1IO0A

Crystal structure of tropomodulin c-terminal half
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
166
structure length
166
Chain Sequence
NSTDVEETLKRIQNNDPDLEEVNLNNIMNIPVPTLKACAEALKTNTYVKKFSIVGTRSNDPVAFALAEMLKVNNTLKSLNVESNFISGSGILALVEALQSNTSLIELRIDNQSQPLGNNVEMEIANMLEKNTTLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TROPOMODULIN
publication title Crystal structure of the C-terminal half of tropomodulin and structural basis of actin filament pointed-end capping
pubmed rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 68
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1io0A00
4R09A 3UL7A 1K5GC 4C2AB 3OGLB 4L3FA 3KJ4A 3UL9A 3ZYOA 4AW4A 3REZA 2Z65A 4CNCA 5GMHA 2Z62A 4BSUA 3WPDA 5CMNA 4WP6A 3RW6A 1XWDC 1H6TA 1K5DC 5HDHA 4WYKA 4U06A 2V9TB 3WPBA 4FD0A 2OMUA 2WQUA 2Q4GW 4TZHA 4U7LA 3ZYIA 3OGMB 4YEBB 3RGXA 4V2DA 4LXSA 1XEUA 3E3ZA 3O6NA 2RA8A 2P1QB 2OMZA 3RFEA 5D3IA 3TSRE 4LSAA 2JQDA 2P1MB 3G04C 4Y61B 4XGOA 1M10B 4C2BB 3GOZA 2O6RA 4HQ1A 5FTTB 3WPFA 1G9UA 4Z61C 2P1PB 4CILA 4PKIG 1ZIWA 3WPHA 4R6AA 4R6FA 4MQWX 5B0TA 4Z64C 3CIGA 4ECOA 3CIYA 4LXRA 4R6JA 4R08A 1A9NA 2WQWA 3W3GA 1Z7XW 2JE0A 2O6SA 2ID5A 4GLPA 3RFJA 3A79B 3BZ5A 4QC0A 2OMTA 4RWTC 5GQRK 1OTNA 2Z7XA 5IJDA 3G39A 1FO1A 4Q3GA 2WQVA 1IO0A 4CNMA 2JE1A 3RFSA 3ZYNA 3WPGA 5IYXC 1M9LA 1O6TA 3G3AA 5CMPA 1OOKG 4RCWA 1P8TA 3P72A 5AZ5A 2OMXA 2ASSB 3W3LA 3C6PB 4M7EC 4KNGA 4KT1A 4ARRA 4CP6A 1OGQA 5LFNA 5AWAA 1FQVA 4V2CA 3ULVA 3PMHG 3M18A 4LSCA 5AWBA 1M0ZA 5HZLB 3WPIA 4FMZA 2CA6A 3OJAA 3W3NA 3RW7A 4QBZA 4J4LA 5B4PA 5AWDA 2UZYA 5A5CA 3O53A 4G8AA 1D0BA 3OGKB 1O6VA 3G06A 5IJCA 4PERA 3C6OB 2V70A 5AWCA 4RCAB 4OQTA 3CVRA 4H09A 3UN9A 1W8AA 4R6GA 4FS7A 4Q62A 2Z82A 4PSJA 3VQ2A 5GMFA 1H6UA 4R58A 3ZYJA 4MN8B 4BV4R 4EZGA 3RIZA 3RGZA 4LI1A 2UZXA 3G3BA 4UFRA 4FCGA 1PGVA 3C6NB 3JB9j 4R0AA 4IM6A 3RJ0A 4R07A 2P1NB 1OTOA 2P1OB 1OTMA 1XCDA 2XOTA 4AY9X 4Z8GA 1DFJI 2IFGA 3ULAA 4LI2A 1P8VA 2R9UA 4FHOA 4XSQA 4NKGA 1FS2A 3OJAB 5GS2B 4R5DA 2RR6A 1P9AG 4ECNA 4FDWA 4LSXC 1YRGA 3WN4A 4Q3IA 1DS9A 2ASTB 1M9SA 5IJBA 3W3KA 2XWTC 1LTXA 3SB4A 4NKHA 2A0ZA 2Y5QA 1WWLA 4PQ8A 1XKUA 4U08A 4CC4C 4P91A 1DCEA 2V9SA 2BNHA 4K17A 2WQXA 1KOOA 1FT8A 4Z79A 3FXIA 2OMYA 1O6SA 4BSSA 3DZEA 3ULUA 2Z66A 4R5CA 4U09A 2OMVA 2BEXA 1SQ0B 2Z7XB 1OZNA 4I6JB 3UL8A 3VQ1A 5GS0A 1JL5A 4QXEA 3M19A 4ARNA 4PEQB 1U0ND 3WPEA 4P8SA 4XOSA 2ELLA 5B0NA 3W3MA 1GWBA 3E4GA 4GT6A 3E6JA 2FT3A 2O6QA 4M7EA 4J0MA 4B8CD 4Z94G 4LSXA 3E2JA 3W3JA 2Z81A 1A4YA 1QYYA 4L3AA 2WFHA 2OMWA 5GMGA 3WPCA 1XECA 4V2EA 4KXFB 2Z64A 1KOHA 4CC4A 4BSRA 2Z63A
chains in the Genus database with same CATH superfamily
4R09A 3UL7A 1K5GC 4C2AB 3OGLB 4L3FA 3KJ4A 3UL9A 3ZYOA 4AW4A 3REZA 2Z65A 4CNCA 5GMHA 2Z62A 4BSUA 3WPDA 5CMNA 4WP6A 3RW6A 1XWDC 1H6TA 1K5DC 5HDHA 4WYKA 4U06A 2V9TB 3WPBA 4FD0A 2OMUA 2WQUA 2Q4GW 4TZHA 4U7LA 3ZYIA 3OGMB 4YEBB 3RGXA 4V2DA 4LXSA 1XEUA 3E3ZA 3O6NA 2RA8A 2P1QB 2OMZA 3RFEA 5D3IA 3TSRE 4LSAA 2JQDA 2P1MB 3G04C 4Y61B 4XGOA 1M10B 4C2BB 3GOZA 2O6RA 4HQ1A 5FTTB 3WPFA 1G9UA 4Z61C 2P1PB 4CILA 4PKIG 1ZIWA 3WPHA 4R6AA 4R6FA 4MQWX 5B0TA 4Z64C 3CIGA 4ECOA 3CIYA 4LXRA 4R6JA 4R08A 1A9NA 2WQWA 3W3GA 1Z7XW 2JE0A 2O6SA 2ID5A 4GLPA 3RFJA 3A79B 3BZ5A 4QC0A 2OMTA 4RWTC 5GQRK 1OTNA 2Z7XA 5IJDA 3G39A 1FO1A 4Q3GA 2WQVA 1IO0A 4CNMA 2JE1A 3RFSA 3ZYNA 3WPGA 5IYXC 1M9LA 4NZRM 1O6TA 3G3AA 5CMPA 1OOKG 4RCWA 1P8TA 3P72A 5AZ5A 2OMXA 2ASSB 3W3LA 3C6PB 4M7EC 4KNGA 4KT1A 4ARRA 4CP6A 1OGQA 5LFNA 5AWAA 1FQVA 4V2CA 3ULVA 3PMHG 3M18A 4LSCA 5AWBA 1M0ZA 5HZLB 3WPIA 4FMZA 2CA6A 3OJAA 3W3NA 3RW7A 4QBZA 4J4LA 5B4PA 5AWDA 2UZYA 5A5CA 3O53A 4G8AA 1D0BA 3OGKB 1O6VA 3G06A 5IJCA 4PERA 3C6OB 2V70A 5AWCA 4RCAB 4OQTA 3CVRA 4H09A 3UN9A 1W8AA 4R6GA 4FS7A 4Q62A 2Z82A 4PSJA 3VQ2A 5GMFA 1H6UA 4R58A 3ZYJA 4MN8B 4BV4R 4EZGA 3RIZA 3RGZA 4LI1A 2UZXA 3G3BA 4UFRA 4FCGA 1PGVA 4NZTM 3C6NB 3JB9j 4R0AA 4IM6A 3RJ0A 4R07A 2P1NB 1OTOA 2P1OB 1OTMA 1XCDA 2XOTA 4AY9X 4Z8GA 1DFJI 2IFGA 3ULAA 4LI2A 1P8VA 2R9UA 4FHOA 4XSQA 4NKGA 1FS2A 3OJAB 5GS2B 4R5DA 2RR6A 1P9AG 4ECNA 4FDWA 4LSXC 1YRGA 3WN4A 4Q3IA 1DS9A 2ASTB 1M9SA 5IJBA 3W3KA 2XWTC 1LTXA 3SB4A 4NKHA 2A0ZA 2Y5QA 1WWLA 4PQ8A 1XKUA 4U08A 4CC4C 4P91A 1DCEA 2V9SA 2BNHA 4K17A 2WQXA 1KOOA 1FT8A 4Z79A 3FXIA 2OMYA 1O6SA 4BSSA 3DZEA 3ULUA 2Z66A 4R5CA 4U09A 2OMVA 2BEXA 1SQ0B 2Z7XB 1OZNA 4I6JB 3UL8A 3VQ1A 5GS0A 1JL5A 4QXEA 3M19A 4ARNA 4PEQB 1U0ND 3WPEA 4P8SA 4XOSA 2ELLA 5B0NA 3W3MA 1GWBA 3E4GA 4GT6A 3E6JA 2FT3A 2O6QA 4M7EA 4J0MA 4B8CD 4Z94G 4LSXA 3E2JA 3W3JA 2Z81A 1A4YA 1QYYA 4L3AA 2WFHA 2OMWA 5GMGA 3WPCA 1XECA 4V2EA 4KXFB 2Z64A 1KOHA 4CC4A 4BSRA 2Z63A
chains in the Genus database with same CATH topology
4R09A 3UL7A 1K5GC 4C2AB 3OGLB 4L3FA 3KJ4A 3UL9A 3ZYOA 4AW4A 3REZA 2Z65A 4CNCA 5GMHA 2Z62A 4BSUA 3WPDA 5CMNA 4WP6A 3RW6A 1XWDC 1H6TA 1K5DC 5HDHA 4WYKA 4U06A 2V9TB 3WPBA 4FD0A 2OMUA 2WQUA 2Q4GW 4TZHA 4U7LA 3ZYIA 3OGMB 4YEBB 3RGXA 4V2DA 4LXSA 1XEUA 3E3ZA 3O6NA 2RA8A 2P1QB 2OMZA 3RFEA 5D3IA 3TSRE 4LSAA 2JQDA 2P1MB 3G04C 4Y61B 4XGOA 1M10B 4C2BB 3GOZA 2O6RA 4HQ1A 5FTTB 3WPFA 1G9UA 4Z61C 2P1PB 4CILA 4PKIG 1ZIWA 3WPHA 4R6AA 4R6FA 4MQWX 5B0TA 4Z64C 3CIGA 4ECOA 3CIYA 4LXRA 4R6JA 4R08A 1A9NA 2WQWA 3W3GA 1Z7XW 2JE0A 2O6SA 2ID5A 4GLPA 3RFJA 3A79B 3BZ5A 4QC0A 2OMTA 4RWTC 5GQRK 1OTNA 2Z7XA 5IJDA 3G39A 1FO1A 4Q3GA 2WQVA 1IO0A 4CNMA 2JE1A 3RFSA 3ZYNA 3WPGA 5IYXC 1M9LA 1O6TA 3G3AA 5CMPA 1OOKG 4RCWA 1P8TA 3P72A 5AZ5A 2OMXA 2ASSB 3W3LA 3C6PB 4M7EC 4KNGA 4KT1A 4ARRA 4CP6A 1OGQA 5LFNA 5AWAA 1FQVA 4V2CA 3ULVA 3PMHG 3M18A 4LSCA 5AWBA 1M0ZA 5HZLB 3WPIA 4FMZA 2CA6A 3OJAA 3W3NA 3RW7A 4QBZA 4J4LA 5B4PA 5AWDA 2UZYA 5A5CA 3O53A 4G8AA 1D0BA 3OGKB 1O6VA 3G06A 5IJCA 4PERA 3C6OB 2V70A 5AWCA 4RCAB 4OQTA 3CVRA 4H09A 3UN9A 1W8AA 4R6GA 4FS7A 4Q62A 2Z82A 4PSJA 3VQ2A 5GMFA 1H6UA 4R58A 3ZYJA 4MN8B 4BV4R 4EZGA 3RIZA 3RGZA 4LI1A 2UZXA 3G3BA 4UFRA 4FCGA 1PGVA 3C6NB 3JB9j 4R0AA 4IM6A 3RJ0A 4R07A 2P1NB 1OTOA 2P1OB 1OTMA 1XCDA 2XOTA 4AY9X 4Z8GA 1DFJI 2IFGA 3ULAA 4LI2A 1P8VA 2R9UA 4FHOA 4XSQA 4NKGA 1FS2A 3OJAB 5GS2B 4R5DA 2RR6A 1P9AG 4ECNA 4FDWA 4LSXC 1YRGA 3WN4A 4Q3IA 1DS9A 2ASTB 1M9SA 5IJBA 3W3KA 2XWTC 1LTXA 3SB4A 4NKHA 2A0ZA 2Y5QA 1WWLA 4PQ8A 1XKUA 4U08A 4CC4C 4P91A 1DCEA 2V9SA 2BNHA 4K17A 2WQXA 1KOOA 1FT8A 4Z79A 3FXIA 2OMYA 1O6SA 4BSSA 3DZEA 3ULUA 2Z66A 4R5CA 4U09A 2OMVA 2BEXA 1SQ0B 2Z7XB 1OZNA 4I6JB 3UL8A 3VQ1A 5GS0A 1JL5A 4QXEA 3M19A 4ARNA 4PEQB 1U0ND 3WPEA 4P8SA 4XOSA 2ELLA 5B0NA 3W3MA 1GWBA 3E4GA 4GT6A 3E6JA 2FT3A 2O6QA 4M7EA 4J0MA 4B8CD 4Z94G 4LSXA 3E2JA 3W3JA 2Z81A 1A4YA 1QYYA 4L3AA 2WFHA 2OMWA 5GMGA 3WPCA 1XECA 4V2EA 4KXFB 2Z64A 1KOHA 4CC4A 4BSRA 2Z63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R09 A;  3UL7 A;  1K5G C;  4C2A B;  3OGL B;  4L3F A;  3KJ4 A;  3UL9 A;  3ZYO A;  4AW4 A;  3REZ A;  2Z65 A;  4CNC A;  5GMH A;  2Z62 A;  4BSU A;  3WPD A;  5CMN A;  4WP6 A;  3RW6 A;  1XWD C;  1H6T A;  1K5D C;  5HDH A;  4WYK A;  4U06 A;  2V9T B;  3WPB A;  4FD0 A;  2OMU A;  2WQU A;  2Q4G W;  4TZH A;  4U7L A;  3ZYI A;  3OGM B;  4YEB B;  3RGX A;  4V2D A;  4LXS A;  1XEU A;  3E3Z A;  3O6N A;  2RA8 A;  2P1Q B;  2OMZ A;  3RFE A;  5D3I A;  3TSR E;  4LSA A;  2JQD A;  2P1M B;  3G04 C;  4Y61 B;  4XGO A;  1M10 B;  4C2B B;  3GOZ A;  2O6R A;  4HQ1 A;  5FTT B;  3WPF A;  1G9U A;  4Z61 C;  2P1P B;  4CIL A;  4PKI G;  1ZIW A;  3WPH A;  4R6A A;  4R6F A;  4MQW X;  5B0T A;  4Z64 C;  3CIG A;  4ECO A;  3CIY A;  4LXR A;  4R6J A;  4R08 A;  1A9N A;  2WQW A;  3W3G A;  1Z7X W;  2JE0 A;  2O6S A;  2ID5 A;  4GLP A;  3RFJ A;  3A79 B;  3BZ5 A;  4QC0 A;  2OMT A;  4RWT C;  5GQR K;  1OTN A;  2Z7X A;  5IJD A;  3G39 A;  1FO1 A;  4Q3G A;  2WQV A;  1IO0 A;  4CNM A;  2JE1 A;  3RFS A;  3ZYN A;  3WPG A;  5IYX C;  1M9L A;  1O6T A;  3G3A A;  5CMP A;  1OOK G;  4RCW A;  1P8T A;  3P72 A;  5AZ5 A;  2OMX A;  2ASS B;  3W3L A;  3C6P B;  4M7E C;  4KNG A;  4KT1 A;  4ARR A;  4CP6 A;  1OGQ A;  5LFN A;  5AWA A;  1FQV A;  4V2C A;  3ULV A;  3PMH G;  3M18 A;  4LSC A;  5AWB A;  1M0Z A;  5HZL B;  3WPI A;  4FMZ A;  2CA6 A;  3OJA A;  3W3N A;  3RW7 A;  4QBZ A;  4J4L A;  5B4P A;  5AWD A;  2UZY A;  5A5C A;  3O53 A;  4G8A A;  1D0B A;  3OGK B;  1O6V A;  3G06 A;  5IJC A;  4PER A;  3C6O B;  2V70 A;  5AWC A;  4RCA B;  4OQT A;  3CVR A;  4H09 A;  3UN9 A;  1W8A A;  4R6G A;  4FS7 A;  4Q62 A;  2Z82 A;  4PSJ A;  3VQ2 A;  5GMF A;  1H6U A;  4R58 A;  3ZYJ A;  4MN8 B;  4BV4 R;  4EZG A;  3RIZ A;  3RGZ A;  4LI1 A;  2UZX A;  3G3B A;  4UFR A;  4FCG A;  1PGV A;  3C6N B;  3JB9 j;  4R0A A;  4IM6 A;  3RJ0 A;  4R07 A;  2P1N B;  1OTO A;  2P1O B;  1OTM A;  1XCD A;  2XOT A;  4AY9 X;  4Z8G A;  1DFJ I;  2IFG A;  3ULA A;  4LI2 A;  1P8V A;  2R9U A;  4FHO A;  4XSQ A;  4NKG A;  1FS2 A;  3OJA B;  5GS2 B;  4R5D A;  2RR6 A;  1P9A G;  4ECN A;  4FDW A;  4LSX C;  1YRG A;  3WN4 A;  4Q3I A;  1DS9 A;  2AST B;  1M9S A;  5IJB A;  3W3K A;  2XWT C;  1LTX A;  3SB4 A;  4NKH A;  2A0Z A;  2Y5Q A;  1WWL A;  4PQ8 A;  1XKU A;  4U08 A;  4CC4 C;  4P91 A;  1DCE A;  2V9S A;  2BNH A;  4K17 A;  2WQX A;  1KOO A;  1FT8 A;  4Z79 A;  3FXI A;  2OMY A;  1O6S A;  4BSS A;  3DZE A;  3ULU A;  2Z66 A;  4R5C A;  4U09 A;  2OMV A;  2BEX A;  1SQ0 B;  2Z7X B;  1OZN A;  4I6J B;  3UL8 A;  3VQ1 A;  5GS0 A;  1JL5 A;  4QXE A;  3M19 A;  4ARN A;  4PEQ B;  1U0N D;  3WPE A;  4P8S A;  4XOS A;  2ELL A;  5B0N A;  3W3M A;  1GWB A;  3E4G A;  4GT6 A;  3E6J A;  2FT3 A;  2O6Q A;  4M7E A;  4J0M A;  4B8C D;  4Z94 G;  4LSX A;  3E2J A;  3W3J A;  2Z81 A;  1A4Y A;  1QYY A;  4L3A A;  2WFH A;  2OMW A;  5GMG A;  3WPC A;  1XEC A;  4V2E A;  4KXF B;  2Z64 A;  1KOH A;  4CC4 A;  4BSR A;  2Z63 A; 
#chains in the Genus database with same CATH topology
 4R09 A;  3UL7 A;  1K5G C;  4C2A B;  3OGL B;  4L3F A;  3KJ4 A;  3UL9 A;  3ZYO A;  4AW4 A;  3REZ A;  2Z65 A;  4CNC A;  5GMH A;  2Z62 A;  4BSU A;  3WPD A;  5CMN A;  4WP6 A;  3RW6 A;  1XWD C;  1H6T A;  1K5D C;  5HDH A;  4WYK A;  4U06 A;  2V9T B;  3WPB A;  4FD0 A;  2OMU A;  2WQU A;  2Q4G W;  4TZH A;  4U7L A;  3ZYI A;  3OGM B;  4YEB B;  3RGX A;  4V2D A;  4LXS A;  1XEU A;  3E3Z A;  3O6N A;  2RA8 A;  2P1Q B;  2OMZ A;  3RFE A;  5D3I A;  3TSR E;  4LSA A;  2JQD A;  2P1M B;  3G04 C;  4Y61 B;  4XGO A;  1M10 B;  4C2B B;  3GOZ A;  2O6R A;  4HQ1 A;  5FTT B;  3WPF A;  1G9U A;  4Z61 C;  2P1P B;  4CIL A;  4PKI G;  1ZIW A;  3WPH A;  4R6A A;  4R6F A;  4MQW X;  5B0T A;  4Z64 C;  3CIG A;  4ECO A;  3CIY A;  4LXR A;  4R6J A;  4R08 A;  1A9N A;  2WQW A;  3W3G A;  1Z7X W;  2JE0 A;  2O6S A;  2ID5 A;  4GLP A;  3RFJ A;  3A79 B;  3BZ5 A;  4QC0 A;  2OMT A;  4RWT C;  5GQR K;  1OTN A;  2Z7X A;  5IJD A;  3G39 A;  1FO1 A;  4Q3G A;  2WQV A;  1IO0 A;  4CNM A;  2JE1 A;  3RFS A;  3ZYN A;  3WPG A;  5IYX C;  1M9L A;  4NZR M;  1O6T A;  3G3A A;  5CMP A;  1OOK G;  4RCW A;  1P8T A;  3P72 A;  5AZ5 A;  2OMX A;  2ASS B;  3W3L A;  3C6P B;  4M7E C;  4KNG A;  4KT1 A;  4ARR A;  4CP6 A;  1OGQ A;  5LFN A;  5AWA A;  1FQV A;  4V2C A;  3ULV A;  3PMH G;  3M18 A;  4LSC A;  5AWB A;  1M0Z A;  5HZL B;  3WPI A;  4FMZ A;  2CA6 A;  3OJA A;  3W3N A;  3RW7 A;  4QBZ A;  4J4L A;  5B4P A;  5AWD A;  2UZY A;  5A5C A;  3O53 A;  4G8A A;  1D0B A;  3OGK B;  1O6V A;  3G06 A;  5IJC A;  4PER A;  3C6O B;  2V70 A;  5AWC A;  4RCA B;  4OQT A;  3CVR A;  4H09 A;  3UN9 A;  1W8A A;  4R6G A;  4FS7 A;  4Q62 A;  2Z82 A;  4PSJ A;  3VQ2 A;  5GMF A;  1H6U A;  4R58 A;  3ZYJ A;  4MN8 B;  4BV4 R;  4EZG A;  3RIZ A;  3RGZ A;  4LI1 A;  2UZX A;  3G3B A;  4UFR A;  4FCG A;  1PGV A;  4NZT M;  3C6N B;  3JB9 j;  4R0A A;  4IM6 A;  3RJ0 A;  4R07 A;  2P1N B;  1OTO A;  2P1O B;  1OTM A;  1XCD A;  2XOT A;  4AY9 X;  4Z8G A;  1DFJ I;  2IFG A;  3ULA A;  4LI2 A;  1P8V A;  2R9U A;  4FHO A;  4XSQ A;  4NKG A;  1FS2 A;  3OJA B;  5GS2 B;  4R5D A;  2RR6 A;  1P9A G;  4ECN A;  4FDW A;  4LSX C;  1YRG A;  3WN4 A;  4Q3I A;  1DS9 A;  2AST B;  1M9S A;  5IJB A;  3W3K A;  2XWT C;  1LTX A;  3SB4 A;  4NKH A;  2A0Z A;  2Y5Q A;  1WWL A;  4PQ8 A;  1XKU A;  4U08 A;  4CC4 C;  4P91 A;  1DCE A;  2V9S A;  2BNH A;  4K17 A;  2WQX A;  1KOO A;  1FT8 A;  4Z79 A;  3FXI A;  2OMY A;  1O6S A;  4BSS A;  3DZE A;  3ULU A;  2Z66 A;  4R5C A;  4U09 A;  2OMV A;  2BEX A;  1SQ0 B;  2Z7X B;  1OZN A;  4I6J B;  3UL8 A;  3VQ1 A;  5GS0 A;  1JL5 A;  4QXE A;  3M19 A;  4ARN A;  4PEQ B;  1U0N D;  3WPE A;  4P8S A;  4XOS A;  2ELL A;  5B0N A;  3W3M A;  1GWB A;  3E4G A;  4GT6 A;  3E6J A;  2FT3 A;  2O6Q A;  4M7E A;  4J0M A;  4B8C D;  4Z94 G;  4LSX A;  3E2J A;  3W3J A;  2Z81 A;  1A4Y A;  1QYY A;  4L3A A;  2WFH A;  2OMW A;  5GMG A;  3WPC A;  1XEC A;  4V2E A;  4KXF B;  2Z64 A;  1KOH A;  4CC4 A;  4BSR A;  2Z63 A; 
#chains in the Genus database with same CATH homology
 4R09 A;  3UL7 A;  1K5G C;  4C2A B;  3OGL B;  4L3F A;  3KJ4 A;  3UL9 A;  3ZYO A;  4AW4 A;  3REZ A;  2Z65 A;  4CNC A;  5GMH A;  2Z62 A;  4BSU A;  3WPD A;  5CMN A;  4WP6 A;  3RW6 A;  1XWD C;  1H6T A;  1K5D C;  5HDH A;  4WYK A;  4U06 A;  2V9T B;  3WPB A;  4FD0 A;  2OMU A;  2WQU A;  2Q4G W;  4TZH A;  4U7L A;  3ZYI A;  3OGM B;  4YEB B;  3RGX A;  4V2D A;  4LXS A;  1XEU A;  3E3Z A;  3O6N A;  2RA8 A;  2P1Q B;  2OMZ A;  3RFE A;  5D3I A;  3TSR E;  4LSA A;  2JQD A;  2P1M B;  3G04 C;  4Y61 B;  4XGO A;  1M10 B;  4C2B B;  3GOZ A;  2O6R A;  4HQ1 A;  5FTT B;  3WPF A;  1G9U A;  4Z61 C;  2P1P B;  4CIL A;  4PKI G;  1ZIW A;  3WPH A;  4R6A A;  4R6F A;  4MQW X;  5B0T A;  4Z64 C;  3CIG A;  4ECO A;  3CIY A;  4LXR A;  4R6J A;  4R08 A;  1A9N A;  2WQW A;  3W3G A;  1Z7X W;  2JE0 A;  2O6S A;  2ID5 A;  4GLP A;  3RFJ A;  3A79 B;  3BZ5 A;  4QC0 A;  2OMT A;  4RWT C;  5GQR K;  1OTN A;  2Z7X A;  5IJD A;  3G39 A;  1FO1 A;  4Q3G A;  2WQV A;  1IO0 A;  4CNM A;  2JE1 A;  3RFS A;  3ZYN A;  3WPG A;  5IYX C;  1M9L A;  1O6T A;  3G3A A;  5CMP A;  1OOK G;  4RCW A;  1P8T A;  3P72 A;  5AZ5 A;  2OMX A;  2ASS B;  3W3L A;  3C6P B;  4M7E C;  4KNG A;  4KT1 A;  4ARR A;  4CP6 A;  1OGQ A;  5LFN A;  5AWA A;  1FQV A;  4V2C A;  3ULV A;  3PMH G;  3M18 A;  4LSC A;  5AWB A;  1M0Z A;  5HZL B;  3WPI A;  4FMZ A;  2CA6 A;  3OJA A;  3W3N A;  3RW7 A;  4QBZ A;  4J4L A;  5B4P A;  5AWD A;  2UZY A;  5A5C A;  3O53 A;  4G8A A;  1D0B A;  3OGK B;  1O6V A;  3G06 A;  5IJC A;  4PER A;  3C6O B;  2V70 A;  5AWC A;  4RCA B;  4OQT A;  3CVR A;  4H09 A;  3UN9 A;  1W8A A;  4R6G A;  4FS7 A;  4Q62 A;  2Z82 A;  4PSJ A;  3VQ2 A;  5GMF A;  1H6U A;  4R58 A;  3ZYJ A;  4MN8 B;  4BV4 R;  4EZG A;  3RIZ A;  3RGZ A;  4LI1 A;  2UZX A;  3G3B A;  4UFR A;  4FCG A;  1PGV A;  3C6N B;  3JB9 j;  4R0A A;  4IM6 A;  3RJ0 A;  4R07 A;  2P1N B;  1OTO A;  2P1O B;  1OTM A;  1XCD A;  2XOT A;  4AY9 X;  4Z8G A;  1DFJ I;  2IFG A;  3ULA A;  4LI2 A;  1P8V A;  2R9U A;  4FHO A;  4XSQ A;  4NKG A;  1FS2 A;  3OJA B;  5GS2 B;  4R5D A;  2RR6 A;  1P9A G;  4ECN A;  4FDW A;  4LSX C;  1YRG A;  3WN4 A;  4Q3I A;  1DS9 A;  2AST B;  1M9S A;  5IJB A;  3W3K A;  2XWT C;  1LTX A;  3SB4 A;  4NKH A;  2A0Z A;  2Y5Q A;  1WWL A;  4PQ8 A;  1XKU A;  4U08 A;  4CC4 C;  4P91 A;  1DCE A;  2V9S A;  2BNH A;  4K17 A;  2WQX A;  1KOO A;  1FT8 A;  4Z79 A;  3FXI A;  2OMY A;  1O6S A;  4BSS A;  3DZE A;  3ULU A;  2Z66 A;  4R5C A;  4U09 A;  2OMV A;  2BEX A;  1SQ0 B;  2Z7X B;  1OZN A;  4I6J B;  3UL8 A;  3VQ1 A;  5GS0 A;  1JL5 A;  4QXE A;  3M19 A;  4ARN A;  4PEQ B;  1U0N D;  3WPE A;  4P8S A;  4XOS A;  2ELL A;  5B0N A;  3W3M A;  1GWB A;  3E4G A;  4GT6 A;  3E6J A;  2FT3 A;  2O6Q A;  4M7E A;  4J0M A;  4B8C D;  4Z94 G;  4LSX A;  3E2J A;  3W3J A;  2Z81 A;  1A4Y A;  1QYY A;  4L3A A;  2WFH A;  2OMW A;  5GMG A;  3WPC A;  1XEC A;  4V2E A;  4KXF B;  2Z64 A;  1KOH A;  4CC4 A;  4BSR A;  2Z63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...