4J0MA

Crystal structure of brl1 (lrr) in complex with brassinolide
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
727
structure length
724
Chain Sequence
DFNETALLLAFKQNSVKSDPNNVLGNWKYEGSCSWRGVSCSDDGRIVGLDLRNSGLTGTLNLVNLTALPNLQNLYLQGNYFSSGGDSSGSDCYLQVLDLSSNSISDYSMVDYVFSKCSNLVSVNISNNKLVGKLGFAPSSLQSLTTVDLSYNILSDKIPESFISDFPASLKYLDLTHNNLSGDFSDLSFGICGNLTFFSLSQNNLSGDKFPITLPNCKFLETLNISRNNLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGNTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPMELGKCKSLKTIDLSFNELTGPIPKEIWMLPNLSDLVMWANNLTGTIPEGVCVKGGNLETLILNNNLLTGSIPESISRCTNMIWISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEGIRAERLERLPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAVSGFIPPGYGNMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIPFGGQLTTFPVSRYANNSGLCGVPLRPCGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for differential recognition of brassinolide by its receptors
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase BRI1-like 1
total genus 246
structure length 724
sequence length 727
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.310 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4j0mA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4j0mA01
4U7LA 4Z94G 3GOZA 2P1OB 4Z8GA 4R6AA 2Y5QA 3W3KA 4CC4C 3WN4A 5GMGA 3M18A 1G9UA 1GWBA 2XOTA 2Z66A 4MQWX 4GT6A 3O6NA 2ASTB 4XSQA 4EZGA 3ULUA 2UZXA 2O6RA 1A9NA 1M10B 3W3MA 1U0ND 2Z81A 3VQ1A 2P1MB 3RJ0A 1DCEA 2IFGA 2Q4GW 4V2CA 4Z61C 1DFJI 4QBZA 4R0AA 5HDHA 3W3LA 1M9LA 3WPIA 2OMUA 3OJAA 5AWBA 1OZNA 4V2EA 2Z82A 3G3AA 5HZLB 4LSAA 1YRGA 1H6UA 3G39A 3WPDA 3RW6A 1M0ZA 2OMTA 4PSJA 2P1QB 3WPBA 3W3JA 1FO1A 3UL9A 3JB9j 4G8AA 4L3FA 2P1PB 3E3ZA 4AW4A 3ZYNA 4RWTC 5CMPA 4LI2A 2JE0A 1FS2A 1XWDC 4HQ1A 1PGVA 3A79B 4I6JB 5B4PA 3TSRE 4P8SA 3ZYJA 2WQXA 2OMXA 4XGOA 4QC0A 4K17A 4CNMA 4FD0A 4Z79A 4NKGA 2P1NB 4Q3GA 4MN8B 5A5CA 5AZ5A 3REZA 3ULAA 4J4LA 4R5CA 3RGZA 4PERA 4R6GA 3WPFA 3OGLB 2OMVA 4KXFB 3G06A 1K5DC 4FHOA 3W3GA 3OGMB 4R08A 4CILA 1O6SA 3E2JA 5B0TA 1XEUA 5GQRK 1P8TA 3E4GA 5IJCA 4M7EC 1KOOA 2O6SA 5GS0A 1Z7XW 5GMFA 2WQWA 3RGXA 2Z7XA 3C6OB 3KJ4A 4CNCA 3RFSA 2XWTC 3W3NA 4IM6A 4LSXA 3G3BA 2O6QA 2FT3A 1M9SA 4Q3IA 1FT8A 2WQVA 4C2BB 4M7EA 5AWAA 4LI1A 4WP6A 3P72A 3RIZA 4U08A 1OTOA 3WPEA 2Z63A 4FDWA 4FMZA 2V9TB 4R58A 4WYKA 2WFHA 2Z64A 1W8AA 4R6FA 5FTTB 3VQ2A 3WPHA 1A4YA 4ECOA 2ASSB 2WQUA 1D0BA 4RCWA 4Y61B 1OTNA 3RFJA 4J0MA 4ARNA 1JL5A 4NKHA 3PMHG 4L3AA 4KNGA 3WPGA 1WWLA 2ELLA 5IJBA 1OGQA 4UFRA 2Z65A 3ZYIA 1OTMA 2RR6A 1XECA 5D3IA 2CA6A 2ID5A 2V70A 4LXRA 4PKIG 3C6PB 3UN9A 4ARRA 2JQDA 1LTXA 4ECNA 3WPCA 2JE1A 1H6TA 4YEBB 3RW7A 3FXIA 1DS9A 5GS2B 3CVRA 3CIYA 4C2AB 2R9UA 4LSCA 4CP6A 4XOSA 1SQ0B 1O6VA 4FS7A 4Q62A 2BNHA 5B0NA 4V2DA 4BV4R 5AWCA 4R5DA 1ZIWA 4FCGA 4TZHA 3CIGA 2V9SA 4CC4A 4R07A 4U06A 5CMNA 1KOHA 5AWDA 4BSSA 2OMZA 4Z64C 4U09A 4R6JA 3ULVA 4KT1A 4LXSA 1QYYA 3C6NB 3SB4A 5GMHA 4OQTA 1O6TA 5IYXC 1FQVA 1IO0A 2Z7XB 4H09A 1P8VA 3O53A 4QXEA 4RCAB 5LFNA 4P91A 4B8CD 4LSXC 5IJDA 1XKUA 4GLPA 1OOKG 3E6JA 3OGKB 2OMWA 3G04C 3DZEA 3RFEA 4AY9X 2Z62A 3OJAB 1P9AG 1XCDA 3ZYOA 2A0ZA 2RA8A 4BSUA 1K5GC 4PEQB 4PQ8A 2BEXA 3UL8A 4BSRA 2OMYA 3BZ5A 2UZYA 3UL7A 4R09A 3M19A
chains in the Genus database with same CATH superfamily
4U7LA 3SI8A 5LP6F 3HXLA 3LWBA 4ECVA 2B63G 4NZRM 3PR4A 2W6MA 1V51A 2FP4B 5FD5A 5KFCA 4GC6A 4A3JG 4LF9H 1GWBA 4DUZH 3M18A 3KHHA 1E4EA 3K3VA 3KAKA 3ORRA 4EG0A 2ZM6H 1CQJB 3K5HA 2J6UA 2W8LA 1M10B 2R93G 3N40P 3VQ1A 3K5IA 4TUYF 3VPDA 5L1IA 4EBDA 2V4QA 4EBEA 1XMQH 4F4WA 3MWEA 2JA5A 2IFGA 4QBZA 3WPIA 5IYCG 3KHRA 5BPFA 1I94H 1OZNA 2R7MA 2R87A 3HB9A 2GPSA 4YBZB 4RZRA 4MV8A 3HOVG 4YAJB 5C3EG 4O3PA 3GTMA 5JVDF 4QJFA 3HOWG 2AGPA 3WPCA 4HR7A 5KG1A 3I4NG 1FO1A 3HBLA 3UL9A 3UQ8A 3EPIA 1KJIA 3R5FA 5KFVA 4ED7A 1N34H 4AW4A 4ECTA 2FPIB 4ED1A 1S97A 2JE0A 4HQ1A 2VUGA 1L2ZA 1KJ9A 4I7HA 4B3TH 4K17A 1M0WA 4FD0A 3RTXA 5KFJA 4ED2A 2ATLA 3REZA 1IBLH 4J4LA 4NXMH 3BQ1A 3RGZA 5KG6A 4PERA 2W9CB 1ZETA 5GONF 5IWAH 4F4XA 1OWTA 3V6KA 1RYRA 1XNQH 1K5DC 3G06A 5DGBA 2I80A 5L9XA 1RK6A 5C1OA 2XC9A 4EYIB 2UUBH 2BR0A 4OX9H 3GTQA 4CILA 5KX5F 5EOYA 1Y14B 5GQRK 2O03A 1JLLB 2UVVA 5IJCA 5IP7G 5D8DA 4A3MG 4FBUA 2O6SA 5GS0A 2Y5QA 3C6OB 2XCPA 4WD3A 1S0MA 2FKLA 3V6JA 4IM6A 4UCSA 5FPRA 1C3OA 5JQWA 1RJRA 4LF5H 2Y0SE 1M9SA 4Q3IA 5FLXW 3TINA 4ETSA 4JV0A 4O2BF 4U08A 4Y8VB 1OTOA 4IRDA 4R58A 4WYKA 3MJFA 4QW8A 4R6FA 2OLSA 3WPHA 2VA3A 2YU9A 4RUAA 1CQIB 2ASSB 2C28A 1D0BA 2RGVA 4RCWA 1OTNA 3RFJA 1M7JA 4YB8B 3R23A 2W6PA 3J7AK 3L4JA 3KHGA 1T36A 2W71A 1B6RA 1XECA 3Q8RB 2ID5A 4O3QA 2V70A 3UN9A 2JQDA 3PR5B 3PZPA 2UUCH 1LTXA 3FDSA 1H6TA 2JE1A 4ECNA 3RBEA 4FM9A 4LSCA 4C5BA 1GYFA 4UCRA 2RF4A 4Q62A 5B0TA 2BNHA 3PN1A 4RNMA 4BBRG 4QWAA 2R82A 4ECXA 2WE6A 3CIGA 2R85A 3H0GA 4X64H 4U06A 3WPEA 1GO3E 5L1KA 2GPWA 4BSSA 1ULZA 4XZ3B 4R6JA 4LXSA 1KC7A 4FS2A 2M05A 5I47A 4OQTA 3QFFA 4LFBH 4QW9A 3FKIG 3CIYA 4LSXC 1RJQA 4KHPH 5HV6A 4R8UA 4P91A 1Y1WA 2R8HA 5DQIA 3PW5A 5J2TF 4CC5A 1I50A 4DR2H 3GTPA 1OOKG 2OMWA 3OGKB 1C30A 3RFEA 5KFLA 4I4TF 2J6SA 2HVQA 1ZHSA 4ZHQF 3OJAB 2NU9B 4B3MH 1E4EB 4DL7A 4MV3A 3M9NB 2A0ZA 4MV7A 5H80A 3GTLA 4PEQB 1EUCB 2HHHH 1V4YA 4BSRA 3CVZA 4GKJH 2UZYA 2R7NA 1R9TA 3BZ5A 2C2EA 2WB1A 3RF2A 4R09A 4X62H 3KHLA 3GOZA 4EFEA 2FE3A 4EFBA 3N41B 3WN4A 4A2BA 2DPIA 2R8KA 4A3IG 3GV8B 4A3DG 2WDTA 5C44G 3ULUA 4MQWX 4GT6A 1N36H 3PO3G 4F4YA 2UVWA 4RAYA 1IBKH 3O6NA 4DR1H 3QZ8A 3OSNA 2ALZA 4LFCH 1XNRH 4IAJA 3W3KA 3GLKA 2Q4GW 3T1YH 2YRXA 1DFJI 5HDHA 3W3LA 1M9LA 4MA0A 4DL6A 1UC9A 5DQGA 3KALA 4J9PA 2VA2A 4YJ3F 2OWOA 2R93A 4DV7H 3WO1A 3V4SA 4JUZA 3OHBA 3BABA 1IBMH 4C5AA 1DV1A 5KG2A 3OSPA 2HGSA 1X9NA 3OUZA 3Q8PB 4XX0B 3GILA 4DV2H 4LH7A 2FK3A 1HR0H 4NLGA 2JA8G 4G8AA 3E3ZA 2V9WA 1Y1VA 2B63A 1JXLA 3HOYG 4L3FA 3ZYNA 5DG7A 3E5NA 1VS0A 5KG0A 2VOBA 4IRKA 2Y0SA 3A79B 5D1PA 5B4PA 3N8DA 5L1LA 3TSRE 2W6ZA 4J9KA 5AZ5A 2VQFH 5KG5A 4MN8B 4O4IF 3ULAA 3VPCA 2IMWP 3PW0A 4JI5H 3GTGA 4JYAH 4R5CA 3SE7A 4DV1H 4AYBA 4DV5H 4ECQA 2NVXA 3OGLB 3GV5B 2OMVA 2W9BB 4KXFB 5IYZF 3T5HA 3I4MG 5BMVF 4DV0H 4ZOLF 3RB4A 3MR2A 3RB6A 2E2IA 2W70A 5KFNA 4JI4H 1KEEA 2PVPA 4YQWA 1KOOA 5GMFA 2WQWA 3RGXA 3KJ4A 4CNCA 2XWTC 2KSWA 3KTMA 2GLTA 5EDWA 4LMYA 3RB3A 2O6QA 3BA8A 1EHIA 2W6OA 4ED6A 1BGWA 2XCLA 5DGAA 4C2BB 4MV1A 5KFSA 4Q43A 3NGDA 2ZDQA 1S0OA 5DLGA 4LI1A 4O3SA 2R8IA 4WP6A 4J9LA 2YRWA 5KFTA 2ASDA 2FLPA 2WFHA 4R7RA 1BJTA 4DL2A 2Z64A 5FTTB 4CC6A 1A4YA 4ECOA 5KFHA 3LP8A 4TQSA 4J9MA 4Y61B 2CKZB 4UCTA 5BPHA 5C8YF 4GLXA 2VPSA 4EEQA 1TAEA 4ARNA 2YS7A 4ZI7F 5KT3A 4FU0A 4KNGA 3H4DA 2P0AA 2XGQA 1WWLA 5JUMA 2WB1E 1KJQA 3RUPA 4ED0A 3V4ZA 4DLKA 1Y1VG 1WR2A 4LXRA 4PKIG 3C0FB 4RB3C 3L4KA 1HNXH 3C6PB 4ARRA 1N56A 3H20A 5GS2B 4E4TA 5DLFA 4O4HF 4LFAH 4DL5A 4XOSA 3UFXB 2W9AA 5D1OA 3VPBA 3PW2A 2BQ3A 4LF8H 5KT4A 2R7ZA 2V9SA 4R5DA 4LH6A 3GTKA 5CMNA 5KFBA 3ULVA 4RZQA 1SYXB 2RGRA 2OMZA 4U09A 4Z64C 2R7ZG 3T5LA 4FBTA 4EGJA 2MCTA 3GIPA 1O6TA 3J80W 3BQ2A 1FQVA 2Z7XB 2Q2UA 4ZQIA 4RUCA 3HKZE 4MA5A 5LFNA 3Q8QB 5IJDA 1FJGH 5KFGA 4GLPA 3E6JA 1DGSA 4ED3A 3BAAA 2W8KA 2Z62A 3PW4A 1P9AG 3MR6A 1XCDA 3T5KA 4HNVA 1A0IA 4A3LG 2R92G 3I12A 1JIHA 3VMMA 3T5JA 1Z2OX 1Y1WG 1K5GC 2YZNA 3G6XA 4WBNF 2BEXA 3MR3A 4B3SH 2JEFA 2VQDA 2R6FA 5C5JA 3M19A 3JAMW 2ZDHA 4K0KH 4Z8GA 4JI7H 4O2AF 3RV3A 3R5XA 3H0GG 2FJZA 2NU7B 4QWCA 5F9LA 5KFWA 4AQYH 4IR9A 2VUMG 5L1JA 2XOTA 2YZGA 3RBDA 3Q1KA 4BWSC 5IYBG 3MWMA 4XSQA 4DV6H 4PDBA 2O6RA 1A9NA 3GIMA 1U0ND 4I55F 4UFZA 1CE8A 3RJ0A 1DCEA 2P1MB 1ZQ7A 2W9CA 4EYHB 2JA6G 2OMUA 2NUAB 4A3CG 2YL2A 1T3NA 3CQZA 5AWBA 4V2EA 3TQ1A 4LSAA 2WYOA 2W57A 1FVIA 1H6UA 1HNZH 3G39A 2YCHA 4YR2A 2R8GA 2DLNA 3HOUG 1TWCA 3WPBA 2FB9A 3JB9j 2R86A 4U7CA 3JRWA 4DV4H 4LF7H 2P1PB 4QIWE 4RWTC 2QK4A 4TQRA 4QWDA 4LI2A 4I6JB 1PGVA 5KFIA 4EEYA 1DS9A 2C2DA 4P8SA 2OH2A 4ECYA 4QC0A 5KFXA 3WO0A 4CNMA 5JVLA 4Z79A 4HQ6A 4A3EG 5KFAA 3HKZA 2P1NB 4NKGA 1VBHA 4Q3GA 2NVYA 2C35B 5KFYA 4TV8F 3Q8SB 5KFEA 2C00A 4R6GA 3WPFA 5LL6b 2YW2A 5A2QW 2NU8B 2W9BA 2J6TA 1SCUB 3F8NA 2ASLA 3W3GA 5KFQA 5LOVF 5EZYF 3OTOH 4J9RA 2C2RA 5J2UF 2R7LA 2YYAA 4IZOA 3V6HA 2HVSA 3U9SA 4FS1A 4JI1H 1XEUA 3PW7A 2W6NA 4C2MA 3M9OB 2JEJA 4M7EC 2WAQE 3JSLA 5KFMA 4F50A 4RB0A 2FPPB 3RFSA 1B04A 5C1PA 1Z2NX 4LSXA 3G3BA 2CW7A 5F9NA 2FT3A 2XIGA 4X66H 3J81W 5AWAA 5CA0F 4M7EA 2R84A 3P72A 1GGOA 3IG0A 4JI8H 2YZMA 3U9TA 2Z63A 4FDWA 3ETHA 2E5LH 4FMZA 4M9UA 1M6VA 4HNUA 2AGOA 4JV1A 4LF6H 2F4VH 2UXBH 2V59A 4L1KA 4IWYA 4NZTM 3AYHB 5K2MA 4DL3A 4G3IA 5KG3A 4DV3H 5DQHA 4DL4A 3RAXA 1GLVA 4J9SA 3BQ0A 1JL5A 3PMHG 4L3AA 1DV2A 1RK5A 3G8CA 3WPGA 4YY3H 3KXYT 5KFUA 4BY1G 5KT5A 1OGQA 2ELLA 3H4BA 2Z65A 3ZYJA 3ZYIA 5IP9G 2FLNA 1RJPA 1I6UA 3TIIA 4O3OA 1JKJB 4QWBA 2ZJTA 2UXDH 2I87A 3FXIA 3T1HH 3CVRA 1KJJA 1UC8A 3JRXA 2ZDGA 5LXTF 4QWEA 1O6VA 1SQ0B 4FS7A 5AWCA 3BA9A 4BXXG 4V2DA 3W3MA 5DG8A 1K1QA 4UCUA 3WNZA 4TZHA 2YS6A 4I50F 4YR0A 4U6PA 3H40A 4A3KG 1KOHA 5EWEA 4RB1A 1A9XA 1B6SA 5KFFA 2SCUB 4Q45A 2FLLA 4KT1A 1TWFA 4JI0H 1QYYA 3SB4A 5GMHA 4J9OA 3RV4A 4NXNH 5IYXC 1IO0A 2DZDA 3N6XA 3G6VA 4DR5H 1V9PA 1I7LA 4RCAB 4B8CD 3BG5A 2BQUA 3M9MB 1E4GT 1BXRA 3FKIA 1IOVA 5T14A 1BNCA 3DZEA 1EUDB 3G04C 2ASJA 4IHJF 4AY9X 3PVXA 1J5EH 2WTFA 2CW8A 3UL7A 3ZYOA 4ME6A 1I7NA 3ETJA 2UVUA 2RA8A 4BSUA 4YJ2F 4PQ8A 2XCAA 3R5HA 1XDNA 2VR1A 3QZ7A 2IA6A 4YAKB 3GIIA 2JEGA 4XYLB 3L2PA 2OMYA 3FMAA 3RB0A 3HOXG 2W7OA 5EWFA 1AUXA 1XMOH 1S10A 3MR5A 5KFRA 4IRCA 2P1OB 4Q0YA 4Z94G 4R6AA 1EYZA 1JDBB 1P8LA 3ORQA 3GQCA 4ECZA 1I3QA 3HOZG 3EPGA 1K1SA 3LMLA 4CC4C 1G9UA 1UNNC 5GMGA 1GSAA 3EYYA 3K3PA 5JH7F 2Z66A 4EZGA 1TWGA 2ASTB 1DIKA 2JA7G 2UZXA 5CB4F 2WAQA 2DPJA 2UU9H 4DR4H 5KFPA 2Z81A 3PO2G 4V2CA 4GKKH 2FK1A 1N33H 4Z61C 4R0AA 4Q8FA 2V5AA 4RB2C 2PN1A 3RAQA 3OJAA 1FKAH 2NU6B 1S0NA 4C5CA 4Q44A 4X65H 2Z82A 3G3AA 5HZLB 3OHAA 5FLMG 5KT7A 3GIQA 1YRGA 3WPDA 3RW6A 5KFOA 1M0ZA 2OMTA 3IN5A 3W3JA 3MFHA 1WSCA 1WCMG 5D1OB 4AYBE 2DIKA 4IR1A 4DR6H 3M4IA 4R8UB 1AN7A 5DG9A 3BJYA 4ECWA 5CMPA 2PMZE 1FS2A 1XWDC 4MV6A 4ECUA 2QYZA 5CAEB 2WQXA 1MZBA 2OMXA 4F4ZA 2IBKA 4XGOA 4A2AA 4YHHH 5A5CA 4JI2H 1CS0A 1N32H 1ZHQA 1EZ1A 1VBGA 2I8CA 2X0SA 3GIDA 5IYDG 2FK2A 3OUUA 4MTDA 4RNNA 1T94A 4EGQA 5LMUH 4JV2A 4DR3H 5KFZA 1RYSA 4FHOA 2PMZA 3OGMB 2V4RA 1TA8A 2DWCA 4A93G 4R08A 1O6SA 3E2JA 4APMA 2C22A 2FMAA 4TV9F 1P8TA 3E4GA 5KG7A 5FPOA 2CZGA 3RFCA 4JI6H 4B3RH 1Z7XW 2JA5G 4YR3A 2RDJA 1PK8A 4QIWA 4ECRA 4HYKA 4J9QA 2PBZA 2Z7XA 3W3NA 5BR8H 1W96A 2XD4A 2R8JA 2VPQA 1FT8A 2AGQA 2WQVA 4JI3H 3GV7B 4PWQA 1SEIA 5KG4A 3RIZA 5KKNB 1AUVA 4O3RA 1S68A 3Q2OA 2IP4A 2V9TB 5HBRB 3N43B 3H3VH 2JEIA 5CA1F 1W8AA 1B33N 5FJ8G 3VQ2A 1WCMA 3GTJA 2WQUA 3G6YA 1SFOA 2HJWA 4J0MA 3JSNA 4MV9A 4NKHA 1GSHA 5KT6A 4Q8EA 3TIGA 1M0TA 4UFRA 5IJBA 5LYJF 1OTMA 3DF7A 2AU0A 2JA6A 2RR6A 2CA6A 5D3IA 2BQRA 4A3FG 2J9GA 4O3NA 4YEBB 3RW7A 2R92A 4XYMB 4RNOA 2VQEH 2UUAH 1O75A 5C4XG 1JX4A 2R9UA 4C2AB 4A3BG 1KBLA 2JA7A 4CP6A 1W93A 4MV4A 3MFIA 1TWHA 4BBSG 5B0NA 2XGPA 4BV4R 4MTEA 1Z2PX 1ZIWA 4ED8A 1E4FT 4FCGA 4CC4A 3GTOA 4R07A 5IT9W 4RU9A 5AWDA 1IOWA 3N44B 3JZIA 5EWGA 1N48A 2RDIA 2E2HA 1K83A 4DR7H 4MAMA 1VKZA 4PSJA 2AQ4A 3C6NB 1HNWH 4BY7G 2R7KA 3MWDA 1KJ8A 4EBCA 5FD6A 4H09A 2W6QA 3N42B 5LA6F 4LF4H 1P8VA 5LMNH 2P1QB 3O53A 4DUYH 4QXEA 2UVRA 5KT2A 1S03G 2FPGB 1XKUA 4RAZA 4O4LF 4UCOA 4IWXA 2Q2TA 4GC7A 2CQYA 3TQTA 1S9FA 4HNTA 5KFDA 1WH2A 4J9NA 2HVRA 1PX2A 4ECSA 4YP3A 1TWAA 3GIKA 1VAJA 4A3GG 3GIJA 2W7PA 2VUMA 5KFKA 3UL8A 1GSOA 4JV5H 1JDEA 3KAJA 4UCVA 2UXCH 2V58A
chains in the Genus database with same CATH topology
4U7LA 3HXLA 5FD5A 3M18A 4LF9H 1GWBA 4DUZH 3K3VA 3KAKA 2ZM6H 1M10B 3N40P 3VQ1A 1XMQH 2IFGA 4QBZA 3WPIA 1I94H 1OZNA 1FO1A 3UL9A 3UQ8A 1N34H 4AW4A 2JE0A 4HQ1A 2VUGA 1L2ZA 4I7HA 4B3TH 4K17A 1M0WA 4FD0A 3RTXA 3REZA 1IBLH 4J4LA 4NXMH 3RGZA 4PERA 1XNQH 5IWAH 3G06A 1K5DC 4OX9H 2UUBH 4CILA 5EOYA 5GQRK 2O03A 5IJCA 2O6SA 5GS0A 3C6OB 4IM6A 4UCSA 5FPRA 4LF5H 1M9SA 4Q3IA 5FLXW 4ETSA 4U08A 1OTOA 4R58A 4WYKA 4R6FA 3WPHA 2ASSB 1D0BA 2RGVA 4RCWA 1OTNA 3RFJA 3J7AK 3L4JA 1XECA 2ID5A 2V70A 3UN9A 2JQDA 2UUCH 1LTXA 4ECNA 2JE1A 1H6TA 4FM9A 4LSCA 1GYFA 4UCRA 4Q62A 2BNHA 3PN1A 3CIGA 2WE6A 4X64H 4U06A 3WPEA 4BSSA 4R6JA 4LXSA 4OQTA 4LFBH 3CIYA 4LSXC 4KHPH 4P91A 4CC5A 4DR2H 1OOKG 3OGKB 2OMWA 3RFEA 2HVQA 1ZHSA 3OJAB 4B3MH 2A0ZA 4MV7A 4PEQB 2HHHH 4BSRA 3CVZA 4GKJH 2UZYA 4R09A 3RF2A 4X62H 3GOZA 4EFEA 2FE3A 4EFBA 3N41B 3WN4A 2WDTA 3ULUA 4MQWX 4GT6A 1N36H 3O6NA 4RAYA 1IBKH 4DR1H 1XNRH 4LFCH 4IAJA 2Q4GW 3T1YH 1DFJI 5HDHA 3W3LA 1M9LA 3KALA 2OWOA 4DV7H 4PSJA 3BABA 1IBMH 2P1QB 1X9NA 2HGSA 4DV2H 4G8AA 4LH7A 1HR0H 4L3FA 3E3ZA 3ZYNA 1VS0A 5B4PA 2VOBA 3A79B 3TSRE 3ZYJA 5D1PA 5AZ5A 2VQFH 4MN8B 3ULAA 4JI5H 4JYAH 4R5CA 4DV5H 4DV1H 3OGLB 2OMVA 4KXFB 4DV0H 4JI4H 1KOOA 5GMFA 2WQWA 3RGXA 3KJ4A 4CNCA 2XWTC 2KSWA 4LMYA 2O6QA 3BA8A 1BGWA 4C2BB 5AWAA 4LI1A 4WP6A 2WFHA 2Z64A 4R7RA 1BJTA 5FTTB 4CC6A 1A4YA 4ECOA 4Y61B 4UCTA 4GLXA 2VPSA 4EEQA 1TAEA 4ARNA 4KNGA 1WWLA 4LXRA 4PKIG 4ARRA 3C0FB 4RB3C 3L4KA 1HNXH 3C6PB 3H20A 5GS2B 4LFAH 4XOSA 5D1OA 4LF8H 4R5DA 2V9SA 4LH6A 5CMNA 3ULVA 4RZQA 1SYXB 2RGRA 2OMZA 4U09A 4Z64C 2MCTA 1O6TA 3J80W 1FQVA 2Z7XB 2Q2UA 5LFNA 5IJDA 1FJGH 4GLPA 3E6JA 1DGSA 3BAAA 2Z62A 1P9AG 1XCDA 1A0IA 1Z2OX 1K5GC 2BEXA 4B3SH 3M19A 3JAMW 4K0KH 4Z8GA 4JI7H 4AQYH 2XOTA 4BWSC 4XSQA 3MWMA 4DV6H 4PDBA 2O6RA 1A9NA 1U0ND 4UFZA 2P1MB 3RJ0A 1DCEA 2OMUA 5AWBA 4V2EA 4LSAA 2WYOA 2W57A 1FVIA 1H6UA 1HNZH 3G39A 2YCHA 3WPBA 3JB9j 4DV4H 4LF7H 2P1PB 4RWTC 4LI2A 4I6JB 1PGVA 1DS9A 4P8SA 4QC0A 4CNMA 4Z79A 4NKGA 2P1NB 4Q3GA 4R6GA 3WPFA 5LL6b 5A2QW 3F8NA 3W3GA 3OTOH 5B0TA 4JI1H 1XEUA 2HVSA 4M7EC 3JSLA 4RB0A 3RFSA 1B04A 1Z2NX 4LSXA 3G3BA 2CW7A 2FT3A 2XIGA 4X66H 3J81W 4M7EA 3P72A 3IG0A 4JI8H 2Z63A 4FDWA 2E5LH 4FMZA 4LF6H 2F4VH 2UXBH 4DV3H 1JL5A 3PMHG 4L3AA 3WPGA 4YY3H 3KXYT 1OGQA 2ELLA 2Z65A 3ZYIA 1I6UA 2UXDH 2ZJTA 3FXIA 3T1HH 3CVRA 1O6VA 1SQ0B 4FS7A 5AWCA 3BA9A 4V2DA 3W3MA 4UCUA 4TZHA 1KOHA 4RB1A 4KT1A 1QYYA 4JI0H 3SB4A 5GMHA 4NXNH 5IYXC 1IO0A 3N6XA 4DR5H 1V9PA 4RCAB 4B8CD 1E4GT 3G04C 3DZEA 4AY9X 1J5EH 2CW8A 3ZYOA 2RA8A 4BSUA 4PQ8A 1XDNA 2OMYA 3BZ5A 3L2PA 3FMAA 3UL7A 1XMOH 4Z94G 2P1OB 4Q0YA 4R6AA 1P8LA 2Y5QA 3W3KA 4CC4C 5GMGA 3LMLA 1G9UA 3EYYA 2Z66A 4EZGA 2ASTB 2UZXA 4DR4H 2Z81A 2UU9H 4V2CA 4GKKH 1N33H 4Z61C 4R0AA 4RB2C 3OJAA 1FKAH 4X65H 2Z82A 3G3AA 5HZLB 1YRGA 3WPDA 3RW6A 1M0ZA 2OMTA 3W3JA 5D1OB 4DR6H 3M4IA 1AN7A 5CMPA 1FS2A 1XWDC 2WQXA 1MZBA 2OMXA 4XGOA 4A2AA 4YHHH 5A5CA 4JI2H 1N32H 1ZHQA 5LMUH 4MTDA 4DR3H 4FHOA 3OGMB 4R08A 1TA8A 1O6SA 3E2JA 4APMA 1P8TA 3E4GA 4B3RH 5FPOA 4JI6H 1Z7XW 2Z7XA 3W3NA 5BR8H 1FT8A 2WQVA 4JI3H 1SEIA 3RIZA 1S68A 2V9TB 3N43B 1W8AA 3VQ2A 2WQUA 4J0MA 3JSNA 4MV9A 4NKHA 5IJBA 1M0TA 4UFRA 1OTMA 2RR6A 3DF7A 5D3IA 2CA6A 3WPCA 4YEBB 3RW7A 2VQEH 2UUAH 1O75A 4C2AB 2R9UA 4CP6A 5B0NA 4BV4R 4MTEA 1Z2PX 1ZIWA 4FCGA 1E4FT 4CC4A 4R07A 5IT9W 5AWDA 3N44B 4DR7H 3C6NB 1HNWH 5FD6A 4H09A 4QXEA 3N42B 4LF4H 1P8VA 3O53A 5LMNH 4DUYH 1S03G 1XKUA 4RAZA 4UCOA 2Q2TA 1WH2A 2HVRA 3UL8A 4JV5H 4A2BA 3KAJA 4UCVA 2UXCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7L A;  4Z94 G;  3GOZ A;  2P1O B;  4Z8G A;  4R6A A;  2Y5Q A;  3W3K A;  4CC4 C;  3WN4 A;  5GMG A;  3M18 A;  1G9U A;  1GWB A;  2XOT A;  2Z66 A;  4MQW X;  4GT6 A;  3O6N A;  2AST B;  4XSQ A;  4EZG A;  3ULU A;  2UZX A;  2O6R A;  1A9N A;  1M10 B;  3W3M A;  1U0N D;  2Z81 A;  3VQ1 A;  2P1M B;  3RJ0 A;  1DCE A;  2IFG A;  2Q4G W;  4V2C A;  4Z61 C;  1DFJ I;  4QBZ A;  4R0A A;  5HDH A;  3W3L A;  1M9L A;  3WPI A;  2OMU A;  3OJA A;  5AWB A;  1OZN A;  4V2E A;  2Z82 A;  3G3A A;  5HZL B;  4LSA A;  1YRG A;  1H6U A;  3G39 A;  3WPD A;  3RW6 A;  1M0Z A;  2OMT A;  4PSJ A;  2P1Q B;  3WPB A;  3W3J A;  1FO1 A;  3UL9 A;  3JB9 j;  4G8A A;  4L3F A;  2P1P B;  3E3Z A;  4AW4 A;  3ZYN A;  4RWT C;  5CMP A;  4LI2 A;  2JE0 A;  1FS2 A;  1XWD C;  4HQ1 A;  1PGV A;  3A79 B;  4I6J B;  5B4P A;  3TSR E;  4P8S A;  3ZYJ A;  2WQX A;  2OMX A;  4XGO A;  4QC0 A;  4K17 A;  4CNM A;  4FD0 A;  4Z79 A;  4NKG A;  2P1N B;  4Q3G A;  4MN8 B;  5A5C A;  5AZ5 A;  3REZ A;  3ULA A;  4J4L A;  4R5C A;  3RGZ A;  4PER A;  4R6G A;  3WPF A;  3OGL B;  2OMV A;  4KXF B;  3G06 A;  1K5D C;  4FHO A;  3W3G A;  3OGM B;  4R08 A;  4CIL A;  1O6S A;  3E2J A;  5B0T A;  1XEU A;  5GQR K;  1P8T A;  3E4G A;  5IJC A;  4M7E C;  1KOO A;  2O6S A;  5GS0 A;  1Z7X W;  5GMF A;  2WQW A;  3RGX A;  2Z7X A;  3C6O B;  3KJ4 A;  4CNC A;  3RFS A;  2XWT C;  3W3N A;  4IM6 A;  4LSX A;  3G3B A;  2O6Q A;  2FT3 A;  1M9S A;  4Q3I A;  1FT8 A;  2WQV A;  4C2B B;  4M7E A;  5AWA A;  4LI1 A;  4WP6 A;  3P72 A;  3RIZ A;  4U08 A;  1OTO A;  3WPE A;  2Z63 A;  4FDW A;  4FMZ A;  2V9T B;  4R58 A;  4WYK A;  2WFH A;  2Z64 A;  1W8A A;  4R6F A;  5FTT B;  3VQ2 A;  3WPH A;  1A4Y A;  4ECO A;  2ASS B;  2WQU A;  1D0B A;  4RCW A;  4Y61 B;  1OTN A;  3RFJ A;  4J0M A;  4ARN A;  1JL5 A;  4NKH A;  3PMH G;  4L3A A;  4KNG A;  3WPG A;  1WWL A;  2ELL A;  5IJB A;  1OGQ A;  4UFR A;  2Z65 A;  3ZYI A;  1OTM A;  2RR6 A;  1XEC A;  5D3I A;  2CA6 A;  2ID5 A;  2V70 A;  4LXR A;  4PKI G;  3C6P B;  3UN9 A;  4ARR A;  2JQD A;  1LTX A;  4ECN A;  3WPC A;  2JE1 A;  1H6T A;  4YEB B;  3RW7 A;  3FXI A;  1DS9 A;  5GS2 B;  3CVR A;  3CIY A;  4C2A B;  2R9U A;  4LSC A;  4CP6 A;  4XOS A;  1SQ0 B;  1O6V A;  4FS7 A;  4Q62 A;  2BNH A;  5B0N A;  4V2D A;  4BV4 R;  5AWC A;  4R5D A;  1ZIW A;  4FCG A;  4TZH A;  3CIG A;  2V9S A;  4CC4 A;  4R07 A;  4U06 A;  5CMN A;  1KOH A;  5AWD A;  4BSS A;  2OMZ A;  4Z64 C;  4U09 A;  4R6J A;  3ULV A;  4KT1 A;  4LXS A;  1QYY A;  3C6N B;  3SB4 A;  5GMH A;  4OQT A;  1O6T A;  5IYX C;  1FQV A;  1IO0 A;  2Z7X B;  4H09 A;  1P8V A;  3O53 A;  4QXE A;  4RCA B;  5LFN A;  4P91 A;  4B8C D;  4LSX C;  5IJD A;  1XKU A;  4GLP A;  1OOK G;  3E6J A;  3OGK B;  2OMW A;  3G04 C;  3DZE A;  3RFE A;  4AY9 X;  2Z62 A;  3OJA B;  1P9A G;  1XCD A;  3ZYO A;  2A0Z A;  2RA8 A;  4BSU A;  1K5G C;  4PEQ B;  4PQ8 A;  2BEX A;  3UL8 A;  4BSR A;  2OMY A;  3BZ5 A;  2UZY A;  3UL7 A;  4R09 A;  3M19 A; 
#chains in the Genus database with same CATH topology
 4U7L A;  3SI8 A;  5LP6 F;  3HXL A;  3LWB A;  4ECV A;  2B63 G;  4NZR M;  3PR4 A;  2W6M A;  1V51 A;  2FP4 B;  5FD5 A;  5KFC A;  4GC6 A;  4A3J G;  4LF9 H;  1GWB A;  4DUZ H;  3M18 A;  3KHH A;  1E4E A;  3K3V A;  3KAK A;  3ORR A;  4EG0 A;  2ZM6 H;  1CQJ B;  3K5H A;  2J6U A;  2W8L A;  1M10 B;  2R93 G;  3N40 P;  3VQ1 A;  3K5I A;  4TUY F;  3VPD A;  5L1I A;  4EBD A;  2V4Q A;  4EBE A;  1XMQ H;  4F4W A;  3MWE A;  2JA5 A;  2IFG A;  4QBZ A;  3WPI A;  5IYC G;  3KHR A;  5BPF A;  1I94 H;  1OZN A;  2R7M A;  2R87 A;  3HB9 A;  2GPS A;  4YBZ B;  4RZR A;  4MV8 A;  3HOV G;  4YAJ B;  5C3E G;  4O3P A;  3GTM A;  5JVD F;  4QJF A;  3HOW G;  2AGP A;  3WPC A;  4HR7 A;  5KG1 A;  3I4N G;  1FO1 A;  3HBL A;  3UL9 A;  3UQ8 A;  3EPI A;  1KJI A;  3R5F A;  5KFV A;  4ED7 A;  1N34 H;  4AW4 A;  4ECT A;  2FPI B;  4ED1 A;  1S97 A;  2JE0 A;  4HQ1 A;  2VUG A;  1L2Z A;  1KJ9 A;  4I7H A;  4B3T H;  4K17 A;  1M0W A;  4FD0 A;  3RTX A;  5KFJ A;  4ED2 A;  2ATL A;  3REZ A;  1IBL H;  4J4L A;  4NXM H;  3BQ1 A;  3RGZ A;  5KG6 A;  4PER A;  2W9C B;  1ZET A;  5GON F;  5IWA H;  4F4X A;  1OWT A;  3V6K A;  1RYR A;  1XNQ H;  1K5D C;  3G06 A;  5DGB A;  2I80 A;  5L9X A;  1RK6 A;  5C1O A;  2XC9 A;  4EYI B;  2UUB H;  2BR0 A;  4OX9 H;  3GTQ A;  4CIL A;  5KX5 F;  5EOY A;  1Y14 B;  5GQR K;  2O03 A;  1JLL B;  2UVV A;  5IJC A;  5IP7 G;  5D8D A;  4A3M G;  4FBU A;  2O6S A;  5GS0 A;  2Y5Q A;  3C6O B;  2XCP A;  4WD3 A;  1S0M A;  2FKL A;  3V6J A;  4IM6 A;  4UCS A;  5FPR A;  1C3O A;  5JQW A;  1RJR A;  4LF5 H;  2Y0S E;  1M9S A;  4Q3I A;  5FLX W;  3TIN A;  4ETS A;  4JV0 A;  4O2B F;  4U08 A;  4Y8V B;  1OTO A;  4IRD A;  4R58 A;  4WYK A;  3MJF A;  4QW8 A;  4R6F A;  2OLS A;  3WPH A;  2VA3 A;  2YU9 A;  4RUA A;  1CQI B;  2ASS B;  2C28 A;  1D0B A;  2RGV A;  4RCW A;  1OTN A;  3RFJ A;  1M7J A;  4YB8 B;  3R23 A;  2W6P A;  3J7A K;  3L4J A;  3KHG A;  1T36 A;  2W71 A;  1B6R A;  1XEC A;  3Q8R B;  2ID5 A;  4O3Q A;  2V70 A;  3UN9 A;  2JQD A;  3PR5 B;  3PZP A;  2UUC H;  1LTX A;  3FDS A;  1H6T A;  2JE1 A;  4ECN A;  3RBE A;  4FM9 A;  4LSC A;  4C5B A;  1GYF A;  4UCR A;  2RF4 A;  4Q62 A;  5B0T A;  2BNH A;  3PN1 A;  4RNM A;  4BBR G;  4QWA A;  2R82 A;  4ECX A;  2WE6 A;  3CIG A;  2R85 A;  3H0G A;  4X64 H;  4U06 A;  3WPE A;  1GO3 E;  5L1K A;  2GPW A;  4BSS A;  1ULZ A;  4XZ3 B;  4R6J A;  4LXS A;  1KC7 A;  4FS2 A;  2M05 A;  5I47 A;  4OQT A;  3QFF A;  4LFB H;  4QW9 A;  3FKI G;  3CIY A;  4LSX C;  1RJQ A;  4KHP H;  5HV6 A;  4R8U A;  4P91 A;  1Y1W A;  2R8H A;  5DQI A;  3PW5 A;  5J2T F;  4CC5 A;  1I50 A;  4DR2 H;  3GTP A;  1OOK G;  2OMW A;  3OGK B;  1C30 A;  3RFE A;  5KFL A;  4I4T F;  2J6S A;  2HVQ A;  1ZHS A;  4ZHQ F;  3OJA B;  2NU9 B;  4B3M H;  1E4E B;  4DL7 A;  4MV3 A;  3M9N B;  2A0Z A;  4MV7 A;  5H80 A;  3GTL A;  4PEQ B;  1EUC B;  2HHH H;  1V4Y A;  4BSR A;  3CVZ A;  4GKJ H;  2UZY A;  2R7N A;  1R9T A;  3BZ5 A;  2C2E A;  2WB1 A;  3RF2 A;  4R09 A;  4X62 H;  3KHL A;  3GOZ A;  4EFE A;  2FE3 A;  4EFB A;  3N41 B;  3WN4 A;  4A2B A;  2DPI A;  2R8K A;  4A3I G;  3GV8 B;  4A3D G;  2WDT A;  5C44 G;  3ULU A;  4MQW X;  4GT6 A;  1N36 H;  3PO3 G;  4F4Y A;  2UVW A;  4RAY A;  1IBK H;  3O6N A;  4DR1 H;  3QZ8 A;  3OSN A;  2ALZ A;  4LFC H;  1XNR H;  4IAJ A;  3W3K A;  3GLK A;  2Q4G W;  3T1Y H;  2YRX A;  1DFJ I;  5HDH A;  3W3L A;  1M9L A;  4MA0 A;  4DL6 A;  1UC9 A;  5DQG A;  3KAL A;  4J9P A;  2VA2 A;  4YJ3 F;  2OWO A;  2R93 A;  4DV7 H;  3WO1 A;  3V4S A;  4JUZ A;  3OHB A;  3BAB A;  1IBM H;  4C5A A;  1DV1 A;  5KG2 A;  3OSP A;  2HGS A;  1X9N A;  3OUZ A;  3Q8P B;  4XX0 B;  3GIL A;  4DV2 H;  4LH7 A;  2FK3 A;  1HR0 H;  4NLG A;  2JA8 G;  4G8A A;  3E3Z A;  2V9W A;  1Y1V A;  2B63 A;  1JXL A;  3HOY G;  4L3F A;  3ZYN A;  5DG7 A;  3E5N A;  1VS0 A;  5KG0 A;  2VOB A;  4IRK A;  2Y0S A;  3A79 B;  5D1P A;  5B4P A;  3N8D A;  5L1L A;  3TSR E;  2W6Z A;  4J9K A;  5AZ5 A;  2VQF H;  5KG5 A;  4MN8 B;  4O4I F;  3ULA A;  3VPC A;  2IMW P;  3PW0 A;  4JI5 H;  3GTG A;  4JYA H;  4R5C A;  3SE7 A;  4DV1 H;  4AYB A;  4DV5 H;  4ECQ A;  2NVX A;  3OGL B;  3GV5 B;  2OMV A;  2W9B B;  4KXF B;  5IYZ F;  3T5H A;  3I4M G;  5BMV F;  4DV0 H;  4ZOL F;  3RB4 A;  3MR2 A;  3RB6 A;  2E2I A;  2W70 A;  5KFN A;  4JI4 H;  1KEE A;  2PVP A;  4YQW A;  1KOO A;  5GMF A;  2WQW A;  3RGX A;  3KJ4 A;  4CNC A;  2XWT C;  2KSW A;  3KTM A;  2GLT A;  5EDW A;  4LMY A;  3RB3 A;  2O6Q A;  3BA8 A;  1EHI A;  2W6O A;  4ED6 A;  1BGW A;  2XCL A;  5DGA A;  4C2B B;  4MV1 A;  5KFS A;  4Q43 A;  3NGD A;  2ZDQ A;  1S0O A;  5DLG A;  4LI1 A;  4O3S A;  2R8I A;  4WP6 A;  4J9L A;  2YRW A;  5KFT A;  2ASD A;  2FLP A;  2WFH A;  4R7R A;  1BJT A;  4DL2 A;  2Z64 A;  5FTT B;  4CC6 A;  1A4Y A;  4ECO A;  5KFH A;  3LP8 A;  4TQS A;  4J9M A;  4Y61 B;  2CKZ B;  4UCT A;  5BPH A;  5C8Y F;  4GLX A;  2VPS A;  4EEQ A;  1TAE A;  4ARN A;  2YS7 A;  4ZI7 F;  5KT3 A;  4FU0 A;  4KNG A;  3H4D A;  2P0A A;  2XGQ A;  1WWL A;  5JUM A;  2WB1 E;  1KJQ A;  3RUP A;  4ED0 A;  3V4Z A;  4DLK A;  1Y1V G;  1WR2 A;  4LXR A;  4PKI G;  3C0F B;  4RB3 C;  3L4K A;  1HNX H;  3C6P B;  4ARR A;  1N56 A;  3H20 A;  5GS2 B;  4E4T A;  5DLF A;  4O4H F;  4LFA H;  4DL5 A;  4XOS A;  3UFX B;  2W9A A;  5D1O A;  3VPB A;  3PW2 A;  2BQ3 A;  4LF8 H;  5KT4 A;  2R7Z A;  2V9S A;  4R5D A;  4LH6 A;  3GTK A;  5CMN A;  5KFB A;  3ULV A;  4RZQ A;  1SYX B;  2RGR A;  2OMZ A;  4U09 A;  4Z64 C;  2R7Z G;  3T5L A;  4FBT A;  4EGJ A;  2MCT A;  3GIP A;  1O6T A;  3J80 W;  3BQ2 A;  1FQV A;  2Z7X B;  2Q2U A;  4ZQI A;  4RUC A;  3HKZ E;  4MA5 A;  5LFN A;  3Q8Q B;  5IJD A;  1FJG H;  5KFG A;  4GLP A;  3E6J A;  1DGS A;  4ED3 A;  3BAA A;  2W8K A;  2Z62 A;  3PW4 A;  1P9A G;  3MR6 A;  1XCD A;  3T5K A;  4HNV A;  1A0I A;  4A3L G;  2R92 G;  3I12 A;  1JIH A;  3VMM A;  3T5J A;  1Z2O X;  1Y1W G;  1K5G C;  2YZN A;  3G6X A;  4WBN F;  2BEX A;  3MR3 A;  4B3S H;  2JEF A;  2VQD A;  2R6F A;  5C5J A;  3M19 A;  3JAM W;  2ZDH A;  4K0K H;  4Z8G A;  4JI7 H;  4O2A F;  3RV3 A;  3R5X A;  3H0G G;  2FJZ A;  2NU7 B;  4QWC A;  5F9L A;  5KFW A;  4AQY H;  4IR9 A;  2VUM G;  5L1J A;  2XOT A;  2YZG A;  3RBD A;  3Q1K A;  4BWS C;  5IYB G;  3MWM A;  4XSQ A;  4DV6 H;  4PDB A;  2O6R A;  1A9N A;  3GIM A;  1U0N D;  4I55 F;  4UFZ A;  1CE8 A;  3RJ0 A;  1DCE A;  2P1M B;  1ZQ7 A;  2W9C A;  4EYH B;  2JA6 G;  2OMU A;  2NUA B;  4A3C G;  2YL2 A;  1T3N A;  3CQZ A;  5AWB A;  4V2E A;  3TQ1 A;  4LSA A;  2WYO A;  2W57 A;  1FVI A;  1H6U A;  1HNZ H;  3G39 A;  2YCH A;  4YR2 A;  2R8G A;  2DLN A;  3HOU G;  1TWC A;  3WPB A;  2FB9 A;  3JB9 j;  2R86 A;  4U7C A;  3JRW A;  4DV4 H;  4LF7 H;  2P1P B;  4QIW E;  4RWT C;  2QK4 A;  4TQR A;  4QWD A;  4LI2 A;  4I6J B;  1PGV A;  5KFI A;  4EEY A;  1DS9 A;  2C2D A;  4P8S A;  2OH2 A;  4ECY A;  4QC0 A;  5KFX A;  3WO0 A;  4CNM A;  5JVL A;  4Z79 A;  4HQ6 A;  4A3E G;  5KFA A;  3HKZ A;  2P1N B;  4NKG A;  1VBH A;  4Q3G A;  2NVY A;  2C35 B;  5KFY A;  4TV8 F;  3Q8S B;  5KFE A;  2C00 A;  4R6G A;  3WPF A;  5LL6 b;  2YW2 A;  5A2Q W;  2NU8 B;  2W9B A;  2J6T A;  1SCU B;  3F8N A;  2ASL A;  3W3G A;  5KFQ A;  5LOV F;  5EZY F;  3OTO H;  4J9R A;  2C2R A;  5J2U F;  2R7L A;  2YYA A;  4IZO A;  3V6H A;  2HVS A;  3U9S A;  4FS1 A;  4JI1 H;  1XEU A;  3PW7 A;  2W6N A;  4C2M A;  3M9O B;  2JEJ A;  4M7E C;  2WAQ E;  3JSL A;  5KFM A;  4F50 A;  4RB0 A;  2FPP B;  3RFS A;  1B04 A;  5C1P A;  1Z2N X;  4LSX A;  3G3B A;  2CW7 A;  5F9N A;  2FT3 A;  2XIG A;  4X66 H;  3J81 W;  5AWA A;  5CA0 F;  4M7E A;  2R84 A;  3P72 A;  1GGO A;  3IG0 A;  4JI8 H;  2YZM A;  3U9T A;  2Z63 A;  4FDW A;  3ETH A;  2E5L H;  4FMZ A;  4M9U A;  1M6V A;  4HNU A;  2AGO A;  4JV1 A;  4LF6 H;  2F4V H;  2UXB H;  2V59 A;  4L1K A;  4IWY A;  4NZT M;  3AYH B;  5K2M A;  4DL3 A;  4G3I A;  5KG3 A;  4DV3 H;  5DQH A;  4DL4 A;  3RAX A;  1GLV A;  4J9S A;  3BQ0 A;  1JL5 A;  3PMH G;  4L3A A;  1DV2 A;  1RK5 A;  3G8C A;  3WPG A;  4YY3 H;  3KXY T;  5KFU A;  4BY1 G;  5KT5 A;  1OGQ A;  2ELL A;  3H4B A;  2Z65 A;  3ZYJ A;  3ZYI A;  5IP9 G;  2FLN A;  1RJP A;  1I6U A;  3TII A;  4O3O A;  1JKJ B;  4QWB A;  2ZJT A;  2UXD H;  2I87 A;  3FXI A;  3T1H H;  3CVR A;  1KJJ A;  1UC8 A;  3JRX A;  2ZDG A;  5LXT F;  4QWE A;  1O6V A;  1SQ0 B;  4FS7 A;  5AWC A;  3BA9 A;  4BXX G;  4V2D A;  3W3M A;  5DG8 A;  1K1Q A;  4UCU A;  3WNZ A;  4TZH A;  2YS6 A;  4I50 F;  4YR0 A;  4U6P A;  3H40 A;  4A3K G;  1KOH A;  5EWE A;  4RB1 A;  1A9X A;  1B6S A;  5KFF A;  2SCU B;  4Q45 A;  2FLL A;  4KT1 A;  1TWF A;  4JI0 H;  1QYY A;  3SB4 A;  5GMH A;  4J9O A;  3RV4 A;  4NXN H;  5IYX C;  1IO0 A;  2DZD A;  3N6X A;  3G6V A;  4DR5 H;  1V9P A;  1I7L A;  4RCA B;  4B8C D;  3BG5 A;  2BQU A;  3M9M B;  1E4G T;  1BXR A;  3FKI A;  1IOV A;  5T14 A;  1BNC A;  3DZE A;  1EUD B;  3G04 C;  2ASJ A;  4IHJ F;  4AY9 X;  3PVX A;  1J5E H;  2WTF A;  2CW8 A;  3UL7 A;  3ZYO A;  4ME6 A;  1I7N A;  3ETJ A;  2UVU A;  2RA8 A;  4BSU A;  4YJ2 F;  4PQ8 A;  2XCA A;  3R5H A;  1XDN A;  2VR1 A;  3QZ7 A;  2IA6 A;  4YAK B;  3GII A;  2JEG A;  4XYL B;  3L2P A;  2OMY A;  3FMA A;  3RB0 A;  3HOX G;  2W7O A;  5EWF A;  1AUX A;  1XMO H;  1S10 A;  3MR5 A;  5KFR A;  4IRC A;  2P1O B;  4Q0Y A;  4Z94 G;  4R6A A;  1EYZ A;  1JDB B;  1P8L A;  3ORQ A;  3GQC A;  4ECZ A;  1I3Q A;  3HOZ G;  3EPG A;  1K1S A;  3LML A;  4CC4 C;  1G9U A;  1UNN C;  5GMG A;  1GSA A;  3EYY A;  3K3P A;  5JH7 F;  2Z66 A;  4EZG A;  1TWG A;  2AST B;  1DIK A;  2JA7 G;  2UZX A;  5CB4 F;  2WAQ A;  2DPJ A;  2UU9 H;  4DR4 H;  5KFP A;  2Z81 A;  3PO2 G;  4V2C A;  4GKK H;  2FK1 A;  1N33 H;  4Z61 C;  4R0A A;  4Q8F A;  2V5A A;  4RB2 C;  2PN1 A;  3RAQ A;  3OJA A;  1FKA H;  2NU6 B;  1S0N A;  4C5C A;  4Q44 A;  4X65 H;  2Z82 A;  3G3A A;  5HZL B;  3OHA A;  5FLM G;  5KT7 A;  3GIQ A;  1YRG A;  3WPD A;  3RW6 A;  5KFO A;  1M0Z A;  2OMT A;  3IN5 A;  3W3J A;  3MFH A;  1WSC A;  1WCM G;  5D1O B;  4AYB E;  2DIK A;  4IR1 A;  4DR6 H;  3M4I A;  4R8U B;  1AN7 A;  5DG9 A;  3BJY A;  4ECW A;  5CMP A;  2PMZ E;  1FS2 A;  1XWD C;  4MV6 A;  4ECU A;  2QYZ A;  5CAE B;  2WQX A;  1MZB A;  2OMX A;  4F4Z A;  2IBK A;  4XGO A;  4A2A A;  4YHH H;  5A5C A;  4JI2 H;  1CS0 A;  1N32 H;  1ZHQ A;  1EZ1 A;  1VBG A;  2I8C A;  2X0S A;  3GID A;  5IYD G;  2FK2 A;  3OUU A;  4MTD A;  4RNN A;  1T94 A;  4EGQ A;  5LMU H;  4JV2 A;  4DR3 H;  5KFZ A;  1RYS A;  4FHO A;  2PMZ A;  3OGM B;  2V4R A;  1TA8 A;  2DWC A;  4A93 G;  4R08 A;  1O6S A;  3E2J A;  4APM A;  2C22 A;  2FMA A;  4TV9 F;  1P8T A;  3E4G A;  5KG7 A;  5FPO A;  2CZG A;  3RFC A;  4JI6 H;  4B3R H;  1Z7X W;  2JA5 G;  4YR3 A;  2RDJ A;  1PK8 A;  4QIW A;  4ECR A;  4HYK A;  4J9Q A;  2PBZ A;  2Z7X A;  3W3N A;  5BR8 H;  1W96 A;  2XD4 A;  2R8J A;  2VPQ A;  1FT8 A;  2AGQ A;  2WQV A;  4JI3 H;  3GV7 B;  4PWQ A;  1SEI A;  5KG4 A;  3RIZ A;  5KKN B;  1AUV A;  4O3R A;  1S68 A;  3Q2O A;  2IP4 A;  2V9T B;  5HBR B;  3N43 B;  3H3V H;  2JEI A;  5CA1 F;  1W8A A;  1B33 N;  5FJ8 G;  3VQ2 A;  1WCM A;  3GTJ A;  2WQU A;  3G6Y A;  1SFO A;  2HJW A;  4J0M A;  3JSN A;  4MV9 A;  4NKH A;  1GSH A;  5KT6 A;  4Q8E A;  3TIG A;  1M0T A;  4UFR A;  5IJB A;  5LYJ F;  1OTM A;  3DF7 A;  2AU0 A;  2JA6 A;  2RR6 A;  2CA6 A;  5D3I A;  2BQR A;  4A3F G;  2J9G A;  4O3N A;  4YEB B;  3RW7 A;  2R92 A;  4XYM B;  4RNO A;  2VQE H;  2UUA H;  1O75 A;  5C4X G;  1JX4 A;  2R9U A;  4C2A B;  4A3B G;  1KBL A;  2JA7 A;  4CP6 A;  1W93 A;  4MV4 A;  3MFI A;  1TWH A;  4BBS G;  5B0N A;  2XGP A;  4BV4 R;  4MTE A;  1Z2P X;  1ZIW A;  4ED8 A;  1E4F T;  4FCG A;  4CC4 A;  3GTO A;  4R07 A;  5IT9 W;  4RU9 A;  5AWD A;  1IOW A;  3N44 B;  3JZI A;  5EWG A;  1N48 A;  2RDI A;  2E2H A;  1K83 A;  4DR7 H;  4MAM A;  1VKZ A;  4PSJ A;  2AQ4 A;  3C6N B;  1HNW H;  4BY7 G;  2R7K A;  3MWD A;  1KJ8 A;  4EBC A;  5FD6 A;  4H09 A;  2W6Q A;  3N42 B;  5LA6 F;  4LF4 H;  1P8V A;  5LMN H;  2P1Q B;  3O53 A;  4DUY H;  4QXE A;  2UVR A;  5KT2 A;  1S03 G;  2FPG B;  1XKU A;  4RAZ A;  4O4L F;  4UCO A;  4IWX A;  2Q2T A;  4GC7 A;  2CQY A;  3TQT A;  1S9F A;  4HNT A;  5KFD A;  1WH2 A;  4J9N A;  2HVR A;  1PX2 A;  4ECS A;  4YP3 A;  1TWA A;  3GIK A;  1VAJ A;  4A3G G;  3GIJ A;  2W7P A;  2VUM A;  5KFK A;  3UL8 A;  1GSO A;  4JV5 H;  1JDE A;  3KAJ A;  4UCV A;  2UXC H;  2V58 A; 
#chains in the Genus database with same CATH homology
 4U7L A;  3HXL A;  5FD5 A;  3M18 A;  4LF9 H;  1GWB A;  4DUZ H;  3K3V A;  3KAK A;  2ZM6 H;  1M10 B;  3N40 P;  3VQ1 A;  1XMQ H;  2IFG A;  4QBZ A;  3WPI A;  1I94 H;  1OZN A;  1FO1 A;  3UL9 A;  3UQ8 A;  1N34 H;  4AW4 A;  2JE0 A;  4HQ1 A;  2VUG A;  1L2Z A;  4I7H A;  4B3T H;  4K17 A;  1M0W A;  4FD0 A;  3RTX A;  3REZ A;  1IBL H;  4J4L A;  4NXM H;  3RGZ A;  4PER A;  1XNQ H;  5IWA H;  3G06 A;  1K5D C;  4OX9 H;  2UUB H;  4CIL A;  5EOY A;  5GQR K;  2O03 A;  5IJC A;  2O6S A;  5GS0 A;  3C6O B;  4IM6 A;  4UCS A;  5FPR A;  4LF5 H;  1M9S A;  4Q3I A;  5FLX W;  4ETS A;  4U08 A;  1OTO A;  4R58 A;  4WYK A;  4R6F A;  3WPH A;  2ASS B;  1D0B A;  2RGV A;  4RCW A;  1OTN A;  3RFJ A;  3J7A K;  3L4J A;  1XEC A;  2ID5 A;  2V70 A;  3UN9 A;  2JQD A;  2UUC H;  1LTX A;  4ECN A;  2JE1 A;  1H6T A;  4FM9 A;  4LSC A;  1GYF A;  4UCR A;  4Q62 A;  2BNH A;  3PN1 A;  3CIG A;  2WE6 A;  4X64 H;  4U06 A;  3WPE A;  4BSS A;  4R6J A;  4LXS A;  4OQT A;  4LFB H;  3CIY A;  4LSX C;  4KHP H;  4P91 A;  4CC5 A;  4DR2 H;  1OOK G;  3OGK B;  2OMW A;  3RFE A;  2HVQ A;  1ZHS A;  3OJA B;  4B3M H;  2A0Z A;  4MV7 A;  4PEQ B;  2HHH H;  4BSR A;  3CVZ A;  4GKJ H;  2UZY A;  4R09 A;  3RF2 A;  4X62 H;  3GOZ A;  4EFE A;  2FE3 A;  4EFB A;  3N41 B;  3WN4 A;  2WDT A;  3ULU A;  4MQW X;  4GT6 A;  1N36 H;  3O6N A;  4RAY A;  1IBK H;  4DR1 H;  1XNR H;  4LFC H;  4IAJ A;  2Q4G W;  3T1Y H;  1DFJ I;  5HDH A;  3W3L A;  1M9L A;  3KAL A;  2OWO A;  4DV7 H;  4PSJ A;  3BAB A;  1IBM H;  2P1Q B;  1X9N A;  2HGS A;  4DV2 H;  4G8A A;  4LH7 A;  1HR0 H;  4L3F A;  3E3Z A;  3ZYN A;  1VS0 A;  5B4P A;  2VOB A;  3A79 B;  3TSR E;  3ZYJ A;  5D1P A;  5AZ5 A;  2VQF H;  4MN8 B;  3ULA A;  4JI5 H;  4JYA H;  4R5C A;  4DV5 H;  4DV1 H;  3OGL B;  2OMV A;  4KXF B;  4DV0 H;  4JI4 H;  1KOO A;  5GMF A;  2WQW A;  3RGX A;  3KJ4 A;  4CNC A;  2XWT C;  2KSW A;  4LMY A;  2O6Q A;  3BA8 A;  1BGW A;  4C2B B;  5AWA A;  4LI1 A;  4WP6 A;  2WFH A;  2Z64 A;  4R7R A;  1BJT A;  5FTT B;  4CC6 A;  1A4Y A;  4ECO A;  4Y61 B;  4UCT A;  4GLX A;  2VPS A;  4EEQ A;  1TAE A;  4ARN A;  4KNG A;  1WWL A;  4LXR A;  4PKI G;  4ARR A;  3C0F B;  4RB3 C;  3L4K A;  1HNX H;  3C6P B;  3H20 A;  5GS2 B;  4LFA H;  4XOS A;  5D1O A;  4LF8 H;  4R5D A;  2V9S A;  4LH6 A;  5CMN A;  3ULV A;  4RZQ A;  1SYX B;  2RGR A;  2OMZ A;  4U09 A;  4Z64 C;  2MCT A;  1O6T A;  3J80 W;  1FQV A;  2Z7X B;  2Q2U A;  5LFN A;  5IJD A;  1FJG H;  4GLP A;  3E6J A;  1DGS A;  3BAA A;  2Z62 A;  1P9A G;  1XCD A;  1A0I A;  1Z2O X;  1K5G C;  2BEX A;  4B3S H;  3M19 A;  3JAM W;  4K0K H;  4Z8G A;  4JI7 H;  4AQY H;  2XOT A;  4BWS C;  4XSQ A;  3MWM A;  4DV6 H;  4PDB A;  2O6R A;  1A9N A;  1U0N D;  4UFZ A;  2P1M B;  3RJ0 A;  1DCE A;  2OMU A;  5AWB A;  4V2E A;  4LSA A;  2WYO A;  2W57 A;  1FVI A;  1H6U A;  1HNZ H;  3G39 A;  2YCH A;  3WPB A;  3JB9 j;  4DV4 H;  4LF7 H;  2P1P B;  4RWT C;  4LI2 A;  4I6J B;  1PGV A;  1DS9 A;  4P8S A;  4QC0 A;  4CNM A;  4Z79 A;  4NKG A;  2P1N B;  4Q3G A;  4R6G A;  3WPF A;  5LL6 b;  5A2Q W;  3F8N A;  3W3G A;  3OTO H;  5B0T A;  4JI1 H;  1XEU A;  2HVS A;  4M7E C;  3JSL A;  4RB0 A;  3RFS A;  1B04 A;  1Z2N X;  4LSX A;  3G3B A;  2CW7 A;  2FT3 A;  2XIG A;  4X66 H;  3J81 W;  4M7E A;  3P72 A;  3IG0 A;  4JI8 H;  2Z63 A;  4FDW A;  2E5L H;  4FMZ A;  4LF6 H;  2F4V H;  2UXB H;  4DV3 H;  1JL5 A;  3PMH G;  4L3A A;  3WPG A;  4YY3 H;  3KXY T;  1OGQ A;  2ELL A;  2Z65 A;  3ZYI A;  1I6U A;  2UXD H;  2ZJT A;  3FXI A;  3T1H H;  3CVR A;  1O6V A;  1SQ0 B;  4FS7 A;  5AWC A;  3BA9 A;  4V2D A;  3W3M A;  4UCU A;  4TZH A;  1KOH A;  4RB1 A;  4KT1 A;  1QYY A;  4JI0 H;  3SB4 A;  5GMH A;  4NXN H;  5IYX C;  1IO0 A;  3N6X A;  4DR5 H;  1V9P A;  4RCA B;  4B8C D;  1E4G T;  3G04 C;  3DZE A;  4AY9 X;  1J5E H;  2CW8 A;  3ZYO A;  2RA8 A;  4BSU A;  4PQ8 A;  1XDN A;  2OMY A;  3BZ5 A;  3L2P A;  3FMA A;  3UL7 A;  1XMO H;  4Z94 G;  2P1O B;  4Q0Y A;  4R6A A;  1P8L A;  2Y5Q A;  3W3K A;  4CC4 C;  5GMG A;  3LML A;  1G9U A;  3EYY A;  2Z66 A;  4EZG A;  2AST B;  2UZX A;  4DR4 H;  2Z81 A;  2UU9 H;  4V2C A;  4GKK H;  1N33 H;  4Z61 C;  4R0A A;  4RB2 C;  3OJA A;  1FKA H;  4X65 H;  2Z82 A;  3G3A A;  5HZL B;  1YRG A;  3WPD A;  3RW6 A;  1M0Z A;  2OMT A;  3W3J A;  5D1O B;  4DR6 H;  3M4I A;  1AN7 A;  5CMP A;  1FS2 A;  1XWD C;  2WQX A;  1MZB A;  2OMX A;  4XGO A;  4A2A A;  4YHH H;  5A5C A;  4JI2 H;  1N32 H;  1ZHQ A;  5LMU H;  4MTD A;  4DR3 H;  4FHO A;  3OGM B;  4R08 A;  1TA8 A;  1O6S A;  3E2J A;  4APM A;  1P8T A;  3E4G A;  4B3R H;  5FPO A;  4JI6 H;  1Z7X W;  2Z7X A;  3W3N A;  5BR8 H;  1FT8 A;  2WQV A;  4JI3 H;  1SEI A;  3RIZ A;  1S68 A;  2V9T B;  3N43 B;  1W8A A;  3VQ2 A;  2WQU A;  4J0M A;  3JSN A;  4MV9 A;  4NKH A;  5IJB A;  1M0T A;  4UFR A;  1OTM A;  2RR6 A;  3DF7 A;  5D3I A;  2CA6 A;  3WPC A;  4YEB B;  3RW7 A;  2VQE H;  2UUA H;  1O75 A;  4C2A B;  2R9U A;  4CP6 A;  5B0N A;  4BV4 R;  4MTE A;  1Z2P X;  1ZIW A;  4FCG A;  1E4F T;  4CC4 A;  4R07 A;  5IT9 W;  5AWD A;  3N44 B;  4DR7 H;  3C6N B;  1HNW H;  5FD6 A;  4H09 A;  4QXE A;  3N42 B;  4LF4 H;  1P8V A;  3O53 A;  5LMN H;  4DUY H;  1S03 G;  1XKU A;  4RAZ A;  4UCO A;  2Q2T A;  1WH2 A;  2HVR A;  3UL8 A;  4JV5 H;  4A2B A;  3KAJ A;  4UCV A;  2UXC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...