4J0MA

Crystal structure of brl1 (lrr) in complex with brassinolide
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
727
structure length
724
Chain Sequence
DFNETALLLAFKQNSVKSDPNNVLGNWKYEGSCSWRGVSCSDDGRIVGLDLRNSGLTGTLNLVNLTALPNLQNLYLQGNYFSSGGDSSGSDCYLQVLDLSSNSISDYSMVDYVFSKCSNLVSVNISNNKLVGKLGFAPSSLQSLTTVDLSYNILSDKIPESFISDFPASLKYLDLTHNNLSGDFSDLSFGICGNLTFFSLSQNNLSGDKFPITLPNCKFLETLNISRNNLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGNTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPMELGKCKSLKTIDLSFNELTGPIPKEIWMLPNLSDLVMWANNLTGTIPEGVCVKGGNLETLILNNNLLTGSIPESISRCTNMIWISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEGIRAERLERLPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAVSGFIPPGYGNMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIPFGGQLTTFPVSRYANNSGLCGVPLRPCGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase BRI1-like 1
publication title Structural basis for differential recognition of brassinolide by its receptors
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 246
structure length 724
sequence length 727
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.310 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4j0mA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4j0mA01
3W3LA 2RR6A 3W3KA 4CC4C 4YEBB 3FXIA 3WPGA 2FT3A 4M7EA 5IJCA 3RIZA 3JB9j 4LSCA 3WPFA 2P1QB 4V2DA 4U06A 1XECA 2O6QA 2P1MB 4IM6A 3M18A 1K5GC 1LTXA 2A0ZA 4C2AB 2BEXA 4R5CA 4BV4R 4NKGA 3RGZA 1OOKG 3W3GA 2JE1A 5CMNA 4FDWA 3TSRE 4Y61B 1U0ND 4Q3IA 5GMFA 4LSXA 4R6GA 3WPIA 4U09A 4GT6A 3OGLB 1P8TA 2JQDA 4LI2A 5LFNA 5GQRK 4Q62A 2ASTB 5IJDA 3CIGA 3E6JA 1A9NA 4U08A 4OQTA 3M19A 3WPHA 2WQUA 4R6JA 4NKHA 2OMZA 1K5DC 3A79B 4WYKA 1H6UA 4RCAB 4P91A 3G04C 3SB4A 3WPBA 1IO0A 5IJBA 4RWTC 2P1NB 4H09A 3WPCA 3UL9A 4AW4A 3ZYIA 3O53A 4KNGA 2OMYA 4XOSA 1XEUA 3UN9A 1FT8A 1SQ0B 4WP6A 4QXEA 3OJAA 3RFSA 1W8AA 3VQ1A 2WFHA 2Z63A 3WN4A 2Z7XA 2Y5QA 3ZYNA 2V9SA 2ID5A 2XWTC 1H6TA 4CP6A 3UL7A 4PEQB 4XSQA 2XOTA 5GMGA 4KT1A 4R08A 4Z8GA 3OGMB 4Z61C 4HQ1A 3CIYA 3WPDA 4Z64C 1OTOA 4K17A 1M10B 2JE0A 1QYYA 3C6PB 5AWDA 4Q3GA 3C6NB 3KJ4A 4FHOA 2OMVA 4FD0A 4Z94G 2Z82A 3ULVA 1OGQA 3PMHG 4UFRA 3G3BA 1G9UA 2Z64A 1YRGA 3C6OB 4CNMA 2P1PB 2R9UA 4I6JB 4ARRA 1KOOA 4FCGA 1FS2A 1M0ZA 2Q4GW 3E4GA 4R6FA 4QBZA 1M9SA 3OGKB 1OTNA 4CC4A 2OMXA 1Z7XW 2Z7XB 4V2CA 5GS0A 4R07A 3WPEA 1OZNA 1O6SA 5D3IA 5B0TA 3ULUA 4R0AA 1XKUA 2UZXA 1FQVA 1OTMA 3RFEA 4EZGA 1P8VA 2BNHA 1PGVA 5HDHA 4LSAA 1P9AG 4LSXC 5B4PA 3O6NA 4R58A 3RGXA 2O6SA 4PQ8A 4R09A 1WWLA 1JL5A 5AWBA 3UL8A 3ZYJA 5AZ5A 4CILA 4LI1A 3RW7A 4FS7A 1DS9A 3G39A 4KXFB 4PSJA 5A5CA 4TZHA 2ASSB 3ULAA 2Z65A 4ARNA 4MQWX 3E3ZA 4P8SA 3BZ5A 4LXRA 1XCDA 1KOHA 4R6AA 3W3NA 2Z81A 1ZIWA 3CVRA 3RW6A 3P72A 4B8CD 3W3MA 1M9LA 1A4YA 5AWAA 4BSSA 4R5DA 4XGOA 5HZLB 5GMHA 1DFJI 4MN8B 5FTTB 1DCEA 3VQ2A 3RJ0A 4BSUA 2UZYA 3OJAB 2Z66A 2WQWA 3G3AA 2P1OB 4Z79A 2V9TB 2WQXA 4M7EC 4BSRA 3DZEA 4LXSA 3W3JA 2IFGA 4ECNA 2V70A 5CMPA 1FO1A 4FMZA 4PKIG 4PERA 3E2JA 2CA6A 4ECOA 2Z62A 1O6TA 4GLPA 3ZYOA 5GS2B 4L3FA 2OMUA 1GWBA 2O6RA 5IYXC 2OMTA 5AWCA 3REZA 4J0MA 2OMWA 4QC0A 4L3AA 4V2EA 4J4LA 1D0BA 1XWDC 4AY9X 2ELLA 4U7LA 1O6VA 3G06A 3GOZA 2RA8A 5B0NA 4CNCA 4G8AA 4RCWA 2WQVA 3RFJA 4C2BB
chains in the Genus database with same CATH superfamily
1O75A 1C30A 3K5HA 3MWMA 1GYFA 1WH2A 5KFMA 4YEBB 3FXIA 2FT3A 1K1SA 4UCSA 3U9SA 3WPFA 3JRXA 3RB0A 1HNZH 4U06A 4ECSA 5EDWA 2Y0SA 3M18A 1K5GC 4C5BA 2BEXA 1W96A 2SCUB 2V59A 5KFUA 4FDWA 5BPFA 5GMFA 5D1PA 5FD5A 4DR4H 1KC7A 4DR1H 3LP8A 2VR1A 2JQDA 1XDNA 3PR5B 1GGOA 3H4DA 5GQRK 4Q62A 4UCTA 4QWDA 1A9NA 4C5AA 1JDEA 1DIKA 1HNXH 5FLXW 3V6KA 3T5KA 3MWEA 4NKHA 2NU8B 1UNNC 3KHHA 4QWAA 2YZMA 4RCAB 5D1OB 5KFXA 2YU9A 1HR0H 3I4NG 3SB4A 4UFZA 1FKAH 1ZETA 2HGSA 5KT2A 3WPCA 3UL9A 1DGSA 2CKZB 5KT7A 3UN9A 1XEUA 3N6XA 1FT8A 4O4LF 2R87A 4F4WA 1XMQH 1E4EA 3GLKA 2Q2UA 1HNWH 1SQ0B 2V4RA 2JA6A 4LH6A 2RF4A 2Y5QA 3HB9A 4LF9H 3HOWG 4CP6A 3UL7A 4PEQB 2UVVA 4J9KA 4YR2A 2FJZA 1IBLH 3EPGA 2W7PA 3GV7B 2W6PA 4R08A 4X62H 5J2UF 2R84A 3RTXA 5KFFA 1FJGH 2GPSA 2W9CA 3RFCA 4BXXG 1OTOA 5L1KA 1Y1VA 4A3LG 1M10B 1RYRA 1Y1WG 1QYYA 5AWDA 2NVYA 1Y14B 4Q44A 4IRDA 2OWOA 3KJ4A 4FHOA 1CQIB 5KG7A 4Z94G 1BNCA 2PBZA 3PMHG 2FB9A 3G3BA 2JEGA 4ED6A 1KJIA 1BGWA 2FPIB 5KFCA 4DL4A 5KFNA 3KHRA 2P1PB 5KFTA 3Q8PB 3KHLA 3ETJA 4U6PA 3L4JA 1N56A 5KG5A 4ED3A 2Q4GW 4QBZA 2UXCH 4FM9A 4UCUA 4YJ3F 4MV3A 1OTNA 2OMXA 4CC6A 1DV2A 1CE8A 4V2CA 2RGVA 1OZNA 5H80A 5FPRA 3PW2A 5D3IA 2AGQA 3ULUA 2C35B 1XKUA 1A9XA 2UZXA 4JI1H 5KFDA 4AYBE 1BXRA 1JX4A 5CAEB 5LOVF 2FLLA 4EZGA 4DV5H 1P8VA 1PGVA 2UUAH 3VPDA 4I4TF 4ED7A 2W9CB 3TQTA 1CQJB 5AWBA 2J6SA 1IBMH 2R7MA 2WYOA 4YR3A 4J9NA 4LFBH 3H20A 4LI1A 5BMVF 1R9TA 3I4MG 2DIKA 4A3IG 4DR2H 3G39A 4KXFB 3BQ1A 3OHAA 4QIWA 2R8IA 1S68A 3H40A 4B3SH 1J5EH 2ASSB 2Z65A 2R92A 2FK1A 2AQ4A 4LF6H 3MR2A 3BZ5A 4LXRA 1XCDA 3N41B 1JIHA 3W3NA 4JV0A 4DR6H 3P72A 3OUUA 1M9LA 3BA9A 2BQRA 1I94H 5AWAA 2B63G 1ZHQA 1KJQA 3MWDA 1N48A 5KFSA 1DFJI 4EGQA 4TUYF 3FDSA 4EG0A 1UC9A 4DV4H 1Z2PX 2I87A 2FK2A 2R93A 4BSUA 4O3OA 2ZM6H 3BJYA 2WQWA 1KEEA 3SI8A 4Z79A 4ECWA 2ZDQA 4LXSA 2FMAA 3HBLA 4UCRA 4TV8F 5KG2A 1KBLA 4ED0A 4RUCA 2FP4B 5KFKA 2PVPA 4LMYA 1T3NA 2W57A 4PKIG 3Q8QB 3ORRA 3E2JA 2AGOA 2CA6A 4RAZA 3FMAA 4ECOA 2XCAA 1RK5A 4EYHB 1GSAA 4IHJF 2CZGA 3L2PA 2OMWA 3MFIA 1SEIA 2V58A 1VS0A 4YQWA 4IZOA 3DF7A 4J9MA 4MV8A 4J9RA 4G8AA 5KG3A 1UC8A 4C2BB 2XC9A 2V4QA 2R7LA 1V51A 3N44B 3W3LA 2RR6A 3W3KA 5L9XA 2XGPA 2VPQA 4CC4C 2R8JA 3H0GG 4ECQA 3PW4A 5KG1A 3WPGA 5IJCA 4IRKA 2J6UA 3L4KA 4HYKA 1EHIA 4Q45A 4EEQA 5LMNH 4GC6A 2P1MB 4IM6A 3RV3A 1GO3E 1A0IA 4I55F 4C2AB 4BV4R 4NKGA 3RGZA 3BQ0A 1OOKG 2JE1A 4Y61B 2R86A 4A3KG 2O03A 2R7ZA 2Y0SE 2HJWA 4U09A 2RDIA 3Q2OA 4DUZH 4HNVA 4LI2A 1N33H 3RAQA 1XMOH 3R23A 2ASTB 3CIGA 3E6JA 4G3IA 3KHGA 1B04A 1GSOA 1I50A 3M19A 3TIIA 2WQUA 2OMZA 1K5DC 3RAXA 3A79B 4LFAH 3QFFA 4A3FG 3F8NA 1H6UA 5DQGA 4P91A 2F4VH 5IJBA 2W9BA 2DPJA 4NXMH 3SE7A 4H09A 4IRCA 3O53A 3VPBA 5L1IA 3G8CA 5KFZA 3BA8A 1IOWA 4F4XA 5JH7F 4QXEA 3OJAA 4ED1A 4DV6H 2W6MA 3RFSA 2WFHA 2Z63A 2OH2A 4ECXA 1I7NA 4ECZA 2CQYA 2NU9B 3ZYNA 3LWBA 4RNNA 5KFEA 4R7RA 2WAQE 1EUCB 5DGAA 4DV7H 2RGRA 3VPCA 3NGDA 4Q0YA 4XSQA 4HQ1A 3WPDA 4X66H 2HVRA 4TQRA 4Z64C 2PMZE 2VUMG 3FKIA 4K17A 4L1KA 4GKJH 4Q3GA 3C6NB 3K5IA 3Q8RB 3OUZA 3GTLA 3EPIA 2FKLA 1CS0A 3ULVA 5DLFA 4MV6A 1I3QA 5DQHA 4LF8H 4UFRA 5LA6F 1KJ9A 4APMA 4YP3A 4MAMA 4EBDA 5K2MA 1S0NA 4CNMA 4NZTM 4DL7A 4ARRA 1FS2A 4QWCA 3E4GA 4FS1A 1M9SA 4A93G 4CC4A 2QYZA 3OTOH 2J9GA 4A2BA 4F50A 2BQUA 3LMLA 1TAEA 5EWEA 2XIGA 4Q8EA 2V9WA 4R0AA 3KAKA 1FQVA 1TWFA 2VPSA 3RFEA 2RDJA 2VA3A 2JA5G 5KFLA 1E4GT 2I8CA 5HDHA 5IP9G 3E5NA 4LSXC 3HOYG 5B4PA 3O6NA 5FPOA 1EYZA 2YZGA 1WWLA 1JL5A 2E2IA 3UL8A 4WBNF 5AZ5A 1SFOA 4MTEA 1M0WA 3MR6A 2ZDGA 4Q8FA 4FS7A 1DS9A 4PSJA 5D8DA 3HXLA 3GV8B 2ASLA 4ARNA 2MCTA 4MQWX 5IYCG 4O2BF 3R5FA 1ZHSA 1WR2A 1RK6A 4QIWE 2OLSA 1TA8A 4EEYA 3K3VA 3GIIA 3W3MA 2XD4A 1JKJB 1A4YA 4XGOA 1JLLB 5IYZF 5GMHA 2JEJA 2CW7A 3RB4A 1K83A 4JYAH 2FPGB 1S97A 5KFGA 3VQ2A 1IOVA 1E4EB 5LYJF 1XNQH 5GONF 2XCLA 5KFPA 2Z66A 2P0AA 2P1OB 4ECRA 4BBSG 3DZEA 3W3JA 3JAMW 4DV3H 2C00A 3GV5B 4ECNA 5FJ8G 5KFQA 1WSCA 2W7OA 5CMPA 3WO0A 4IR9A 5KFYA 2BQ3A 2Z62A 4GLPA 3ZYOA 5GS2B 2OMUA 2R93G 5IWAH 4IWXA 3AYHB 2R8KA 5AWCA 3REZA 3GTMA 4L3AA 5BPHA 3BQ2A 1EZ1A 2JEIA 4EFBA 4U7LA 1VAJA 1S0OA 5CA0F 3GOZA 2RA8A 4O4HF 4ECYA 3T5HA 1VBHA 2WQVA 4LF5H 3JSNA 3ETHA 4JI7H 1ULZA 3GTKA 2Q2TA 2M05A 2VA2A 1V4YA 3HOVG 3RIZA 4JV1A 3JB9j 2FPPB 4V2DA 4RUAA 5J2TF 2XCPA 5KFRA 1L2ZA 4JI2H 2O6QA 3JRWA 1LTXA 1Z2OX 3Q8SB 2A0ZA 5KFBA 4RB2C 3W3GA 3TINA 3TSRE 1U0ND 5KFJA 4LSXA 4R6GA 4O2AF 3WPIA 2VOBA 5LFNA 2R6FA 3GTQA 4Q43A 2W8LA 1WCMA 4U08A 4RNOA 3WPHA 4EGJA 3H3VH 3N40P 4R6JA 1FVIA 2C2EA 4WYKA 4A3BG 4BWSC 2R7ZG 3WO1A 3GTGA 2FE3A 2R8GA 3G04C 5LXTF 3VMMA 1IO0A 4DL3A 2P1NB 3UFXB 4O3RA 3ZYIA 1TWAA 2OMYA 4XOSA 4O3PA 5C5JA 5KFOA 2VQDA 4JI3H 3PO2G 3N43B 2KSWA 4J9SA 2ASJA 2R7KA 2R8HA 3GIMA 5LP6F 3VQ1A 3PZPA 3WN4A 2Z7XA 2UVUA 2AGPA 2V9SA 5IT9W 1S0MA 4U7CA 4LFCH 1H6TA 5LL6b 4X64H 3HKZA 2YL2A 2ATLA 4RZQA 1I6UA 3M4IA 4JI0H 2XOTA 3HOZG 3GTJA 2ASDA 3OGMB 1GLVA 3CIYA 3C0FB 1S9FA 1JXLA 3V4ZA 4LH7A 2W6ZA 4IWYA 3J80W 3UQ8A 4DR5H 4O3SA 3TIGA 3BABA 2IA6A 2OMVA 3OHBA 1OGQA 2YCHA 4DR7H 2GPWA 2W9AA 1M7JA 1S10A 5F9NA 1N32H 2YZNA 4A3GG 2YW2A 3V4SA 4JI4H 2R9UA 5JVDF 4IAJA 1KOOA 4FCGA 4DUYH 4FBUA 3OSNA 3N42B 2XGQA 3OGKB 1Z7XW 2Z7XB 1ZQ7A 4RZRA 5B0TA 2JA7A 4LF4H 4YBZB 1EUDB 1N34H 3OSPA 2HVQA 2V5AA 4UCOA 4WD3A 4QWBA 2IBKA 4OX9H 2BNHA 5EWFA 4LSAA 2NUAB 4RU9A 1KJJA 4DL6A 1M0TA 3RGXA 3H0GA 5JVLA 5KG0A 2WB1A 3RBEA 2DLNA 4A3JG 2C2RA 5KFIA 4A3DG 4DL2A 1XNRH 4YHHH 2JA6G 2W6NA 4TZHA 4YR0A 3ULAA 5L1JA 2NU7B 3GIJA 2UUBH 4BY1G 4MV4A 2UVRA 4ZOLF 3T1HH 1M6VA 2W70A 1OWTA 2UXBH 3J81W 2Z81A 4JV2A 1AUXA 4YY3H 3G6XA 4B8CD 5C1OA 2FLPA 4R5DA 2X0SA 4EBCA 2W9BB 1IBKH 1V9PA 4EBEA 5DG7A 4M9UA 4MN8B 1Y1VG 5FTTB 3JZIA 2YRXA 4DV2H 4YAKB 3PN1A 3RJ0A 3V6HA 4ZI7F 3OJAB 4ZQIA 2UZYA 5KT3A 1TWCA 5KFAA 3IN5A 2WQXA 4A3CG 4I7HA 4JI8H 2R82A 2DZDA 3K3PA 1B6RA 3QZ8A 4GKKH 1W93A 2IFGA 2V70A 4ED8A 2ALZA 4DV0H 1FO1A 5FD6A 3KXYT 4PERA 3KALA 2UXDH 1Z2NX 4I50F 1VBGA 4BBRG 5KFHA 4ME6A 1GWBA 2O6RA 3N8DA 2W6QA 2ZDHA 4V2EA 5DG9A 5C8YF 1PX2A 1D0BA 1XWDC 2WAQA 4MA5A 3RBDA 3PR4A 2HHHH 1O6VA 2VUMA 5C1PA 2CW8A 4CNCA 4QW9A 5HV6A 3RFJA 4E4TA 4ECVA 4O3QA 5EZYF 2PMZA 2E5LH 5DQIA 4RB0A 5KT6A 2NVXA 4Y8VB 4YJ2F 4M7EA 4LSCA 4DL5A 2P1QB 1XECA 3M9MB 4BY7G 4GLXA 1C3OA 2GLTA 2VQFH 2IMWP 3V6JA 2YRWA 4R5CA 1AN7A 3GIQA 2VQEH 1RJPA 5CMNA 4Q3IA 3CVZA 3G6VA 4YB8B 1I7LA 4GT6A 2R92G 3OGLB 1P8TA 4TV9F 4IR1A 3ORQA 4FBTA 5IJDA 3U9TA 1KJ8A 3RF2A 3MJFA 4OQTA 2JA5A 3PW5A 3T1YH 3GQCA 1B33N 4A3EG 2DWCA 1P8LA 4QJFA 3WPBA 4RWTC 2JEFA 4AW4A 1X9NA 4KNGA 3HOUG 4XX0B 4GC7A 2YYAA 1WCMG 4KHPH 4DV1H 4WP6A 5L1LA 1DV1A 4XYMB 4NZRM 3R5HA 1B6SA 1W8AA 3RB6A 3H4BA 1Y1WA 5IYBG 4MTDA 1TWHA 4J9LA 5FLMG 4MV9A 2ID5A 2XWTC 5C44G 1N36H 4XYLB 4JUZA 3GIPA 3J7AK 4RB1A 2YS6A 4FU0A 5GMGA 4B3MH 4KT1A 2DPIA 4Z8GA 4Z61C 4QWEA 4CC5A 5F9LA 3HKZE 4X65H 4TQSA 5IP7G 2W71A 2IP4A 2WDTA 2JE0A 4MA0A 3C6PB 1E4FT 4A2AA 5HBRB 3PW0A 4FD0A 2J6TA 5JQWA 4C5CA 2Z82A 3MR5A 1BJTA 2W6OA 4HQ6A 3T5LA 4DR3H 2JA8G 3GIDA 3M9NB 2FLNA 1G9UA 1YRGA 2Z64A 3I12A 4ZHQF 3C6OB 4ED2A 3M9OB 4I6JB 1M0ZA 5A2QW 4O4IF 4R6FA 2BR0A 3EYYA 5KFVA 4AYBA 1SCUB 4PWQA 4YAJB 3PVXA 5GS0A 4R8UA 4R07A 2AU0A 3WPEA 1O6SA 5KG6A 5KFWA 5T14A 3MR3A 1OTMA 3KAJA 2UVWA 4HR7A 1RJQA 1P9AG 2UUCH 2WTFA 4ECUA 5IYDG 4A3MG 4B3RH 4R58A 3HOXG 2O6SA 5DG8A 4PQ8A 4R09A 2WE6A 3GILA 3ZYJA 5C3EG 3Q1KA 5C4XG 4K0KH 4CILA 3RW7A 2JA7G 2NU6B 3WNZA 2I80A 3BAAA 1K1QA 4RB3C 4RAYA 4LF7H 2WB1E 3G6YA 2B63A 5LMUH 5A5CA 3JSLA 1MZBA 2E2HA 2YS7A 3PO3G 2VUGA 5DGBA 3RV4A 3E3ZA 4PDBA 4P8SA 3RUPA 1T94A 2FK3A 1KOHA 4R6AA 2QK4A 4JV5H 3TQ1A 4JI6H 5EOYA 1ZIWA 3CVRA 3RW6A 4C2MA 5CB4F 4NLGA 4F4ZA 4UCVA 4BSSA 5KX5F 4R8UB 1T36A 5HZLB 4NXNH 3FKIG 4MV7A 3RB3A 2C22A 4ETSA 1DCEA 2R7NA 4QW8A 5I47A 5DLGA 3T5JA 1S03G 1SYXB 1GSHA 4MV1A 5KKNB 2PN1A 3GTPA 4J9QA 3G3AA 2V9TB 4HNUA 4EFEA 1TWGA 4M7EC 4BSRA 3R5XA 5CA1F 2HVSA 1RJRA 3IG0A 4B3TH 5EWGA 4J9PA 4O3NA 5KG4A 2ZJTA 2C2DA 2R85A 5KT4A 4FMZA 1RYSA 3CQZA 4AQYH 4JI5H 1O6TA 3KTMA 4FS2A 4XZ3B 4L3FA 1JDBB 5IYXC 2OMTA 4J0MA 4DLKA 3PW7A 4QC0A 4J4LA 2C28A 4AY9X 1AUVA 3QZ7A 2ELLA 3MFHA 5BR8H 5D1OA 2W8KA 3G06A 1VKZA 5B0NA 1PK8A 3GIKA 4HNTA 3GTOA 4RCWA 2UU9H 4J9OA 5JUMA 4EYIB 4RNMA 4F4YA 5KT5A 3BG5A 4ECTA
chains in the Genus database with same CATH topology
3W3LA 2RR6A 3W3KA 2E5LH 1O75A 2Q2TA 3MWMA 1GYFA 1WH2A 4RB0A 4CC4C 4YEBB 3FXIA 3WPGA 2FT3A 4M7EA 5IJCA 3RIZA 4UCSA 3L4KA 3JB9j 4LSCA 3WPFA 2P1QB 4EEQA 4V2DA 1HNZH 5LMNH 4U06A 1XECA 1L2ZA 4JI2H 2O6QA 4GLXA 2P1MB 4IM6A 3M18A 1K5GC 1LTXA 1Z2OX 2VQFH 2A0ZA 1A0IA 4C2AB 2BEXA 4R5CA 4RB2C 4BV4R 1AN7A 4NKGA 3RGZA 2VQEH 1OOKG 3W3GA 2JE1A 5CMNA 4FDWA 3TSRE 4Y61B 1U0ND 4Q3IA 5GMFA 5D1PA 2O03A 5FD5A 4LSXA 3CVZA 4R6GA 3WPIA 4DR4H 4DR1H 4U09A 4GT6A 3OGLB 2VOBA 1P8TA 2JQDA 1XDNA 4DUZH 4LI2A 1N33H 5LFNA 1XMOH 5GQRK 4Q62A 4UCTA 2ASTB 5IJDA 3CIGA 3E6JA 1A9NA 1B04A 3RF2A 4U08A 4OQTA 3M19A 3WPHA 1HNXH 5FLXW 2WQUA 3N40P 4R6JA 4NKHA 1FVIA 3T1YH 2OMZA 1K5DC 3A79B 4LFAH 4WYKA 4BWSC 1P8LA 3F8NA 1H6UA 2FE3A 4RCAB 4P91A 5D1OB 3G04C 1HR0H 3SB4A 4UFZA 1FKAH 3WPBA 1IO0A 2F4VH 5IJBA 4RWTC 4NXMH 2HGSA 2P1NB 4H09A 3WPCA 3UL9A 4AW4A 3ZYIA 1DGSA 1X9NA 3O53A 4KNGA 2OMYA 4XOSA 1XEUA 3UN9A 3N6XA 1FT8A 4JI3H 2KSWA 3N43B 3BA8A 1XMQH 2Q2UA 1HNWH 4DV1H 4KHPH 1SQ0B 4WP6A 4QXEA 3OJAA 4DV6H 3RFSA 1W8AA 3VQ1A 4LH6A 2WFHA 2Z63A 3WN4A 2Z7XA 2Y5QA 4LF9H 3ZYNA 2V9SA 4MTDA 5IT9W 4MV9A 2ID5A 4R7RA 2XWTC 4LFCH 1H6TA 4DV7H 4CP6A 5LL6b 2RGRA 3UL7A 4X64H 4PEQB 1N36H 1IBLH 4Q0YA 4RZQA 4XSQA 1I6UA 3M4IA 4JI0H 3J7AK 4RB1A 2XOTA 5GMGA 4B3MH 4KT1A 4R08A 4X62H 4Z8GA 3OGMB 4Z61C 4HQ1A 3CIYA 3WPDA 3RTXA 4CC5A 4X66H 2HVRA 4Z64C 3C0FB 1FJGH 4X65H 1OTOA 4K17A 1M10B 2WDTA 4LH7A 2JE0A 1QYYA 3C6PB 4GKJH 5AWDA 1E4FT 4Q3GA 3C6NB 3J80W 3UQ8A 4A2AA 2OWOA 4DR5H 3KJ4A 4FHOA 3BABA 2OMVA 4FD0A 4Z94G 2Z82A 3ULVA 1BJTA 1OGQA 2YCHA 3PMHG 4LF8H 4DR7H 4UFRA 3G3BA 4DR3H 4APMA 1BGWA 1G9UA 2Z64A 1YRGA 1N32H 3C6OB 4CNMA 2P1PB 4JI4H 2R9UA 4IAJA 4I6JB 4ARRA 1KOOA 4FCGA 1FS2A 4DUYH 1M0ZA 5A2QW 3L4JA 2Q4GW 3E4GA 3N42B 4R6FA 4QBZA 1M9SA 3EYYA 2UXCH 4FM9A 3OGKB 4UCUA 1OTNA 4CC4A 2OMXA 4CC6A 3OTOH 1Z7XW 4A2BA 2Z7XB 4V2CA 5GS0A 4R07A 3LMLA 2RGVA 1TAEA 3WPEA 1OZNA 1O6SA 2XIGA 5FPRA 5D3IA 5B0TA 3ULUA 4R0AA 1XKUA 3KAKA 4LF4H 2UZXA 1N34H 4JI1H 1FQVA 1OTMA 2VPSA 3RFEA 4EZGA 2HVQA 3KAJA 4DV5H 1P8VA 4UCOA 1E4GT 4OX9H 2BNHA 1PGVA 5HDHA 2UUAH 4LSAA 1P9AG 2UUCH 4LSXC 5B4PA 4B3RH 3O6NA 1M0TA 4R58A 5FPOA 3RGXA 2O6SA 4PQ8A 4R09A 1WWLA 1JL5A 2WE6A 5AWBA 3UL8A 3ZYJA 5AZ5A 1IBMH 2WYOA 4K0KH 4LFBH 4CILA 3H20A 4MTEA 4LI1A 3RW7A 1M0WA 4FS7A 3BAAA 4RB3C 4RAYA 1DS9A 4DR2H 4LF7H 1XNRH 3G39A 4YHHH 5LMUH 4KXFB 4PSJA 5A5CA 1S68A 1MZBA 3JSLA 3HXLA 4TZHA 4B3SH 1J5EH 2ASSB 3ULAA 2Z65A 4ARNA 2VUGA 2MCTA 2UUBH 4MQWX 3E3ZA 4LF6H 4PDBA 3T1HH 4P8SA 1ZHSA 3BZ5A 4LXRA 1XCDA 2UXBH 1KOHA 3N41B 4R6AA 4JV5H 3J81W 4JI6H 5EOYA 3W3NA 2Z81A 1ZIWA 1TA8A 3K3VA 3CVRA 4YY3H 3RW6A 4DR6H 3P72A 4B8CD 3W3MA 1M9LA 3BA9A 1I94H 1A4YA 5AWAA 4UCVA 4BSSA 1ZHQA 4R5DA 4XGOA 1IBKH 1V9PA 5HZLB 4NXNH 5GMHA 4MV7A 1DFJI 4MN8B 5FTTB 4ETSA 1DCEA 2CW7A 4DV2H 4JYAH 4DV4H 3VQ2A 1S03G 1SYXB 1Z2PX 3PN1A 3RJ0A 1XNQH 4BSUA 2ZM6H 2UZYA 3OJAB 2Z66A 2WQWA 3G3AA 2P1OB 4Z79A 2V9TB 2WQXA 4EFEA 4I7HA 4JI8H 4M7EC 4BSRA 3DZEA 4LXSA 2HVSA 3W3JA 3IG0A 3JAMW 4DV3H 4GKKH 4UCRA 4B3TH 2IFGA 4ECNA 2V70A 2ZJTA 5CMPA 4DV0H 4LMYA 1FO1A 2W57A 4FMZA 4PKIG 5FD6A 3KXYT 4PERA 3E2JA 2CA6A 4AQYH 3KALA 4RAZA 3FMAA 4ECOA 2UXDH 4JI5H 2Z62A 1Z2NX 1O6TA 4GLPA 3ZYOA 5GS2B 4L3FA 2OMUA 1GWBA 5IWAH 3L2PA 2O6RA 5IYXC 2OMTA 5AWCA 3REZA 4J0MA 2OMWA 4QC0A 1SEIA 4L3AA 4J4LA 4V2EA 1D0BA 1XWDC 4AY9X 1VS0A 4EFBA 2ELLA 4U7LA 5BR8H 5D1OA 3DF7A 2HHHH 1O6VA 3G06A 3GOZA 2RA8A 5B0NA 2CW8A 4CNCA 4G8AA 4RCWA 2UU9H 2WQVA 3RFJA 4C2BB 4LF5H 3JSNA 4JI7H 3N44B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W3L A;  2RR6 A;  3W3K A;  4CC4 C;  4YEB B;  3FXI A;  3WPG A;  2FT3 A;  4M7E A;  5IJC A;  3RIZ A;  3JB9 j;  4LSC A;  3WPF A;  2P1Q B;  4V2D A;  4U06 A;  1XEC A;  2O6Q A;  2P1M B;  4IM6 A;  3M18 A;  1K5G C;  1LTX A;  2A0Z A;  4C2A B;  2BEX A;  4R5C A;  4BV4 R;  4NKG A;  3RGZ A;  1OOK G;  3W3G A;  2JE1 A;  5CMN A;  4FDW A;  3TSR E;  4Y61 B;  1U0N D;  4Q3I A;  5GMF A;  4LSX A;  4R6G A;  3WPI A;  4U09 A;  4GT6 A;  3OGL B;  1P8T A;  2JQD A;  4LI2 A;  5LFN A;  5GQR K;  4Q62 A;  2AST B;  5IJD A;  3CIG A;  3E6J A;  1A9N A;  4U08 A;  4OQT A;  3M19 A;  3WPH A;  2WQU A;  4R6J A;  4NKH A;  2OMZ A;  1K5D C;  3A79 B;  4WYK A;  1H6U A;  4RCA B;  4P91 A;  3G04 C;  3SB4 A;  3WPB A;  1IO0 A;  5IJB A;  4RWT C;  2P1N B;  4H09 A;  3WPC A;  3UL9 A;  4AW4 A;  3ZYI A;  3O53 A;  4KNG A;  2OMY A;  4XOS A;  1XEU A;  3UN9 A;  1FT8 A;  1SQ0 B;  4WP6 A;  4QXE A;  3OJA A;  3RFS A;  1W8A A;  3VQ1 A;  2WFH A;  2Z63 A;  3WN4 A;  2Z7X A;  2Y5Q A;  3ZYN A;  2V9S A;  2ID5 A;  2XWT C;  1H6T A;  4CP6 A;  3UL7 A;  4PEQ B;  4XSQ A;  2XOT A;  5GMG A;  4KT1 A;  4R08 A;  4Z8G A;  3OGM B;  4Z61 C;  4HQ1 A;  3CIY A;  3WPD A;  4Z64 C;  1OTO A;  4K17 A;  1M10 B;  2JE0 A;  1QYY A;  3C6P B;  5AWD A;  4Q3G A;  3C6N B;  3KJ4 A;  4FHO A;  2OMV A;  4FD0 A;  4Z94 G;  2Z82 A;  3ULV A;  1OGQ A;  3PMH G;  4UFR A;  3G3B A;  1G9U A;  2Z64 A;  1YRG A;  3C6O B;  4CNM A;  2P1P B;  2R9U A;  4I6J B;  4ARR A;  1KOO A;  4FCG A;  1FS2 A;  1M0Z A;  2Q4G W;  3E4G A;  4R6F A;  4QBZ A;  1M9S A;  3OGK B;  1OTN A;  4CC4 A;  2OMX A;  1Z7X W;  2Z7X B;  4V2C A;  5GS0 A;  4R07 A;  3WPE A;  1OZN A;  1O6S A;  5D3I A;  5B0T A;  3ULU A;  4R0A A;  1XKU A;  2UZX A;  1FQV A;  1OTM A;  3RFE A;  4EZG A;  1P8V A;  2BNH A;  1PGV A;  5HDH A;  4LSA A;  1P9A G;  4LSX C;  5B4P A;  3O6N A;  4R58 A;  3RGX A;  2O6S A;  4PQ8 A;  4R09 A;  1WWL A;  1JL5 A;  5AWB A;  3UL8 A;  3ZYJ A;  5AZ5 A;  4CIL A;  4LI1 A;  3RW7 A;  4FS7 A;  1DS9 A;  3G39 A;  4KXF B;  4PSJ A;  5A5C A;  4TZH A;  2ASS B;  3ULA A;  2Z65 A;  4ARN A;  4MQW X;  3E3Z A;  4P8S A;  3BZ5 A;  4LXR A;  1XCD A;  1KOH A;  4R6A A;  3W3N A;  2Z81 A;  1ZIW A;  3CVR A;  3RW6 A;  3P72 A;  4B8C D;  3W3M A;  1M9L A;  1A4Y A;  5AWA A;  4BSS A;  4R5D A;  4XGO A;  5HZL B;  5GMH A;  1DFJ I;  4MN8 B;  5FTT B;  1DCE A;  3VQ2 A;  3RJ0 A;  4BSU A;  2UZY A;  3OJA B;  2Z66 A;  2WQW A;  3G3A A;  2P1O B;  4Z79 A;  2V9T B;  2WQX A;  4M7E C;  4BSR A;  3DZE A;  4LXS A;  3W3J A;  2IFG A;  4ECN A;  2V70 A;  5CMP A;  1FO1 A;  4FMZ A;  4PKI G;  4PER A;  3E2J A;  2CA6 A;  4ECO A;  2Z62 A;  1O6T A;  4GLP A;  3ZYO A;  5GS2 B;  4L3F A;  2OMU A;  1GWB A;  2O6R A;  5IYX C;  2OMT A;  5AWC A;  3REZ A;  4J0M A;  2OMW A;  4QC0 A;  4L3A A;  4V2E A;  4J4L A;  1D0B A;  1XWD C;  4AY9 X;  2ELL A;  4U7L A;  1O6V A;  3G06 A;  3GOZ A;  2RA8 A;  5B0N A;  4CNC A;  4G8A A;  4RCW A;  2WQV A;  3RFJ A;  4C2B B; 
#chains in the Genus database with same CATH topology
 1O75 A;  1C30 A;  3K5H A;  3MWM A;  1GYF A;  1WH2 A;  5KFM A;  4YEB B;  3FXI A;  2FT3 A;  1K1S A;  4UCS A;  3U9S A;  3WPF A;  3JRX A;  3RB0 A;  1HNZ H;  4U06 A;  4ECS A;  5EDW A;  2Y0S A;  3M18 A;  1K5G C;  4C5B A;  2BEX A;  1W96 A;  2SCU B;  2V59 A;  5KFU A;  4FDW A;  5BPF A;  5GMF A;  5D1P A;  5FD5 A;  4DR4 H;  1KC7 A;  4DR1 H;  3LP8 A;  2VR1 A;  2JQD A;  1XDN A;  3PR5 B;  1GGO A;  3H4D A;  5GQR K;  4Q62 A;  4UCT A;  4QWD A;  1A9N A;  4C5A A;  1JDE A;  1DIK A;  1HNX H;  5FLX W;  3V6K A;  3T5K A;  3MWE A;  4NKH A;  2NU8 B;  1UNN C;  3KHH A;  4QWA A;  2YZM A;  4RCA B;  5D1O B;  5KFX A;  2YU9 A;  1HR0 H;  3I4N G;  3SB4 A;  4UFZ A;  1FKA H;  1ZET A;  2HGS A;  5KT2 A;  3WPC A;  3UL9 A;  1DGS A;  2CKZ B;  5KT7 A;  3UN9 A;  1XEU A;  3N6X A;  1FT8 A;  4O4L F;  2R87 A;  4F4W A;  1XMQ H;  1E4E A;  3GLK A;  2Q2U A;  1HNW H;  1SQ0 B;  2V4R A;  2JA6 A;  4LH6 A;  2RF4 A;  2Y5Q A;  3HB9 A;  4LF9 H;  3HOW G;  4CP6 A;  3UL7 A;  4PEQ B;  2UVV A;  4J9K A;  4YR2 A;  2FJZ A;  1IBL H;  3EPG A;  2W7P A;  3GV7 B;  2W6P A;  4R08 A;  4X62 H;  5J2U F;  2R84 A;  3RTX A;  5KFF A;  1FJG H;  2GPS A;  2W9C A;  3RFC A;  4BXX G;  1OTO A;  5L1K A;  1Y1V A;  4A3L G;  1M10 B;  1RYR A;  1Y1W G;  1QYY A;  5AWD A;  2NVY A;  1Y14 B;  4Q44 A;  4IRD A;  2OWO A;  3KJ4 A;  4FHO A;  1CQI B;  5KG7 A;  4Z94 G;  1BNC A;  2PBZ A;  3PMH G;  2FB9 A;  3G3B A;  2JEG A;  4ED6 A;  1KJI A;  1BGW A;  2FPI B;  5KFC A;  4DL4 A;  5KFN A;  3KHR A;  2P1P B;  5KFT A;  3Q8P B;  3KHL A;  3ETJ A;  4U6P A;  3L4J A;  1N56 A;  5KG5 A;  4ED3 A;  2Q4G W;  4QBZ A;  2UXC H;  4FM9 A;  4UCU A;  4YJ3 F;  4MV3 A;  1OTN A;  2OMX A;  4CC6 A;  1DV2 A;  1CE8 A;  4V2C A;  2RGV A;  1OZN A;  5H80 A;  5FPR A;  3PW2 A;  5D3I A;  2AGQ A;  3ULU A;  2C35 B;  1XKU A;  1A9X A;  2UZX A;  4JI1 H;  5KFD A;  4AYB E;  1BXR A;  1JX4 A;  5CAE B;  5LOV F;  2FLL A;  4EZG A;  4DV5 H;  1P8V A;  1PGV A;  2UUA H;  3VPD A;  4I4T F;  4ED7 A;  2W9C B;  3TQT A;  1CQJ B;  5AWB A;  2J6S A;  1IBM H;  2R7M A;  2WYO A;  4YR3 A;  4J9N A;  4LFB H;  3H20 A;  4LI1 A;  5BMV F;  1R9T A;  3I4M G;  2DIK A;  4A3I G;  4DR2 H;  3G39 A;  4KXF B;  3BQ1 A;  3OHA A;  4QIW A;  2R8I A;  1S68 A;  3H40 A;  4B3S H;  1J5E H;  2ASS B;  2Z65 A;  2R92 A;  2FK1 A;  2AQ4 A;  4LF6 H;  3MR2 A;  3BZ5 A;  4LXR A;  1XCD A;  3N41 B;  1JIH A;  3W3N A;  4JV0 A;  4DR6 H;  3P72 A;  3OUU A;  1M9L A;  3BA9 A;  2BQR A;  1I94 H;  5AWA A;  2B63 G;  1ZHQ A;  1KJQ A;  3MWD A;  1N48 A;  5KFS A;  1DFJ I;  4EGQ A;  4TUY F;  3FDS A;  4EG0 A;  1UC9 A;  4DV4 H;  1Z2P X;  2I87 A;  2FK2 A;  2R93 A;  4BSU A;  4O3O A;  2ZM6 H;  3BJY A;  2WQW A;  1KEE A;  3SI8 A;  4Z79 A;  4ECW A;  2ZDQ A;  4LXS A;  2FMA A;  3HBL A;  4UCR A;  4TV8 F;  5KG2 A;  1KBL A;  4ED0 A;  4RUC A;  2FP4 B;  5KFK A;  2PVP A;  4LMY A;  1T3N A;  2W57 A;  4PKI G;  3Q8Q B;  3ORR A;  3E2J A;  2AGO A;  2CA6 A;  4RAZ A;  3FMA A;  4ECO A;  2XCA A;  1RK5 A;  4EYH B;  1GSA A;  4IHJ F;  2CZG A;  3L2P A;  2OMW A;  3MFI A;  1SEI A;  2V58 A;  1VS0 A;  4YQW A;  4IZO A;  3DF7 A;  4J9M A;  4MV8 A;  4J9R A;  4G8A A;  5KG3 A;  1UC8 A;  4C2B B;  2XC9 A;  2V4Q A;  2R7L A;  1V51 A;  3N44 B;  3W3L A;  2RR6 A;  3W3K A;  5L9X A;  2XGP A;  2VPQ A;  4CC4 C;  2R8J A;  3H0G G;  4ECQ A;  3PW4 A;  5KG1 A;  3WPG A;  5IJC A;  4IRK A;  2J6U A;  3L4K A;  4HYK A;  1EHI A;  4Q45 A;  4EEQ A;  5LMN H;  4GC6 A;  2P1M B;  4IM6 A;  3RV3 A;  1GO3 E;  1A0I A;  4I55 F;  4C2A B;  4BV4 R;  4NKG A;  3RGZ A;  3BQ0 A;  1OOK G;  2JE1 A;  4Y61 B;  2R86 A;  4A3K G;  2O03 A;  2R7Z A;  2Y0S E;  2HJW A;  4U09 A;  2RDI A;  3Q2O A;  4DUZ H;  4HNV A;  4LI2 A;  1N33 H;  3RAQ A;  1XMO H;  3R23 A;  2AST B;  3CIG A;  3E6J A;  4G3I A;  3KHG A;  1B04 A;  1GSO A;  1I50 A;  3M19 A;  3TII A;  2WQU A;  2OMZ A;  1K5D C;  3RAX A;  3A79 B;  4LFA H;  3QFF A;  4A3F G;  3F8N A;  1H6U A;  5DQG A;  4P91 A;  2F4V H;  5IJB A;  2W9B A;  2DPJ A;  4NXM H;  3SE7 A;  4H09 A;  4IRC A;  3O53 A;  3VPB A;  5L1I A;  3G8C A;  5KFZ A;  3BA8 A;  1IOW A;  4F4X A;  5JH7 F;  4QXE A;  3OJA A;  4ED1 A;  4DV6 H;  2W6M A;  3RFS A;  2WFH A;  2Z63 A;  2OH2 A;  4ECX A;  1I7N A;  4ECZ A;  2CQY A;  2NU9 B;  3ZYN A;  3LWB A;  4RNN A;  5KFE A;  4R7R A;  2WAQ E;  1EUC B;  5DGA A;  4DV7 H;  2RGR A;  3VPC A;  3NGD A;  4Q0Y A;  4XSQ A;  4HQ1 A;  3WPD A;  4X66 H;  2HVR A;  4TQR A;  4Z64 C;  2PMZ E;  2VUM G;  3FKI A;  4K17 A;  4L1K A;  4GKJ H;  4Q3G A;  3C6N B;  3K5I A;  3Q8R B;  3OUZ A;  3GTL A;  3EPI A;  2FKL A;  1CS0 A;  3ULV A;  5DLF A;  4MV6 A;  1I3Q A;  5DQH A;  4LF8 H;  4UFR A;  5LA6 F;  1KJ9 A;  4APM A;  4YP3 A;  4MAM A;  4EBD A;  5K2M A;  1S0N A;  4CNM A;  4NZT M;  4DL7 A;  4ARR A;  1FS2 A;  4QWC A;  3E4G A;  4FS1 A;  1M9S A;  4A93 G;  4CC4 A;  2QYZ A;  3OTO H;  2J9G A;  4A2B A;  4F50 A;  2BQU A;  3LML A;  1TAE A;  5EWE A;  2XIG A;  4Q8E A;  2V9W A;  4R0A A;  3KAK A;  1FQV A;  1TWF A;  2VPS A;  3RFE A;  2RDJ A;  2VA3 A;  2JA5 G;  5KFL A;  1E4G T;  2I8C A;  5HDH A;  5IP9 G;  3E5N A;  4LSX C;  3HOY G;  5B4P A;  3O6N A;  5FPO A;  1EYZ A;  2YZG A;  1WWL A;  1JL5 A;  2E2I A;  3UL8 A;  4WBN F;  5AZ5 A;  1SFO A;  4MTE A;  1M0W A;  3MR6 A;  2ZDG A;  4Q8F A;  4FS7 A;  1DS9 A;  4PSJ A;  5D8D A;  3HXL A;  3GV8 B;  2ASL A;  4ARN A;  2MCT A;  4MQW X;  5IYC G;  4O2B F;  3R5F A;  1ZHS A;  1WR2 A;  1RK6 A;  4QIW E;  2OLS A;  1TA8 A;  4EEY A;  3K3V A;  3GII A;  3W3M A;  2XD4 A;  1JKJ B;  1A4Y A;  4XGO A;  1JLL B;  5IYZ F;  5GMH A;  2JEJ A;  2CW7 A;  3RB4 A;  1K83 A;  4JYA H;  2FPG B;  1S97 A;  5KFG A;  3VQ2 A;  1IOV A;  1E4E B;  5LYJ F;  1XNQ H;  5GON F;  2XCL A;  5KFP A;  2Z66 A;  2P0A A;  2P1O B;  4ECR A;  4BBS G;  3DZE A;  3W3J A;  3JAM W;  4DV3 H;  2C00 A;  3GV5 B;  4ECN A;  5FJ8 G;  5KFQ A;  1WSC A;  2W7O A;  5CMP A;  3WO0 A;  4IR9 A;  5KFY A;  2BQ3 A;  2Z62 A;  4GLP A;  3ZYO A;  5GS2 B;  2OMU A;  2R93 G;  5IWA H;  4IWX A;  3AYH B;  2R8K A;  5AWC A;  3REZ A;  3GTM A;  4L3A A;  5BPH A;  3BQ2 A;  1EZ1 A;  2JEI A;  4EFB A;  4U7L A;  1VAJ A;  1S0O A;  5CA0 F;  3GOZ A;  2RA8 A;  4O4H F;  4ECY A;  3T5H A;  1VBH A;  2WQV A;  4LF5 H;  3JSN A;  3ETH A;  4JI7 H;  1ULZ A;  3GTK A;  2Q2T A;  2M05 A;  2VA2 A;  1V4Y A;  3HOV G;  3RIZ A;  4JV1 A;  3JB9 j;  2FPP B;  4V2D A;  4RUA A;  5J2T F;  2XCP A;  5KFR A;  1L2Z A;  4JI2 H;  2O6Q A;  3JRW A;  1LTX A;  1Z2O X;  3Q8S B;  2A0Z A;  5KFB A;  4RB2 C;  3W3G A;  3TIN A;  3TSR E;  1U0N D;  5KFJ A;  4LSX A;  4R6G A;  4O2A F;  3WPI A;  2VOB A;  5LFN A;  2R6F A;  3GTQ A;  4Q43 A;  2W8L A;  1WCM A;  4U08 A;  4RNO A;  3WPH A;  4EGJ A;  3H3V H;  3N40 P;  4R6J A;  1FVI A;  2C2E A;  4WYK A;  4A3B G;  4BWS C;  2R7Z G;  3WO1 A;  3GTG A;  2FE3 A;  2R8G A;  3G04 C;  5LXT F;  3VMM A;  1IO0 A;  4DL3 A;  2P1N B;  3UFX B;  4O3R A;  3ZYI A;  1TWA A;  2OMY A;  4XOS A;  4O3P A;  5C5J A;  5KFO A;  2VQD A;  4JI3 H;  3PO2 G;  3N43 B;  2KSW A;  4J9S A;  2ASJ A;  2R7K A;  2R8H A;  3GIM A;  5LP6 F;  3VQ1 A;  3PZP A;  3WN4 A;  2Z7X A;  2UVU A;  2AGP A;  2V9S A;  5IT9 W;  1S0M A;  4U7C A;  4LFC H;  1H6T A;  5LL6 b;  4X64 H;  3HKZ A;  2YL2 A;  2ATL A;  4RZQ A;  1I6U A;  3M4I A;  4JI0 H;  2XOT A;  3HOZ G;  3GTJ A;  2ASD A;  3OGM B;  1GLV A;  3CIY A;  3C0F B;  1S9F A;  1JXL A;  3V4Z A;  4LH7 A;  2W6Z A;  4IWY A;  3J80 W;  3UQ8 A;  4DR5 H;  4O3S A;  3TIG A;  3BAB A;  2IA6 A;  2OMV A;  3OHB A;  1OGQ A;  2YCH A;  4DR7 H;  2GPW A;  2W9A A;  1M7J A;  1S10 A;  5F9N A;  1N32 H;  2YZN A;  4A3G G;  2YW2 A;  3V4S A;  4JI4 H;  2R9U A;  5JVD F;  4IAJ A;  1KOO A;  4FCG A;  4DUY H;  4FBU A;  3OSN A;  3N42 B;  2XGQ A;  3OGK B;  1Z7X W;  2Z7X B;  1ZQ7 A;  4RZR A;  5B0T A;  2JA7 A;  4LF4 H;  4YBZ B;  1EUD B;  1N34 H;  3OSP A;  2HVQ A;  2V5A A;  4UCO A;  4WD3 A;  4QWB A;  2IBK A;  4OX9 H;  2BNH A;  5EWF A;  4LSA A;  2NUA B;  4RU9 A;  1KJJ A;  4DL6 A;  1M0T A;  3RGX A;  3H0G A;  5JVL A;  5KG0 A;  2WB1 A;  3RBE A;  2DLN A;  4A3J G;  2C2R A;  5KFI A;  4A3D G;  4DL2 A;  1XNR H;  4YHH H;  2JA6 G;  2W6N A;  4TZH A;  4YR0 A;  3ULA A;  5L1J A;  2NU7 B;  3GIJ A;  2UUB H;  4BY1 G;  4MV4 A;  2UVR A;  4ZOL F;  3T1H H;  1M6V A;  2W70 A;  1OWT A;  2UXB H;  3J81 W;  2Z81 A;  4JV2 A;  1AUX A;  4YY3 H;  3G6X A;  4B8C D;  5C1O A;  2FLP A;  4R5D A;  2X0S A;  4EBC A;  2W9B B;  1IBK H;  1V9P A;  4EBE A;  5DG7 A;  4M9U A;  4MN8 B;  1Y1V G;  5FTT B;  3JZI A;  2YRX A;  4DV2 H;  4YAK B;  3PN1 A;  3RJ0 A;  3V6H A;  4ZI7 F;  3OJA B;  4ZQI A;  2UZY A;  5KT3 A;  1TWC A;  5KFA A;  3IN5 A;  2WQX A;  4A3C G;  4I7H A;  4JI8 H;  2R82 A;  2DZD A;  3K3P A;  1B6R A;  3QZ8 A;  4GKK H;  1W93 A;  2IFG A;  2V70 A;  4ED8 A;  2ALZ A;  4DV0 H;  1FO1 A;  5FD6 A;  3KXY T;  4PER A;  3KAL A;  2UXD H;  1Z2N X;  4I50 F;  1VBG A;  4BBR G;  5KFH A;  4ME6 A;  1GWB A;  2O6R A;  3N8D A;  2W6Q A;  2ZDH A;  4V2E A;  5DG9 A;  5C8Y F;  1PX2 A;  1D0B A;  1XWD C;  2WAQ A;  4MA5 A;  3RBD A;  3PR4 A;  2HHH H;  1O6V A;  2VUM A;  5C1P A;  2CW8 A;  4CNC A;  4QW9 A;  5HV6 A;  3RFJ A;  4E4T A;  4ECV A;  4O3Q A;  5EZY F;  2PMZ A;  2E5L H;  5DQI A;  4RB0 A;  5KT6 A;  2NVX A;  4Y8V B;  4YJ2 F;  4M7E A;  4LSC A;  4DL5 A;  2P1Q B;  1XEC A;  3M9M B;  4BY7 G;  4GLX A;  1C3O A;  2GLT A;  2VQF H;  2IMW P;  3V6J A;  2YRW A;  4R5C A;  1AN7 A;  3GIQ A;  2VQE H;  1RJP A;  5CMN A;  4Q3I A;  3CVZ A;  3G6V A;  4YB8 B;  1I7L A;  4GT6 A;  2R92 G;  3OGL B;  1P8T A;  4TV9 F;  4IR1 A;  3ORQ A;  4FBT A;  5IJD A;  3U9T A;  1KJ8 A;  3RF2 A;  3MJF A;  4OQT A;  2JA5 A;  3PW5 A;  3T1Y H;  3GQC A;  1B33 N;  4A3E G;  2DWC A;  1P8L A;  4QJF A;  3WPB A;  4RWT C;  2JEF A;  4AW4 A;  1X9N A;  4KNG A;  3HOU G;  4XX0 B;  4GC7 A;  2YYA A;  1WCM G;  4KHP H;  4DV1 H;  4WP6 A;  5L1L A;  1DV1 A;  4XYM B;  4NZR M;  3R5H A;  1B6S A;  1W8A A;  3RB6 A;  3H4B A;  1Y1W A;  5IYB G;  4MTD A;  1TWH A;  4J9L A;  5FLM G;  4MV9 A;  2ID5 A;  2XWT C;  5C44 G;  1N36 H;  4XYL B;  4JUZ A;  3GIP A;  3J7A K;  4RB1 A;  2YS6 A;  4FU0 A;  5GMG A;  4B3M H;  4KT1 A;  2DPI A;  4Z8G A;  4Z61 C;  4QWE A;  4CC5 A;  5F9L A;  3HKZ E;  4X65 H;  4TQS A;  5IP7 G;  2W71 A;  2IP4 A;  2WDT A;  2JE0 A;  4MA0 A;  3C6P B;  1E4F T;  4A2A A;  5HBR B;  3PW0 A;  4FD0 A;  2J6T A;  5JQW A;  4C5C A;  2Z82 A;  3MR5 A;  1BJT A;  2W6O A;  4HQ6 A;  3T5L A;  4DR3 H;  2JA8 G;  3GID A;  3M9N B;  2FLN A;  1G9U A;  1YRG A;  2Z64 A;  3I12 A;  4ZHQ F;  3C6O B;  4ED2 A;  3M9O B;  4I6J B;  1M0Z A;  5A2Q W;  4O4I F;  4R6F A;  2BR0 A;  3EYY A;  5KFV A;  4AYB A;  1SCU B;  4PWQ A;  4YAJ B;  3PVX A;  5GS0 A;  4R8U A;  4R07 A;  2AU0 A;  3WPE A;  1O6S A;  5KG6 A;  5KFW A;  5T14 A;  3MR3 A;  1OTM A;  3KAJ A;  2UVW A;  4HR7 A;  1RJQ A;  1P9A G;  2UUC H;  2WTF A;  4ECU A;  5IYD G;  4A3M G;  4B3R H;  4R58 A;  3HOX G;  2O6S A;  5DG8 A;  4PQ8 A;  4R09 A;  2WE6 A;  3GIL A;  3ZYJ A;  5C3E G;  3Q1K A;  5C4X G;  4K0K H;  4CIL A;  3RW7 A;  2JA7 G;  2NU6 B;  3WNZ A;  2I80 A;  3BAA A;  1K1Q A;  4RB3 C;  4RAY A;  4LF7 H;  2WB1 E;  3G6Y A;  2B63 A;  5LMU H;  5A5C A;  3JSL A;  1MZB A;  2E2H A;  2YS7 A;  3PO3 G;  2VUG A;  5DGB A;  3RV4 A;  3E3Z A;  4PDB A;  4P8S A;  3RUP A;  1T94 A;  2FK3 A;  1KOH A;  4R6A A;  2QK4 A;  4JV5 H;  3TQ1 A;  4JI6 H;  5EOY A;  1ZIW A;  3CVR A;  3RW6 A;  4C2M A;  5CB4 F;  4NLG A;  4F4Z A;  4UCV A;  4BSS A;  5KX5 F;  4R8U B;  1T36 A;  5HZL B;  4NXN H;  3FKI G;  4MV7 A;  3RB3 A;  2C22 A;  4ETS A;  1DCE A;  2R7N A;  4QW8 A;  5I47 A;  5DLG A;  3T5J A;  1S03 G;  1SYX B;  1GSH A;  4MV1 A;  5KKN B;  2PN1 A;  3GTP A;  4J9Q A;  3G3A A;  2V9T B;  4HNU A;  4EFE A;  1TWG A;  4M7E C;  4BSR A;  3R5X A;  5CA1 F;  2HVS A;  1RJR A;  3IG0 A;  4B3T H;  5EWG A;  4J9P A;  4O3N A;  5KG4 A;  2ZJT A;  2C2D A;  2R85 A;  5KT4 A;  4FMZ A;  1RYS A;  3CQZ A;  4AQY H;  4JI5 H;  1O6T A;  3KTM A;  4FS2 A;  4XZ3 B;  4L3F A;  1JDB B;  5IYX C;  2OMT A;  4J0M A;  4DLK A;  3PW7 A;  4QC0 A;  4J4L A;  2C28 A;  4AY9 X;  1AUV A;  3QZ7 A;  2ELL A;  3MFH A;  5BR8 H;  5D1O A;  2W8K A;  3G06 A;  1VKZ A;  5B0N A;  1PK8 A;  3GIK A;  4HNT A;  3GTO A;  4RCW A;  2UU9 H;  4J9O A;  5JUM A;  4EYI B;  4RNM A;  4F4Y A;  5KT5 A;  3BG5 A;  4ECT A; 
#chains in the Genus database with same CATH homology
 3W3L A;  2RR6 A;  3W3K A;  2E5L H;  1O75 A;  2Q2T A;  3MWM A;  1GYF A;  1WH2 A;  4RB0 A;  4CC4 C;  4YEB B;  3FXI A;  3WPG A;  2FT3 A;  4M7E A;  5IJC A;  3RIZ A;  4UCS A;  3L4K A;  3JB9 j;  4LSC A;  3WPF A;  2P1Q B;  4EEQ A;  4V2D A;  1HNZ H;  5LMN H;  4U06 A;  1XEC A;  1L2Z A;  4JI2 H;  2O6Q A;  4GLX A;  2P1M B;  4IM6 A;  3M18 A;  1K5G C;  1LTX A;  1Z2O X;  2VQF H;  2A0Z A;  1A0I A;  4C2A B;  2BEX A;  4R5C A;  4RB2 C;  4BV4 R;  1AN7 A;  4NKG A;  3RGZ A;  2VQE H;  1OOK G;  3W3G A;  2JE1 A;  5CMN A;  4FDW A;  3TSR E;  4Y61 B;  1U0N D;  4Q3I A;  5GMF A;  5D1P A;  2O03 A;  5FD5 A;  4LSX A;  3CVZ A;  4R6G A;  3WPI A;  4DR4 H;  4DR1 H;  4U09 A;  4GT6 A;  3OGL B;  2VOB A;  1P8T A;  2JQD A;  1XDN A;  4DUZ H;  4LI2 A;  1N33 H;  5LFN A;  1XMO H;  5GQR K;  4Q62 A;  4UCT A;  2AST B;  5IJD A;  3CIG A;  3E6J A;  1A9N A;  1B04 A;  3RF2 A;  4U08 A;  4OQT A;  3M19 A;  3WPH A;  1HNX H;  5FLX W;  2WQU A;  3N40 P;  4R6J A;  4NKH A;  1FVI A;  3T1Y H;  2OMZ A;  1K5D C;  3A79 B;  4LFA H;  4WYK A;  4BWS C;  1P8L A;  3F8N A;  1H6U A;  2FE3 A;  4RCA B;  4P91 A;  5D1O B;  3G04 C;  1HR0 H;  3SB4 A;  4UFZ A;  1FKA H;  3WPB A;  1IO0 A;  2F4V H;  5IJB A;  4RWT C;  4NXM H;  2HGS A;  2P1N B;  4H09 A;  3WPC A;  3UL9 A;  4AW4 A;  3ZYI A;  1DGS A;  1X9N A;  3O53 A;  4KNG A;  2OMY A;  4XOS A;  1XEU A;  3UN9 A;  3N6X A;  1FT8 A;  4JI3 H;  2KSW A;  3N43 B;  3BA8 A;  1XMQ H;  2Q2U A;  1HNW H;  4DV1 H;  4KHP H;  1SQ0 B;  4WP6 A;  4QXE A;  3OJA A;  4DV6 H;  3RFS A;  1W8A A;  3VQ1 A;  4LH6 A;  2WFH A;  2Z63 A;  3WN4 A;  2Z7X A;  2Y5Q A;  4LF9 H;  3ZYN A;  2V9S A;  4MTD A;  5IT9 W;  4MV9 A;  2ID5 A;  4R7R A;  2XWT C;  4LFC H;  1H6T A;  4DV7 H;  4CP6 A;  5LL6 b;  2RGR A;  3UL7 A;  4X64 H;  4PEQ B;  1N36 H;  1IBL H;  4Q0Y A;  4RZQ A;  4XSQ A;  1I6U A;  3M4I A;  4JI0 H;  3J7A K;  4RB1 A;  2XOT A;  5GMG A;  4B3M H;  4KT1 A;  4R08 A;  4X62 H;  4Z8G A;  3OGM B;  4Z61 C;  4HQ1 A;  3CIY A;  3WPD A;  3RTX A;  4CC5 A;  4X66 H;  2HVR A;  4Z64 C;  3C0F B;  1FJG H;  4X65 H;  1OTO A;  4K17 A;  1M10 B;  2WDT A;  4LH7 A;  2JE0 A;  1QYY A;  3C6P B;  4GKJ H;  5AWD A;  1E4F T;  4Q3G A;  3C6N B;  3J80 W;  3UQ8 A;  4A2A A;  2OWO A;  4DR5 H;  3KJ4 A;  4FHO A;  3BAB A;  2OMV A;  4FD0 A;  4Z94 G;  2Z82 A;  3ULV A;  1BJT A;  1OGQ A;  2YCH A;  3PMH G;  4LF8 H;  4DR7 H;  4UFR A;  3G3B A;  4DR3 H;  4APM A;  1BGW A;  1G9U A;  2Z64 A;  1YRG A;  1N32 H;  3C6O B;  4CNM A;  2P1P B;  4JI4 H;  2R9U A;  4IAJ A;  4I6J B;  4ARR A;  1KOO A;  4FCG A;  1FS2 A;  4DUY H;  1M0Z A;  5A2Q W;  3L4J A;  2Q4G W;  3E4G A;  3N42 B;  4R6F A;  4QBZ A;  1M9S A;  3EYY A;  2UXC H;  4FM9 A;  3OGK B;  4UCU A;  1OTN A;  4CC4 A;  2OMX A;  4CC6 A;  3OTO H;  1Z7X W;  4A2B A;  2Z7X B;  4V2C A;  5GS0 A;  4R07 A;  3LML A;  2RGV A;  1TAE A;  3WPE A;  1OZN A;  1O6S A;  2XIG A;  5FPR A;  5D3I A;  5B0T A;  3ULU A;  4R0A A;  1XKU A;  3KAK A;  4LF4 H;  2UZX A;  1N34 H;  4JI1 H;  1FQV A;  1OTM A;  2VPS A;  3RFE A;  4EZG A;  2HVQ A;  3KAJ A;  4DV5 H;  1P8V A;  4UCO A;  1E4G T;  4OX9 H;  2BNH A;  1PGV A;  5HDH A;  2UUA H;  4LSA A;  1P9A G;  2UUC H;  4LSX C;  5B4P A;  4B3R H;  3O6N A;  1M0T A;  4R58 A;  5FPO A;  3RGX A;  2O6S A;  4PQ8 A;  4R09 A;  1WWL A;  1JL5 A;  2WE6 A;  5AWB A;  3UL8 A;  3ZYJ A;  5AZ5 A;  1IBM H;  2WYO A;  4K0K H;  4LFB H;  4CIL A;  3H20 A;  4MTE A;  4LI1 A;  3RW7 A;  1M0W A;  4FS7 A;  3BAA A;  4RB3 C;  4RAY A;  1DS9 A;  4DR2 H;  4LF7 H;  1XNR H;  3G39 A;  4YHH H;  5LMU H;  4KXF B;  4PSJ A;  5A5C A;  1S68 A;  1MZB A;  3JSL A;  3HXL A;  4TZH A;  4B3S H;  1J5E H;  2ASS B;  3ULA A;  2Z65 A;  4ARN A;  2VUG A;  2MCT A;  2UUB H;  4MQW X;  3E3Z A;  4LF6 H;  4PDB A;  3T1H H;  4P8S A;  1ZHS A;  3BZ5 A;  4LXR A;  1XCD A;  2UXB H;  1KOH A;  3N41 B;  4R6A A;  4JV5 H;  3J81 W;  4JI6 H;  5EOY A;  3W3N A;  2Z81 A;  1ZIW A;  1TA8 A;  3K3V A;  3CVR A;  4YY3 H;  3RW6 A;  4DR6 H;  3P72 A;  4B8C D;  3W3M A;  1M9L A;  3BA9 A;  1I94 H;  1A4Y A;  5AWA A;  4UCV A;  4BSS A;  1ZHQ A;  4R5D A;  4XGO A;  1IBK H;  1V9P A;  5HZL B;  4NXN H;  5GMH A;  4MV7 A;  1DFJ I;  4MN8 B;  5FTT B;  4ETS A;  1DCE A;  2CW7 A;  4DV2 H;  4JYA H;  4DV4 H;  3VQ2 A;  1S03 G;  1SYX B;  1Z2P X;  3PN1 A;  3RJ0 A;  1XNQ H;  4BSU A;  2ZM6 H;  2UZY A;  3OJA B;  2Z66 A;  2WQW A;  3G3A A;  2P1O B;  4Z79 A;  2V9T B;  2WQX A;  4EFE A;  4I7H A;  4JI8 H;  4M7E C;  4BSR A;  3DZE A;  4LXS A;  2HVS A;  3W3J A;  3IG0 A;  3JAM W;  4DV3 H;  4GKK H;  4UCR A;  4B3T H;  2IFG A;  4ECN A;  2V70 A;  2ZJT A;  5CMP A;  4DV0 H;  4LMY A;  1FO1 A;  2W57 A;  4FMZ A;  4PKI G;  5FD6 A;  3KXY T;  4PER A;  3E2J A;  2CA6 A;  4AQY H;  3KAL A;  4RAZ A;  3FMA A;  4ECO A;  2UXD H;  4JI5 H;  2Z62 A;  1Z2N X;  1O6T A;  4GLP A;  3ZYO A;  5GS2 B;  4L3F A;  2OMU A;  1GWB A;  5IWA H;  3L2P A;  2O6R A;  5IYX C;  2OMT A;  5AWC A;  3REZ A;  4J0M A;  2OMW A;  4QC0 A;  1SEI A;  4L3A A;  4J4L A;  4V2E A;  1D0B A;  1XWD C;  4AY9 X;  1VS0 A;  4EFB A;  2ELL A;  4U7L A;  5BR8 H;  5D1O A;  3DF7 A;  2HHH H;  1O6V A;  3G06 A;  3GOZ A;  2RA8 A;  5B0N A;  2CW8 A;  4CNC A;  4G8A A;  4RCW A;  2UU9 H;  2WQV A;  3RFJ A;  4C2B B;  4LF5 H;  3JSN A;  4JI7 H;  3N44 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...