1SQ0 B;  3VQ1 A;  5AWD A;  3C6N B;  3M19 A;  4QBZ A;  4K17 A;  3G3A A;  5GMF A;  4ECO A;  2UZY A;  2IFG A;  2P1M B;  1K5D C;  3WN4 A;  4PEQ B;  4CNC A;  3O6N A;  4Z94 G;  1PGV A;  4KXF B;  4R6F A;  3CIG A;  2JQD A;  2ID5 A;  3WPD A;  5A5C A;  3RFE A;  4R08 A;  5IYX C;  4KNG A;  2O6S A;  5B4P A;  3OGK B;  2OMV A;  4LSC A;  1O6T A;  3DZE A;  3RGX A;  2JE1 A;  3WPE A;  2V70 A;  3UL9 A;  3E3Z A;  5IJC A;  1LTX A;  2O6Q A;  5AWB A;  2AST B;  2ASS B;  2RR6 A;  4WP6 A;  1XWD C;  3CIY A;  4Q3G A;  3RW6 A;  4C2A B;  1OTM A;  1DCE A;  4RCA B;  5HDH A;  4XOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...