4J0MA

Crystal structure of brl1 (lrr) in complex with brassinolide
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
727
structure length
724
Chain Sequence
DFNETALLLAFKQNSVKSDPNNVLGNWKYEGSCSWRGVSCSDDGRIVGLDLRNSGLTGTLNLVNLTALPNLQNLYLQGNYFSSGGDSSGSDCYLQVLDLSSNSISDYSMVDYVFSKCSNLVSVNISNNKLVGKLGFAPSSLQSLTTVDLSYNILSDKIPESFISDFPASLKYLDLTHNNLSGDFSDLSFGICGNLTFFSLSQNNLSGDKFPITLPNCKFLETLNISRNNLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGNTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPMELGKCKSLKTIDLSFNELTGPIPKEIWMLPNLSDLVMWANNLTGTIPEGVCVKGGNLETLILNNNLLTGSIPESISRCTNMIWISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEGIRAERLERLPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAVSGFIPPGYGNMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIPFGGQLTTFPVSRYANNSGLCGVPLRPCGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase BRI1-like 1
publication title Structural basis for differential recognition of brassinolide by its receptors
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 246
structure length 724
sequence length 727
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.310 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4j0mA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4j0mA01
4HQ1A 2UZXA 4LXRA 2CA6A 3VQ1A 3P72A 2JE0A 4EZGA 3OGKB 4R6FA 4BSSA 2Q4GW 2Z82A 4FHOA 1K5GC 4AY9X 4PEQB 3E3ZA 4PQ8A 2WQVA 5AZ5A 2JQDA 3W3NA 3O6NA 3WN4A 3G39A 4Q62A 4H09A 4Z64C 4R09A 2Z62A 2P1PB 4B8CD 1M9LA 2FT3A 2O6QA 1ZIWA 2OMUA 1P8VA 3UL8A 3UL7A 3OJAB 2OMYA 3G04C 4RWTC 4WP6A 5B4PA 1M10B 1O6VA 4XOSA 3WPIA 3WPEA 5B0TA 4L3AA 1A9NA 1U0ND 1KOOA 3GOZA 4CC4A 4NKGA 1O6SA 3TSRE 4NKHA 1M9SA 4M7EA 2A0ZA 1OOKG 3C6NB 3G06A 5B0NA 3REZA 4Y61B 4QBZA 2RR6A 4FCGA 5A5CA 2P1NB 5AWDA 3ZYOA 4V2DA 4FMZA 4P8SA 5D3IA 4CNCA 4LSXC 3UN9A 2Z65A 2XWTC 3ZYIA 3CIGA 1DFJI 1YRGA 4FS7A 4U06A 2Y5QA 4KXFB 4R07A 3G3BA 4P91A 1A4YA 3OGLB 2V70A 3OJAA 4MN8B 5GMHA 1Z7XW 5LFNA 3RGZA 2OMWA 5FTTB 2WQWA 2Z63A 3RGXA 4I6JB 4R6JA 2JE1A 1FQVA 2V9TB 2V9SA 2ELLA 1XCDA 3RFJA 4LSAA 4Z8GA 1G9UA 4OQTA 4J0MA 4ECNA 2R9UA 4AW4A 4R08A 3RJ0A 3RFSA 5GS2B 1OTMA 4V2CA 4RCWA 3C6OB 3RW7A 4BSUA 1WWLA 4KT1A 2P1MB 4LSCA 3KJ4A 3W3KA 1O6TA 1FS2A 4R58A 5HDHA 4PKIG 2Z7XB 3A79B 4BV4R 5IJDA 4MQWX 4YEBB 3RW6A 4CC4C 2WFHA 1QYYA 3UL9A 1K5DC 3JB9j 1LTXA 4PERA 4M7EC 3RIZA 4PSJA 1H6TA 1FT8A 1DCEA 1OTOA 4TZHA 4IM6A 5CMNA 1FO1A 3OGMB 3W3GA 3G3AA 4GT6A 3ZYNA 1KOHA 1GWBA 3CVRA 3WPFA 2BEXA 1DS9A 3W3JA 4R6AA 4GLPA 5IYXC 4C2AB 2P1QB 3RFEA 2WQXA 4LI1A 3PMHG 4XSQA 4V2EA 2Z7XA 3ULAA 3M19A 4XGOA 4WYKA 4CILA 3ULVA 2P1OB 4Z94G 5GMGA 1OGQA 3WPCA 5AWCA 3WPHA 4Q3IA 5IJCA 3BZ5A 4Z61C 3M18A 2Z81A 2IFGA 3SB4A 4ARNA 5GQRK 4L3FA 3WPDA 4Z79A 2OMVA 2ID5A 1H6UA 1D0BA 4U09A 2XOTA 1XEUA 2Z66A 1XWDC 3ZYJA 4CNMA 1PGVA 5GMFA 3ULUA 1SQ0B 2OMTA 3WPBA 4G8AA 4C2BB 5HZLB 5CMPA 4LXSA 1M0ZA 2BNHA 3W3LA 2O6RA 5GS0A 1XECA 5AWAA 4LI2A 2OMXA 2O6SA 1XKUA 4FD0A 3E6JA 4RCAB 4KNGA 4R5CA 4R5DA 1P8TA 3CIYA 3VQ2A 4K17A 2ASTB 2RA8A 2WQUA 4J4LA 4QXEA 5IJBA 1P9AG 3DZEA 4Q3GA 4BSRA 2Z64A 4R0AA 3E2JA 4LSXA 4U08A 4UFRA 4QC0A 2OMZA 5AWBA 2UZYA 3O53A 2ASSB 3W3MA 3E4GA 4CP6A 3WPGA 4FDWA 1W8AA 1IO0A 1OTNA 3FXIA 4ECOA 4ARRA 1OZNA 4R6GA 1JL5A 4U7LA 3C6PB
chains in the Genus database with same CATH superfamily
4HQ1A 4YJ3F 3KXYT 3WNZA 4IRDA 5IT9W 3V6HA 2Q2TA 4Q0YA 4LF8H 2Z82A 4FHOA 1RK5A 4DL7A 2C35B 4YQWA 3QZ7A 4A3CG 5JVLA 2WE6A 5AZ5A 2UXCH 3HOZG 4DUZH 2XCAA 3MR2A 1TWAA 1UC8A 2O6QA 2R93A 1P8VA 2W6OA 4DL6A 2OMYA 5A2QW 4TV8F 3G04C 4WP6A 5C5JA 3WPIA 2VPSA 3PN1A 4L3AA 2UUBH 3GOZA 2HGSA 4CC4A 3MFIA 2W9CA 2HVQA 3K5IA 4MV4A 4NKHA 2V58A 2HHHH 3C6NB 1HNXH 2W8KA 2B63G 3JRWA 5J2TF 2FLLA 4P8SA 1A0IA 4LSXC 1B6RA 1N32H 4O2BF 3N8DA 2DZDA 3RUPA 4EBDA 1ZETA 5T14A 5KG6A 2R8GA 4P91A 1GSOA 3N41B 4MN8B 4DR4H 1CS0A 5KT2A 5LFNA 2C2DA 3RGZA 3GLKA 5FTTB 2WQWA 5KFJA 3GTPA 2ELLA 3KALA 4OQTA 2DIKA 4YBZB 4TQSA 3RFSA 3KHLA 4BSUA 1M7JA 4IWYA 3L2PA 4KT1A 1S97A 3KJ4A 1RK6A 1FS2A 3MWEA 3A79B 2HJWA 2YU9A 3MR5A 4ZI7F 2HVRA 5IJDA 4O3OA 2RDJA 1RJPA 3RW6A 4CC4C 4O4HF 4NZRM 1Z2NX 4LFBH 2VUMG 1K5DC 1GSAA 1GLVA 2Y0SA 4C5CA 4QWAA 4A3FG 1C30A 4TUYF 4O2AF 4QWBA 2UUCH 5IYDG 1OTOA 2R8JA 3PW7A 1CQJB 2YS7A 4IM6A 5CMNA 2PVPA 5KG1A 1S9FA 3PW0A 2V5AA 3WPFA 3DF7A 1UC9A 3V6KA 2R92A 5KFRA 3GTQA 2P1QB 5KX5F 1XNRH 1A9XA 4Q43A 3H3VH 3ULVA 1VBGA 4LF4H 1OGQA 1KJ8A 4J9SA 3WPCA 4A3EG 2YZMA 2V4RA 1DV1A 5C4XG 4R8UB 1O75A 5AWCA 3TQ1A 3WPHA 2JA8G 5KFXA 1Y1WG 3T1HH 4Z61C 5IYCG 3SB4A 4IR1A 4EBCA 1ZHQA 3BQ2A 3HOXG 5KFMA 3TIIA 1IBLH 1CE8A 5IP9G 2R7KA 1HNWH 1FJGH 3GTMA 2VQDA 4FS2A 4JI0H 5KFLA 3TINA 3PVXA 1H6UA 2YL2A 4K0KH 2NVXA 1HNZH 4U09A 4X66H 2R8HA 1XWDC 2B63A 1PGVA 3BQ1A 3RB3A 5KG5A 4ME6A 1SQ0B 4A3IG 2OMTA 3J80W 2YCHA 4B3SH 2R86A 1BGWA 2FPGB 5KFVA 4ECXA 4ED0A 3RAQA 4O3PA 5I47A 2GPSA 4DV4H 4C2BB 5EOYA 4I55F 1BXRA 3PW2A 2V59A 3W3LA 3UFXB 4LI2A 1M0WA 4JV1A 2OMXA 5KT4A 2JEIA 1UNNC 3Q2OA 4KHPH 4FD0A 5EZYF 3E6JA 4KNGA 3FKIG 3E5NA 5C8YF 3M9NB 4DR5H 4NXMH 4K17A 1SEIA 5J2UF 3GV8B 2ASTB 4J4LA 5IJBA 3GIIA 4EGQA 3VPCA 4DV3H 4XZ3B 1P9AG 4XX0B 3DZEA 2J9GA 1C3OA 1TA8A 3N40P 1RJQA 4JI3H 4R0AA 4Y8VB 3RV4A 2J6TA 2OMZA 4DLKA 3CQZA 1T3NA 4Q44A 3O53A 2WYOA 2WTFA 3RAXA 2W57A 4X65H 3FXIA 3GILA 4A3BG 1I6UA 1M6VA 4DL4A 2FLPA 4TQRA 1BJTA 1DV2A 4JI1H 4R6GA 3GIDA 2VUMA 1VBHA 2CKZB 4B3TH 5KFHA 3R5HA 2UZXA 3BA8A 4RB1A 3VQ1A 2JE0A 2IA6A 2Q4GW 5KFGA 4LF5H 2YS6A 3GIMA 4PEQB 4FBUA 5L1JA 5CB4F 4ED7A 3W3NA 4QWDA 2W71A 1WCMG 1MZBA 2FPPB 4Q62A 2Z62A 3Q8PB 3G6VA 1ZIWA 3C0FB 4EYIB 3M4IA 3N43B 3PW5A 5KT6A 4RWTC 1O6VA 2PN1A 1FKAH 5B0TA 2XCPA 1A9NA 3ORQA 4ED6A 2FE3A 4NKGA 3H4DA 4U6PA 2JEGA 1Y1WA 1EHIA 3GTLA 1M9SA 2R82A 2R84A 3HBLA 4YHHH 3T1YH 4ECZA 2ASJA 2R87A 5A5CA 3ZYOA 2WAQE 3WO1A 4FMZA 4V2DA 4LH6A 3OSNA 4CNCA 2YZGA 5KFFA 4DR1H 5KFDA 3FMAA 2NVYA 5L9XA 4CC6A 1N34H 3G3BA 5L1LA 1A4YA 3H20A 5DG9A 3OJAA 2XD4A 3ORRA 1VAJA 3HKZE 2QK4A 2W9BB 3V6JA 4WD3A 2M05A 2VUGA 4ZHQF 3V4SA 4I6JB 4A3JG 3K3PA 5DLGA 1FQVA 2R92G 4GC7A 3RFJA 1T94A 4ECNA 4AW4A 4DR2H 4YJ2F 1GSHA 3FKIA 3RW7A 3R23A 2W6NA 1GGOA 3PW4A 1WWLA 2C22A 3U9SA 2YW2A 3GV5B 4G3IA 3K5HA 4MTEA 4R58A 2I8CA 4Q8FA 1EYZA 3JZIA 2OWOA 2ALZA 4DV5H 4MQWX 4UCRA 2WFHA 4MAMA 3V4ZA 3UL9A 3GTJA 3JB9j 4MV6A 3RIZA 4PSJA 4ECQA 1DCEA 2JA6G 4HYKA 2XC9A 2AGOA 1FO1A 4JUZA 4GT6A 4GKKH 4C5AA 1JKJB 2BEXA 1I7NA 4J9OA 4R6AA 5IYXC 2XCLA 5DQGA 4EG0A 4ED3A 4DV1H 2WQXA 4LI1A 3HOVG 4XSQA 2Z7XA 3ULAA 3EYYA 4CILA 5LXTF 5KFNA 4Z94G 3R5XA 5GMGA 4O3RA 2AGQA 2W6MA 3K3VA 1WCMA 5KT7A 4Q3IA 4YB8B 5F9LA 4J9RA 3MR3A 4L3FA 3N42B 2ASLA 4J9QA 2UXBH 1B6SA 5HV6A 4Z79A 4BY1G 3EPIA 1E4GT 5D1OA 3T5HA 1E4FT 2FLNA 2ZDGA 5JVDF 2DLNA 2ATLA 1XEUA 5C1PA 2FK3A 3ZYJA 1KJJA 1PK8A 1L2ZA 5KFUA 2PBZA 2UXDH 1CQIB 1V9PA 4JI7H 2FK1A 4JI6H 5HZLB 3L4KA 4YY3H 4DV7H 4O4LF 1M0ZA 1B33N 2FJZA 1N48A 4C2MA 2O6RA 5GS0A 1XECA 1VS0A 1KJIA 3BA9A 4M9UA 4RB3C 1KBLA 3GIQA 4JI5H 1XMOH 5FPOA 3JSNA 3RFCA 2WB1E 1SYXB 1I3QA 4OX9H 1SCUB 4RNNA 4AQYH 3WO0A 4RCAB 4R5CA 5IYBG 4R5DA 3CIYA 3VQ2A 2WQUA 2BR0A 1BNCA 4BY7G 4YR3A 4EEQA 4HNTA 1XDNA 4BSRA 2NUAB 2Z64A 2YRXA 3HOYG 4U08A 4EYHB 4UFZA 4QC0A 3UQ8A 3OTOH 2E2HA 2C00A 2W7OA 4B3RH 4FDWA 3GIKA 1W8AA 2RF4A 2R7ZG 1N36H 2VQFH 3GTOA 5DG8A 1JL5A 2W70A 2JA7A 4U7LA 2WAQA 5LMNH 3RB0A 2CA6A 4EEYA 3JSLA 4ED2A 2JA6A 4A3LG 4ED1A 4BSSA 4I4TF 1IBKH 1K5GC 4X62H 4RAZA 4MTDA 4AY9X 1S03G 1N33H 5L1KA 2VA2A 3MWDA 4RAYA 4LF9H 5KFEA 2JQDA 2FPIB 3HKZA 5D8DA 5DLFA 3WN4A 3G39A 4R7RA 4H09A 1Z2OX 4R09A 2AU0A 3TIGA 3PR5B 1M9LA 2OMUA 2XGPA 2FP4B 1KEEA 2SCUB 5H80A 3UL8A 3HOWG 3OJAB 3GQCA 5KFWA 1E4EA 5FD5A 4ECUA 1M10B 4XOSA 2VPQA 4A93G 1U0ND 2UVRA 1KOOA 1AUVA 1TWHA 5GONF 3H40A 4EFBA 2A0ZA 3RB4A 3H0GG 3G06A 5B0NA 3REZA 1N56A 4Y61B 4RZRA 2R8IA 2UVWA 2RR6A 4L1KA 3N6XA 1V51A 1GYFA 4XYMB 2Z65A 2XWTC 1JXLA 1DFJI 4U06A 2MCTA 2Y5QA 1W93A 5D1PA 1DIKA 4NZTM 5LOVF 3OGLB 2V70A 1S0NA 4RNMA 5C3EG 4YAKB 2YYAA 4IRKA 2VQEH 5C1OA 1TAEA 2NU7B 5GMHA 1HR0H 2XIGA 4IRCA 1T36A 1Z7XW 4RB0A 2IP4A 4WBNF 5KFKA 1XNQH 5EWEA 2Z63A 3RGXA 4YR2A 2W9CB 3BJYA 1Z2PX 1PX2A 5KKNB 4GKJH 1EUDB 2V9TB 4JV0A 2V9SA 2GLTA 4ETSA 4LSAA 1G9UA 4J0MA 4EGJA 3KTMA 4R08A 2FKLA 2JA5G 5GS2B 1OTMA 4RCWA 3C6OB 1ZHSA 3JRXA 4PWQA 1O6TA 1JX4A 4PKIG 2Z7XB 4BV4R 2BQUA 5BR8H 5L1IA 4JYAH 3RF2A 3OUUA 5FLMG 3N44B 2YRWA 2ZDHA 4RU9A 1FVIA 2W6QA 1W96A 3H4BA 2R85A 3MFHA 2W6ZA 3GIJA 4HNUA 4ECWA 4IWXA 4X64H 3GV7B 2DPJA 1LTXA 2W8LA 4UCTA 2W6PA 1Y14B 2QYZA 2R7ZA 5FPRA 1FT8A 1H6TA 3T5JA 2C2RA 3OGMB 2RGVA 5FLXW 3G3AA 2ZM6H 3ZYNA 2UUAH 1GWBA 5CA0F 4A2AA 2R7LA 5KG7A 4FU0A 5KT5A 3W3JA 4J9NA 4ZQIA 4C2AB 3RFEA 3LWBA 4V2EA 3RV3A 3QFFA 2FMAA 4XGOA 1S0OA 4MA0A 1RJRA 1RYSA 2RGRA 1B04A 2V4QA 4F50A 2WB1A 3TQTA 5LL6b 3BZ5A 3M18A 2Z81A 3IG0A 4ARNA 2R7MA 1ULZA 4RZQA 1XMQH 2OMVA 5DQIA 2NU9B 5K2MA 4F4WA 2OLSA 3H0GA 3I12A 5LMUH 4QIWE 4ZOLF 1K1QA 3ULUA 3BABA 3WPBA 5KFSA 4JI8H 4GLXA 2ASDA 3SI8A 1K83A 5CMPA 1WSCA 4NXNH 4AYBE 4A3MG 1I7LA 4LXSA 5KG2A 2XGQA 5JH7F 5IYZF 3BG5A 2BNHA 2VA3A 2JA7G 4A3KG 1I94H 4ECYA 4HQ6A 4DL3A 4IHJF 1XKUA 4YAJB 4DUYH 2AGPA 4F4XA 3JAMW 4PDBA 4MA5A 2JEJA 2DWCA 3PZPA 3IN5A 4QW8A 1P8TA 4Q45A 2RA8A 4QXEA 3GIPA 2C28A 2HVSA 2JA5A 3RBDA 3R5FA 4JI4H 4Q3GA 3AYHB 1AUXA 3OSPA 4J9LA 1I50A 5KFOA 4RUCA 4DR7H 2R8KA 4UCUA 1OWTA 1JLLB 4O3NA 2C2EA 4CC5A 2ASSB 3Q1KA 4DV6H 1K1SA 3E4GA 1J5EH 1EZ1A 4CP6A 3G6XA 3RB6A 1IO0A 3KAJA 1OTNA 3J81W 4ARRA 3HB9A 3MR6A 1E4EB 4F4YA 4LH7A 1Y1VG 4O4IF 5LP6F 1VKZA 1IOVA 4LF6H 5KG0A 1KJQA 2IMWP 2O03A 4NLGA 4MV3A 4DV0H 4GC6A 4LXRA 2PMZE 3P72A 3LP8A 2E5LH 4EZGA 3OGKB 4R6FA 5F9NA 2WDTA 4ECVA 4MV7A 4BXXG 3E3ZA 3VPBA 4PQ8A 4LMYA 4XYLB 3BQ0A 2WQVA 3FDSA 4F4ZA 4O3QA 4LF7H 3O6NA 5KFCA 3LMLA 3KHGA 4Z64C 2P1PB 4RNOA 4B8CD 2FT3A 3OUZA 1S10A 3HOUG 4Q8EA 3Q8RB 3UL7A 2W9BA 4MV8A 5B4PA 3WPEA 2W9AA 2ZJTA 1O6SA 2V9WA 4I50F 3TSRE 5KFAA 5KFIA 5KFYA 4QWCA 5DQHA 1DGSA 4M7EA 3VMMA 1OOKG 4ECRA 4A2BA 4JV2A 2VR1A 2DPIA 4A3GG 4QBZA 3QZ8A 4FCGA 1TWFA 5KFZA 2P1NB 3G6YA 5AWDA 4HNVA 5D3IA 5EWFA 4A3DG 3CVZA 3UN9A 3MWMA 2FB9A 1WR2A 3KHHA 4J9MA 3ZYIA 3CIGA 4JI2H 2OH2A 1YRGA 4FS7A 2I80A 4KXFB 4R07A 4FS1A 1KJ9A 1ZQ7A 5KFQA 3VPDA 5HBRB 2UVUA 2UVVA 3T5KA 2J6UA 1WH2A 1TWGA 3I4NG 5FJ8G 5KFPA 2ZDQA 4HR7A 4O3SA 2OMWA 3ETHA 4BBRG 4E4TA 5EDWA 4APMA 4UCSA 5DGBA 4R6JA 1R9TA 2JE1A 2UU9H 2R6FA 1P8LA 1TWCA 1XCDA 1S0MA 3M9MB 4Z8GA 2R9UA 1RYRA 4QJFA 3RJ0A 3GTGA 5C44G 4EBEA 4LFCH 4V2CA 4MV9A 3RTXA 5BPFA 2P1MB 4LSCA 5IP7G 3W3KA 5HDHA 5DGAA 3OHAA 2P0AA 4YEBB 2E2IA 1QYYA 4LFAH 4PERA 4M7EC 2BQRA 1M0TA 4TZHA 2NU6B 3EPGA 3W3GA 1Y1VA 4QIWA 1KOHA 4TV9F 4FM9A 5CAEB 2FK2A 2Q2UA 3CVRA 5KFBA 4QWEA 2AQ4A 1DS9A 3Q8SB 4GLPA 4FBTA 5JQWA 4DR3H 2IBKA 5DG7A 1JDBB 3PMHG 1KC7A 4UCOA 4AYBA 3M19A 3MJFA 4WYKA 4U7CA 4EFEA 2R93G 2CZGA 2P1OB 1SFOA 4IR9A 2BQ3A 4J9PA 4ED8A 4IAJA 4B3MH 3G8CA 2R7NA 2J6SA 5IJCA 2IFGA 4RUAA 3KHRA 3BAAA 1IBMH 5GQRK 4MV1A 3Q8QB 4QW9A 3WPDA 3PO3G 4UCVA 3J7AK 2Y0SE 2GPWA 2CW8A 1IOWA 2ID5A 1X9NA 5EWGA 3ETJA 4YR0A 1D0BA 4DR6H 2XOTA 1S68A 2Z66A 5IWAH 5KT3A 4CNMA 5KFTA 3RBEA 2RDIA 3F8NA 4JV5H 5GMFA 2CW7A 2VOBA 4G8AA 5CA1F 2CQYA 4DL5A 3U9TA 4R8UA 4I7HA 4DL2A 1JDEA 4ECSA 3I4MG 5BMVF 4J9KA 4IZOA 3L4JA 5AWAA 3HXLA 4DV2H 2I87A 2O6SA 2PMZA 2KSWA 5LYJF 3PO2G 5LA6F 5BPHA 5D1OB 5KG3A 4BWSC 4BBSG 5KG4A 2JEFA 4C5BA 1AN7A 1V4YA 3PR4A 2YZNA 3M9OB 4ECTA 2X0SA 5JUMA 2F4VH 3E2JA 4LSXA 3OHBA 4UFRA 5AWBA 2UZYA 3GTKA 3SE7A 3W3MA 3T5LA 3KAKA 3WPGA 1JIHA 4ECOA 5FD6A 3NGDA 2W7PA 2NU8B 1GO3E 1OZNA 4RB2C 1EUCB 4YP3A 3C6PB
chains in the Genus database with same CATH topology
4HQ1A 2UZXA 4LXRA 2CA6A 3BA8A 4RB1A 3KXYT 3JSLA 3VQ1A 3P72A 2JE0A 2E5LH 5IT9W 4EZGA 2Q2TA 3OGKB 4R6FA 4Q0YA 4BSSA 4LF8H 2Q4GW 2Z82A 1IBKH 4FHOA 4LF5H 1K5GC 4X62H 4RAZA 2WDTA 4MTDA 4AY9X 4MV7A 4PEQB 1S03G 3E3ZA 4PQ8A 1N33H 4LMYA 2WQVA 2WE6A 5AZ5A 4RAYA 4LF9H 2JQDA 4LF7H 3W3NA 2UXCH 3O6NA 3WN4A 3G39A 1MZBA 4DUZH 3LMLA 4R7RA 4Q62A 4H09A 1Z2OX 4Z64C 4R09A 2Z62A 2P1PB 4B8CD 1M9LA 2FT3A 2O6QA 1ZIWA 2OMUA 1P8VA 3C0FB 3UL8A 3M4IA 3N43B 3UL7A 3OJAB 2OMYA 5A2QW 3G04C 4RWTC 5FD5A 4WP6A 5B4PA 1M10B 1O6VA 4XOSA 3WPIA 2VPSA 3PN1A 3WPEA 1FKAH 5B0TA 4L3AA 1A9NA 1U0ND 2UUBH 1KOOA 2FE3A 3GOZA 2HGSA 4CC4A 4NKGA 2ZJTA 1O6SA 2HVQA 3TSRE 4EFBA 1M9SA 1DGSA 4M7EA 4NKHA 2A0ZA 2HHHH 4YHHH 3T1YH 1OOKG 3C6NB 1HNXH 4A2BA 3G06A 5B0NA 3REZA 4Y61B 4QBZA 2RR6A 4FCGA 5A5CA 2P1NB 5AWDA 3N6XA 3ZYOA 4V2DA 4FMZA 4P8SA 4LH6A 5D3IA 1GYFA 4CNCA 1A0IA 3CVZA 4LSXC 3UN9A 3MWMA 1N32H 2Z65A 4DR1H 2XWTC 3ZYIA 3CIGA 1DFJI 4JI2H 3FMAA 1YRGA 4FS7A 4U06A 2MCTA 2Y5QA 4KXFB 4R07A 4CC6A 1N34H 3G3BA 5D1PA 4P91A 1A4YA 3OGLB 2V70A 3H20A 3OJAA 3N41B 4MN8B 4DR4H 1WH2A 2VQEH 1TAEA 5GMHA 1HR0H 2XIGA 1Z7XW 5LFNA 4RB0A 2VUGA 3RGZA 2OMWA 1XNQH 5FTTB 2WQWA 2Z63A 3RGXA 4APMA 4UCSA 4I6JB 4R6JA 2JE1A 1Z2PX 2UU9H 1FQVA 4GKJH 2V9TB 1P8LA 2V9SA 2ELLA 1XCDA 3RFJA 4ETSA 4LSAA 4Z8GA 3KALA 1G9UA 4OQTA 4J0MA 4ECNA 2R9UA 4AW4A 4DR2H 4R08A 3RJ0A 3RFSA 5GS2B 1OTMA 4LFCH 4V2CA 4RCWA 3C6OB 1ZHSA 4MV9A 3RTXA 3RW7A 4BSUA 1WWLA 3L2PA 4KT1A 2P1MB 4LSCA 3KJ4A 3W3KA 1O6TA 1FS2A 4MTEA 4R58A 5HDHA 4PKIG 2Z7XB 3A79B 2OWOA 4BV4R 2HVRA 4DV5H 5BR8H 5IJDA 4JYAH 3RF2A 4MQWX 3N44B 4UCRA 1FVIA 4YEBB 3RW6A 4CC4C 1Z2NX 2WFHA 1QYYA 3UL9A 4LFAH 4LFBH 4X64H 1K5DC 3JB9j 1LTXA 4PERA 4M7EC 4UCTA 3RIZA 4PSJA 1H6TA 1M0TA 5FPRA 1FT8A 1DCEA 2UUCH 1OTOA 4TZHA 4IM6A 5CMNA 1FO1A 3OGMB 3W3GA 2RGVA 5FLXW 3G3AA 2ZM6H 4GT6A 3ZYNA 1KOHA 2UUAH 4GKKH 1GWBA 4FM9A 2Q2UA 3CVRA 4A2AA 3WPFA 3DF7A 2BEXA 1DS9A 3W3JA 4R6AA 4GLPA 4DR3H 5IYXC 4C2AB 2P1QB 4DV1H 3RFEA 2WQXA 4LI1A 3PMHG 4XSQA 4V2EA 2Z7XA 3ULAA 1XNRH 4UCOA 3EYYA 3M19A 4XGOA 4WYKA 4CILA 4EFEA 2RGRA 3ULVA 2P1OB 4Z94G 4LF4H 5GMGA 1OGQA 1B04A 3WPCA 3K3VA 4IAJA 4B3MH 1O75A 5AWCA 3WPHA 4Q3IA 5LL6b 5IJCA 3T1HH 3BZ5A 4Z61C 3M18A 2Z81A 2IFGA 3SB4A 1ZHQA 3IG0A 3BAAA 4ARNA 1IBMH 5GQRK 4L3FA 3N42B 2UXBH 3WPDA 1IBLH 4UCVA 3J7AK 4Z79A 1E4GT 4RZQA 5D1OA 2CW8A 1XMQH 2OMVA 1HNWH 1FJGH 1E4FT 1X9NA 2ID5A 4JI0H 1H6UA 4K0KH 1D0BA 1HNZH 4DR6H 4U09A 4X66H 2XOTA 1S68A 1XEUA 5LMUH 2Z66A 5IWAH 1XWDC 3ZYJA 4CNMA 1PGVA 1L2ZA 3F8NA 4JV5H 5GMFA 3ULUA 2UXDH 1SQ0B 3BABA 3J80W 2OMTA 2YCHA 3WPBA 4B3SH 1V9PA 1BGWA 2CW7A 4JI8H 4GLXA 4JI7H 2VOBA 4G8AA 4JI6H 4DV4H 4C2BB 5HZLB 5EOYA 5CMPA 3L4KA 4I7HA 4NXNH 4YY3H 4DV7H 4LXSA 1M0ZA 3L4JA 2BNHA 3W3LA 2O6RA 5GS0A 1XECA 1VS0A 5AWAA 4LI2A 3BA9A 1I94H 4RB3C 3HXLA 1M0WA 4DV2H 4JI5H 1XMOH 2OMXA 5FPOA 3JSNA 2O6SA 1SYXB 4OX9H 4KHPH 1XKUA 2KSWA 4FD0A 3E6JA 4AQYH 4DUYH 3JAMW 4RCAB 4KNGA 4PDBA 5D1OB 4R5CA 4BWSC 4R5DA 4DR5H 1AN7A 4NXMH 1P8TA 3CIYA 3VQ2A 4K17A 1SEIA 2ASTB 2RA8A 2WQUA 4J4LA 4QXEA 5IJBA 4DV3H 2HVSA 1P9AG 3DZEA 4EEQA 1XDNA 1TA8A 4JI4H 4Q3GA 4BSRA 3N40P 2Z64A 4JI3H 2F4VH 4R0AA 3E2JA 4LSXA 4DR7H 4U08A 4UFRA 4UFZA 4UCUA 4QC0A 2OMZA 5AWBA 2UZYA 4CC5A 3O53A 3UQ8A 2ASSB 4DV6H 2WYOA 3OTOH 3W3MA 3E4GA 1J5EH 4CP6A 3KAKA 4B3RH 3WPGA 4FDWA 2W57A 1W8AA 1IO0A 3KAJA 1OTNA 4X65H 3FXIA 4ECOA 1I6UA 1N36H 3J81W 4ARRA 5FD6A 1BJTA 2VQFH 4LH7A 1OZNA 4JI1H 4R6GA 4RB2C 1JL5A 4LF6H 4B3TH 2O03A 4U7LA 4DV0H 5LMNH 3C6PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQ1 A;  2UZX A;  4LXR A;  2CA6 A;  3VQ1 A;  3P72 A;  2JE0 A;  4EZG A;  3OGK B;  4R6F A;  4BSS A;  2Q4G W;  2Z82 A;  4FHO A;  1K5G C;  4AY9 X;  4PEQ B;  3E3Z A;  4PQ8 A;  2WQV A;  5AZ5 A;  2JQD A;  3W3N A;  3O6N A;  3WN4 A;  3G39 A;  4Q62 A;  4H09 A;  4Z64 C;  4R09 A;  2Z62 A;  2P1P B;  4B8C D;  1M9L A;  2FT3 A;  2O6Q A;  1ZIW A;  2OMU A;  1P8V A;  3UL8 A;  3UL7 A;  3OJA B;  2OMY A;  3G04 C;  4RWT C;  4WP6 A;  5B4P A;  1M10 B;  1O6V A;  4XOS A;  3WPI A;  3WPE A;  5B0T A;  4L3A A;  1A9N A;  1U0N D;  1KOO A;  3GOZ A;  4CC4 A;  4NKG A;  1O6S A;  3TSR E;  4NKH A;  1M9S A;  4M7E A;  2A0Z A;  1OOK G;  3C6N B;  3G06 A;  5B0N A;  3REZ A;  4Y61 B;  4QBZ A;  2RR6 A;  4FCG A;  5A5C A;  2P1N B;  5AWD A;  3ZYO A;  4V2D A;  4FMZ A;  4P8S A;  5D3I A;  4CNC A;  4LSX C;  3UN9 A;  2Z65 A;  2XWT C;  3ZYI A;  3CIG A;  1DFJ I;  1YRG A;  4FS7 A;  4U06 A;  2Y5Q A;  4KXF B;  4R07 A;  3G3B A;  4P91 A;  1A4Y A;  3OGL B;  2V70 A;  3OJA A;  4MN8 B;  5GMH A;  1Z7X W;  5LFN A;  3RGZ A;  2OMW A;  5FTT B;  2WQW A;  2Z63 A;  3RGX A;  4I6J B;  4R6J A;  2JE1 A;  1FQV A;  2V9T B;  2V9S A;  2ELL A;  1XCD A;  3RFJ A;  4LSA A;  4Z8G A;  1G9U A;  4OQT A;  4J0M A;  4ECN A;  2R9U A;  4AW4 A;  4R08 A;  3RJ0 A;  3RFS A;  5GS2 B;  1OTM A;  4V2C A;  4RCW A;  3C6O B;  3RW7 A;  4BSU A;  1WWL A;  4KT1 A;  2P1M B;  4LSC A;  3KJ4 A;  3W3K A;  1O6T A;  1FS2 A;  4R58 A;  5HDH A;  4PKI G;  2Z7X B;  3A79 B;  4BV4 R;  5IJD A;  4MQW X;  4YEB B;  3RW6 A;  4CC4 C;  2WFH A;  1QYY A;  3UL9 A;  1K5D C;  3JB9 j;  1LTX A;  4PER A;  4M7E C;  3RIZ A;  4PSJ A;  1H6T A;  1FT8 A;  1DCE A;  1OTO A;  4TZH A;  4IM6 A;  5CMN A;  1FO1 A;  3OGM B;  3W3G A;  3G3A A;  4GT6 A;  3ZYN A;  1KOH A;  1GWB A;  3CVR A;  3WPF A;  2BEX A;  1DS9 A;  3W3J A;  4R6A A;  4GLP A;  5IYX C;  4C2A B;  2P1Q B;  3RFE A;  2WQX A;  4LI1 A;  3PMH G;  4XSQ A;  4V2E A;  2Z7X A;  3ULA A;  3M19 A;  4XGO A;  4WYK A;  4CIL A;  3ULV A;  2P1O B;  4Z94 G;  5GMG A;  1OGQ A;  3WPC A;  5AWC A;  3WPH A;  4Q3I A;  5IJC A;  3BZ5 A;  4Z61 C;  3M18 A;  2Z81 A;  2IFG A;  3SB4 A;  4ARN A;  5GQR K;  4L3F A;  3WPD A;  4Z79 A;  2OMV A;  2ID5 A;  1H6U A;  1D0B A;  4U09 A;  2XOT A;  1XEU A;  2Z66 A;  1XWD C;  3ZYJ A;  4CNM A;  1PGV A;  5GMF A;  3ULU A;  1SQ0 B;  2OMT A;  3WPB A;  4G8A A;  4C2B B;  5HZL B;  5CMP A;  4LXS A;  1M0Z A;  2BNH A;  3W3L A;  2O6R A;  5GS0 A;  1XEC A;  5AWA A;  4LI2 A;  2OMX A;  2O6S A;  1XKU A;  4FD0 A;  3E6J A;  4RCA B;  4KNG A;  4R5C A;  4R5D A;  1P8T A;  3CIY A;  3VQ2 A;  4K17 A;  2AST B;  2RA8 A;  2WQU A;  4J4L A;  4QXE A;  5IJB A;  1P9A G;  3DZE A;  4Q3G A;  4BSR A;  2Z64 A;  4R0A A;  3E2J A;  4LSX A;  4U08 A;  4UFR A;  4QC0 A;  2OMZ A;  5AWB A;  2UZY A;  3O53 A;  2ASS B;  3W3M A;  3E4G A;  4CP6 A;  3WPG A;  4FDW A;  1W8A A;  1IO0 A;  1OTN A;  3FXI A;  4ECO A;  4ARR A;  1OZN A;  4R6G A;  1JL5 A;  4U7L A;  3C6P B; 
#chains in the Genus database with same CATH topology
 4HQ1 A;  4YJ3 F;  3KXY T;  3WNZ A;  4IRD A;  5IT9 W;  3V6H A;  2Q2T A;  4Q0Y A;  4LF8 H;  2Z82 A;  4FHO A;  1RK5 A;  4DL7 A;  2C35 B;  4YQW A;  3QZ7 A;  4A3C G;  5JVL A;  2WE6 A;  5AZ5 A;  2UXC H;  3HOZ G;  4DUZ H;  2XCA A;  3MR2 A;  1TWA A;  1UC8 A;  2O6Q A;  2R93 A;  1P8V A;  2W6O A;  4DL6 A;  2OMY A;  5A2Q W;  4TV8 F;  3G04 C;  4WP6 A;  5C5J A;  3WPI A;  2VPS A;  3PN1 A;  4L3A A;  2UUB H;  3GOZ A;  2HGS A;  4CC4 A;  3MFI A;  2W9C A;  2HVQ A;  3K5I A;  4MV4 A;  4NKH A;  2V58 A;  2HHH H;  3C6N B;  1HNX H;  2W8K A;  2B63 G;  3JRW A;  5J2T F;  2FLL A;  4P8S A;  1A0I A;  4LSX C;  1B6R A;  1N32 H;  4O2B F;  3N8D A;  2DZD A;  3RUP A;  4EBD A;  1ZET A;  5T14 A;  5KG6 A;  2R8G A;  4P91 A;  1GSO A;  3N41 B;  4MN8 B;  4DR4 H;  1CS0 A;  5KT2 A;  5LFN A;  2C2D A;  3RGZ A;  3GLK A;  5FTT B;  2WQW A;  5KFJ A;  3GTP A;  2ELL A;  3KAL A;  4OQT A;  2DIK A;  4YBZ B;  4TQS A;  3RFS A;  3KHL A;  4BSU A;  1M7J A;  4IWY A;  3L2P A;  4KT1 A;  1S97 A;  3KJ4 A;  1RK6 A;  1FS2 A;  3MWE A;  3A79 B;  2HJW A;  2YU9 A;  3MR5 A;  4ZI7 F;  2HVR A;  5IJD A;  4O3O A;  2RDJ A;  1RJP A;  3RW6 A;  4CC4 C;  4O4H F;  4NZR M;  1Z2N X;  4LFB H;  2VUM G;  1K5D C;  1GSA A;  1GLV A;  2Y0S A;  4C5C A;  4QWA A;  4A3F G;  1C30 A;  4TUY F;  4O2A F;  4QWB A;  2UUC H;  5IYD G;  1OTO A;  2R8J A;  3PW7 A;  1CQJ B;  2YS7 A;  4IM6 A;  5CMN A;  2PVP A;  5KG1 A;  1S9F A;  3PW0 A;  2V5A A;  3WPF A;  3DF7 A;  1UC9 A;  3V6K A;  2R92 A;  5KFR A;  3GTQ A;  2P1Q B;  5KX5 F;  1XNR H;  1A9X A;  4Q43 A;  3H3V H;  3ULV A;  1VBG A;  4LF4 H;  1OGQ A;  1KJ8 A;  4J9S A;  3WPC A;  4A3E G;  2YZM A;  2V4R A;  1DV1 A;  5C4X G;  4R8U B;  1O75 A;  5AWC A;  3TQ1 A;  3WPH A;  2JA8 G;  5KFX A;  1Y1W G;  3T1H H;  4Z61 C;  5IYC G;  3SB4 A;  4IR1 A;  4EBC A;  1ZHQ A;  3BQ2 A;  3HOX G;  5KFM A;  3TII A;  1IBL H;  1CE8 A;  5IP9 G;  2R7K A;  1HNW H;  1FJG H;  3GTM A;  2VQD A;  4FS2 A;  4JI0 H;  5KFL A;  3TIN A;  3PVX A;  1H6U A;  2YL2 A;  4K0K H;  2NVX A;  1HNZ H;  4U09 A;  4X66 H;  2R8H A;  1XWD C;  2B63 A;  1PGV A;  3BQ1 A;  3RB3 A;  5KG5 A;  4ME6 A;  1SQ0 B;  4A3I G;  2OMT A;  3J80 W;  2YCH A;  4B3S H;  2R86 A;  1BGW A;  2FPG B;  5KFV A;  4ECX A;  4ED0 A;  3RAQ A;  4O3P A;  5I47 A;  2GPS A;  4DV4 H;  4C2B B;  5EOY A;  4I55 F;  1BXR A;  3PW2 A;  2V59 A;  3W3L A;  3UFX B;  4LI2 A;  1M0W A;  4JV1 A;  2OMX A;  5KT4 A;  2JEI A;  1UNN C;  3Q2O A;  4KHP H;  4FD0 A;  5EZY F;  3E6J A;  4KNG A;  3FKI G;  3E5N A;  5C8Y F;  3M9N B;  4DR5 H;  4NXM H;  4K17 A;  1SEI A;  5J2U F;  3GV8 B;  2AST B;  4J4L A;  5IJB A;  3GII A;  4EGQ A;  3VPC A;  4DV3 H;  4XZ3 B;  1P9A G;  4XX0 B;  3DZE A;  2J9G A;  1C3O A;  1TA8 A;  3N40 P;  1RJQ A;  4JI3 H;  4R0A A;  4Y8V B;  3RV4 A;  2J6T A;  2OMZ A;  4DLK A;  3CQZ A;  1T3N A;  4Q44 A;  3O53 A;  2WYO A;  2WTF A;  3RAX A;  2W57 A;  4X65 H;  3FXI A;  3GIL A;  4A3B G;  1I6U A;  1M6V A;  4DL4 A;  2FLP A;  4TQR A;  1BJT A;  1DV2 A;  4JI1 H;  4R6G A;  3GID A;  2VUM A;  1VBH A;  2CKZ B;  4B3T H;  5KFH A;  3R5H A;  2UZX A;  3BA8 A;  4RB1 A;  3VQ1 A;  2JE0 A;  2IA6 A;  2Q4G W;  5KFG A;  4LF5 H;  2YS6 A;  3GIM A;  4PEQ B;  4FBU A;  5L1J A;  5CB4 F;  4ED7 A;  3W3N A;  4QWD A;  2W71 A;  1WCM G;  1MZB A;  2FPP B;  4Q62 A;  2Z62 A;  3Q8P B;  3G6V A;  1ZIW A;  3C0F B;  4EYI B;  3M4I A;  3N43 B;  3PW5 A;  5KT6 A;  4RWT C;  1O6V A;  2PN1 A;  1FKA H;  5B0T A;  2XCP A;  1A9N A;  3ORQ A;  4ED6 A;  2FE3 A;  4NKG A;  3H4D A;  4U6P A;  2JEG A;  1Y1W A;  1EHI A;  3GTL A;  1M9S A;  2R82 A;  2R84 A;  3HBL A;  4YHH H;  3T1Y H;  4ECZ A;  2ASJ A;  2R87 A;  5A5C A;  3ZYO A;  2WAQ E;  3WO1 A;  4FMZ A;  4V2D A;  4LH6 A;  3OSN A;  4CNC A;  2YZG A;  5KFF A;  4DR1 H;  5KFD A;  3FMA A;  2NVY A;  5L9X A;  4CC6 A;  1N34 H;  3G3B A;  5L1L A;  1A4Y A;  3H20 A;  5DG9 A;  3OJA A;  2XD4 A;  3ORR A;  1VAJ A;  3HKZ E;  2QK4 A;  2W9B B;  3V6J A;  4WD3 A;  2M05 A;  2VUG A;  4ZHQ F;  3V4S A;  4I6J B;  4A3J G;  3K3P A;  5DLG A;  1FQV A;  2R92 G;  4GC7 A;  3RFJ A;  1T94 A;  4ECN A;  4AW4 A;  4DR2 H;  4YJ2 F;  1GSH A;  3FKI A;  3RW7 A;  3R23 A;  2W6N A;  1GGO A;  3PW4 A;  1WWL A;  2C22 A;  3U9S A;  2YW2 A;  3GV5 B;  4G3I A;  3K5H A;  4MTE A;  4R58 A;  2I8C A;  4Q8F A;  1EYZ A;  3JZI A;  2OWO A;  2ALZ A;  4DV5 H;  4MQW X;  4UCR A;  2WFH A;  4MAM A;  3V4Z A;  3UL9 A;  3GTJ A;  3JB9 j;  4MV6 A;  3RIZ A;  4PSJ A;  4ECQ A;  1DCE A;  2JA6 G;  4HYK A;  2XC9 A;  2AGO A;  1FO1 A;  4JUZ A;  4GT6 A;  4GKK H;  4C5A A;  1JKJ B;  2BEX A;  1I7N A;  4J9O A;  4R6A A;  5IYX C;  2XCL A;  5DQG A;  4EG0 A;  4ED3 A;  4DV1 H;  2WQX A;  4LI1 A;  3HOV G;  4XSQ A;  2Z7X A;  3ULA A;  3EYY A;  4CIL A;  5LXT F;  5KFN A;  4Z94 G;  3R5X A;  5GMG A;  4O3R A;  2AGQ A;  2W6M A;  3K3V A;  1WCM A;  5KT7 A;  4Q3I A;  4YB8 B;  5F9L A;  4J9R A;  3MR3 A;  4L3F A;  3N42 B;  2ASL A;  4J9Q A;  2UXB H;  1B6S A;  5HV6 A;  4Z79 A;  4BY1 G;  3EPI A;  1E4G T;  5D1O A;  3T5H A;  1E4F T;  2FLN A;  2ZDG A;  5JVD F;  2DLN A;  2ATL A;  1XEU A;  5C1P A;  2FK3 A;  3ZYJ A;  1KJJ A;  1PK8 A;  1L2Z A;  5KFU A;  2PBZ A;  2UXD H;  1CQI B;  1V9P A;  4JI7 H;  2FK1 A;  4JI6 H;  5HZL B;  3L4K A;  4YY3 H;  4DV7 H;  4O4L F;  1M0Z A;  1B33 N;  2FJZ A;  1N48 A;  4C2M A;  2O6R A;  5GS0 A;  1XEC A;  1VS0 A;  1KJI A;  3BA9 A;  4M9U A;  4RB3 C;  1KBL A;  3GIQ A;  4JI5 H;  1XMO H;  5FPO A;  3JSN A;  3RFC A;  2WB1 E;  1SYX B;  1I3Q A;  4OX9 H;  1SCU B;  4RNN A;  4AQY H;  3WO0 A;  4RCA B;  4R5C A;  5IYB G;  4R5D A;  3CIY A;  3VQ2 A;  2WQU A;  2BR0 A;  1BNC A;  4BY7 G;  4YR3 A;  4EEQ A;  4HNT A;  1XDN A;  4BSR A;  2NUA B;  2Z64 A;  2YRX A;  3HOY G;  4U08 A;  4EYH B;  4UFZ A;  4QC0 A;  3UQ8 A;  3OTO H;  2E2H A;  2C00 A;  2W7O A;  4B3R H;  4FDW A;  3GIK A;  1W8A A;  2RF4 A;  2R7Z G;  1N36 H;  2VQF H;  3GTO A;  5DG8 A;  1JL5 A;  2W70 A;  2JA7 A;  4U7L A;  2WAQ A;  5LMN H;  3RB0 A;  2CA6 A;  4EEY A;  3JSL A;  4ED2 A;  2JA6 A;  4A3L G;  4ED1 A;  4BSS A;  4I4T F;  1IBK H;  1K5G C;  4X62 H;  4RAZ A;  4MTD A;  4AY9 X;  1S03 G;  1N33 H;  5L1K A;  2VA2 A;  3MWD A;  4RAY A;  4LF9 H;  5KFE A;  2JQD A;  2FPI B;  3HKZ A;  5D8D A;  5DLF A;  3WN4 A;  3G39 A;  4R7R A;  4H09 A;  1Z2O X;  4R09 A;  2AU0 A;  3TIG A;  3PR5 B;  1M9L A;  2OMU A;  2XGP A;  2FP4 B;  1KEE A;  2SCU B;  5H80 A;  3UL8 A;  3HOW G;  3OJA B;  3GQC A;  5KFW A;  1E4E A;  5FD5 A;  4ECU A;  1M10 B;  4XOS A;  2VPQ A;  4A93 G;  1U0N D;  2UVR A;  1KOO A;  1AUV A;  1TWH A;  5GON F;  3H40 A;  4EFB A;  2A0Z A;  3RB4 A;  3H0G G;  3G06 A;  5B0N A;  3REZ A;  1N56 A;  4Y61 B;  4RZR A;  2R8I A;  2UVW A;  2RR6 A;  4L1K A;  3N6X A;  1V51 A;  1GYF A;  4XYM B;  2Z65 A;  2XWT C;  1JXL A;  1DFJ I;  4U06 A;  2MCT A;  2Y5Q A;  1W93 A;  5D1P A;  1DIK A;  4NZT M;  5LOV F;  3OGL B;  2V70 A;  1S0N A;  4RNM A;  5C3E G;  4YAK B;  2YYA A;  4IRK A;  2VQE H;  5C1O A;  1TAE A;  2NU7 B;  5GMH A;  1HR0 H;  2XIG A;  4IRC A;  1T36 A;  1Z7X W;  4RB0 A;  2IP4 A;  4WBN F;  5KFK A;  1XNQ H;  5EWE A;  2Z63 A;  3RGX A;  4YR2 A;  2W9C B;  3BJY A;  1Z2P X;  1PX2 A;  5KKN B;  4GKJ H;  1EUD B;  2V9T B;  4JV0 A;  2V9S A;  2GLT A;  4ETS A;  4LSA A;  1G9U A;  4J0M A;  4EGJ A;  3KTM A;  4R08 A;  2FKL A;  2JA5 G;  5GS2 B;  1OTM A;  4RCW A;  3C6O B;  1ZHS A;  3JRX A;  4PWQ A;  1O6T A;  1JX4 A;  4PKI G;  2Z7X B;  4BV4 R;  2BQU A;  5BR8 H;  5L1I A;  4JYA H;  3RF2 A;  3OUU A;  5FLM G;  3N44 B;  2YRW A;  2ZDH A;  4RU9 A;  1FVI A;  2W6Q A;  1W96 A;  3H4B A;  2R85 A;  3MFH A;  2W6Z A;  3GIJ A;  4HNU A;  4ECW A;  4IWX A;  4X64 H;  3GV7 B;  2DPJ A;  1LTX A;  2W8L A;  4UCT A;  2W6P A;  1Y14 B;  2QYZ A;  2R7Z A;  5FPR A;  1FT8 A;  1H6T A;  3T5J A;  2C2R A;  3OGM B;  2RGV A;  5FLX W;  3G3A A;  2ZM6 H;  3ZYN A;  2UUA H;  1GWB A;  5CA0 F;  4A2A A;  2R7L A;  5KG7 A;  4FU0 A;  5KT5 A;  3W3J A;  4J9N A;  4ZQI A;  4C2A B;  3RFE A;  3LWB A;  4V2E A;  3RV3 A;  3QFF A;  2FMA A;  4XGO A;  1S0O A;  4MA0 A;  1RJR A;  1RYS A;  2RGR A;  1B04 A;  2V4Q A;  4F50 A;  2WB1 A;  3TQT A;  5LL6 b;  3BZ5 A;  3M18 A;  2Z81 A;  3IG0 A;  4ARN A;  2R7M A;  1ULZ A;  4RZQ A;  1XMQ H;  2OMV A;  5DQI A;  2NU9 B;  5K2M A;  4F4W A;  2OLS A;  3H0G A;  3I12 A;  5LMU H;  4QIW E;  4ZOL F;  1K1Q A;  3ULU A;  3BAB A;  3WPB A;  5KFS A;  4JI8 H;  4GLX A;  2ASD A;  3SI8 A;  1K83 A;  5CMP A;  1WSC A;  4NXN H;  4AYB E;  4A3M G;  1I7L A;  4LXS A;  5KG2 A;  2XGQ A;  5JH7 F;  5IYZ F;  3BG5 A;  2BNH A;  2VA3 A;  2JA7 G;  4A3K G;  1I94 H;  4ECY A;  4HQ6 A;  4DL3 A;  4IHJ F;  1XKU A;  4YAJ B;  4DUY H;  2AGP A;  4F4X A;  3JAM W;  4PDB A;  4MA5 A;  2JEJ A;  2DWC A;  3PZP A;  3IN5 A;  4QW8 A;  1P8T A;  4Q45 A;  2RA8 A;  4QXE A;  3GIP A;  2C28 A;  2HVS A;  2JA5 A;  3RBD A;  3R5F A;  4JI4 H;  4Q3G A;  3AYH B;  1AUX A;  3OSP A;  4J9L A;  1I50 A;  5KFO A;  4RUC A;  4DR7 H;  2R8K A;  4UCU A;  1OWT A;  1JLL B;  4O3N A;  2C2E A;  4CC5 A;  2ASS B;  3Q1K A;  4DV6 H;  1K1S A;  3E4G A;  1J5E H;  1EZ1 A;  4CP6 A;  3G6X A;  3RB6 A;  1IO0 A;  3KAJ A;  1OTN A;  3J81 W;  4ARR A;  3HB9 A;  3MR6 A;  1E4E B;  4F4Y A;  4LH7 A;  1Y1V G;  4O4I F;  5LP6 F;  1VKZ A;  1IOV A;  4LF6 H;  5KG0 A;  1KJQ A;  2IMW P;  2O03 A;  4NLG A;  4MV3 A;  4DV0 H;  4GC6 A;  4LXR A;  2PMZ E;  3P72 A;  3LP8 A;  2E5L H;  4EZG A;  3OGK B;  4R6F A;  5F9N A;  2WDT A;  4ECV A;  4MV7 A;  4BXX G;  3E3Z A;  3VPB A;  4PQ8 A;  4LMY A;  4XYL B;  3BQ0 A;  2WQV A;  3FDS A;  4F4Z A;  4O3Q A;  4LF7 H;  3O6N A;  5KFC A;  3LML A;  3KHG A;  4Z64 C;  2P1P B;  4RNO A;  4B8C D;  2FT3 A;  3OUZ A;  1S10 A;  3HOU G;  4Q8E A;  3Q8R B;  3UL7 A;  2W9B A;  4MV8 A;  5B4P A;  3WPE A;  2W9A A;  2ZJT A;  1O6S A;  2V9W A;  4I50 F;  3TSR E;  5KFA A;  5KFI A;  5KFY A;  4QWC A;  5DQH A;  1DGS A;  4M7E A;  3VMM A;  1OOK G;  4ECR A;  4A2B A;  4JV2 A;  2VR1 A;  2DPI A;  4A3G G;  4QBZ A;  3QZ8 A;  4FCG A;  1TWF A;  5KFZ A;  2P1N B;  3G6Y A;  5AWD A;  4HNV A;  5D3I A;  5EWF A;  4A3D G;  3CVZ A;  3UN9 A;  3MWM A;  2FB9 A;  1WR2 A;  3KHH A;  4J9M A;  3ZYI A;  3CIG A;  4JI2 H;  2OH2 A;  1YRG A;  4FS7 A;  2I80 A;  4KXF B;  4R07 A;  4FS1 A;  1KJ9 A;  1ZQ7 A;  5KFQ A;  3VPD A;  5HBR B;  2UVU A;  2UVV A;  3T5K A;  2J6U A;  1WH2 A;  1TWG A;  3I4N G;  5FJ8 G;  5KFP A;  2ZDQ A;  4HR7 A;  4O3S A;  2OMW A;  3ETH A;  4BBR G;  4E4T A;  5EDW A;  4APM A;  4UCS A;  5DGB A;  4R6J A;  1R9T A;  2JE1 A;  2UU9 H;  2R6F A;  1P8L A;  1TWC A;  1XCD A;  1S0M A;  3M9M B;  4Z8G A;  2R9U A;  1RYR A;  4QJF A;  3RJ0 A;  3GTG A;  5C44 G;  4EBE A;  4LFC H;  4V2C A;  4MV9 A;  3RTX A;  5BPF A;  2P1M B;  4LSC A;  5IP7 G;  3W3K A;  5HDH A;  5DGA A;  3OHA A;  2P0A A;  4YEB B;  2E2I A;  1QYY A;  4LFA H;  4PER A;  4M7E C;  2BQR A;  1M0T A;  4TZH A;  2NU6 B;  3EPG A;  3W3G A;  1Y1V A;  4QIW A;  1KOH A;  4TV9 F;  4FM9 A;  5CAE B;  2FK2 A;  2Q2U A;  3CVR A;  5KFB A;  4QWE A;  2AQ4 A;  1DS9 A;  3Q8S B;  4GLP A;  4FBT A;  5JQW A;  4DR3 H;  2IBK A;  5DG7 A;  1JDB B;  3PMH G;  1KC7 A;  4UCO A;  4AYB A;  3M19 A;  3MJF A;  4WYK A;  4U7C A;  4EFE A;  2R93 G;  2CZG A;  2P1O B;  1SFO A;  4IR9 A;  2BQ3 A;  4J9P A;  4ED8 A;  4IAJ A;  4B3M H;  3G8C A;  2R7N A;  2J6S A;  5IJC A;  2IFG A;  4RUA A;  3KHR A;  3BAA A;  1IBM H;  5GQR K;  4MV1 A;  3Q8Q B;  4QW9 A;  3WPD A;  3PO3 G;  4UCV A;  3J7A K;  2Y0S E;  2GPW A;  2CW8 A;  1IOW A;  2ID5 A;  1X9N A;  5EWG A;  3ETJ A;  4YR0 A;  1D0B A;  4DR6 H;  2XOT A;  1S68 A;  2Z66 A;  5IWA H;  5KT3 A;  4CNM A;  5KFT A;  3RBE A;  2RDI A;  3F8N A;  4JV5 H;  5GMF A;  2CW7 A;  2VOB A;  4G8A A;  5CA1 F;  2CQY A;  4DL5 A;  3U9T A;  4R8U A;  4I7H A;  4DL2 A;  1JDE A;  4ECS A;  3I4M G;  5BMV F;  4J9K A;  4IZO A;  3L4J A;  5AWA A;  3HXL A;  4DV2 H;  2I87 A;  2O6S A;  2PMZ A;  2KSW A;  5LYJ F;  3PO2 G;  5LA6 F;  5BPH A;  5D1O B;  5KG3 A;  4BWS C;  4BBS G;  5KG4 A;  2JEF A;  4C5B A;  1AN7 A;  1V4Y A;  3PR4 A;  2YZN A;  3M9O B;  4ECT A;  2X0S A;  5JUM A;  2F4V H;  3E2J A;  4LSX A;  3OHB A;  4UFR A;  5AWB A;  2UZY A;  3GTK A;  3SE7 A;  3W3M A;  3T5L A;  3KAK A;  3WPG A;  1JIH A;  4ECO A;  5FD6 A;  3NGD A;  2W7P A;  2NU8 B;  1GO3 E;  1OZN A;  4RB2 C;  1EUC B;  4YP3 A;  3C6P B; 
#chains in the Genus database with same CATH homology
 4HQ1 A;  2UZX A;  4LXR A;  2CA6 A;  3BA8 A;  4RB1 A;  3KXY T;  3JSL A;  3VQ1 A;  3P72 A;  2JE0 A;  2E5L H;  5IT9 W;  4EZG A;  2Q2T A;  3OGK B;  4R6F A;  4Q0Y A;  4BSS A;  4LF8 H;  2Q4G W;  2Z82 A;  1IBK H;  4FHO A;  4LF5 H;  1K5G C;  4X62 H;  4RAZ A;  2WDT A;  4MTD A;  4AY9 X;  4MV7 A;  4PEQ B;  1S03 G;  3E3Z A;  4PQ8 A;  1N33 H;  4LMY A;  2WQV A;  2WE6 A;  5AZ5 A;  4RAY A;  4LF9 H;  2JQD A;  4LF7 H;  3W3N A;  2UXC H;  3O6N A;  3WN4 A;  3G39 A;  1MZB A;  4DUZ H;  3LML A;  4R7R A;  4Q62 A;  4H09 A;  1Z2O X;  4Z64 C;  4R09 A;  2Z62 A;  2P1P B;  4B8C D;  1M9L A;  2FT3 A;  2O6Q A;  1ZIW A;  2OMU A;  1P8V A;  3C0F B;  3UL8 A;  3M4I A;  3N43 B;  3UL7 A;  3OJA B;  2OMY A;  5A2Q W;  3G04 C;  4RWT C;  5FD5 A;  4WP6 A;  5B4P A;  1M10 B;  1O6V A;  4XOS A;  3WPI A;  2VPS A;  3PN1 A;  3WPE A;  1FKA H;  5B0T A;  4L3A A;  1A9N A;  1U0N D;  2UUB H;  1KOO A;  2FE3 A;  3GOZ A;  2HGS A;  4CC4 A;  4NKG A;  2ZJT A;  1O6S A;  2HVQ A;  3TSR E;  4EFB A;  1M9S A;  1DGS A;  4M7E A;  4NKH A;  2A0Z A;  2HHH H;  4YHH H;  3T1Y H;  1OOK G;  3C6N B;  1HNX H;  4A2B A;  3G06 A;  5B0N A;  3REZ A;  4Y61 B;  4QBZ A;  2RR6 A;  4FCG A;  5A5C A;  2P1N B;  5AWD A;  3N6X A;  3ZYO A;  4V2D A;  4FMZ A;  4P8S A;  4LH6 A;  5D3I A;  1GYF A;  4CNC A;  1A0I A;  3CVZ A;  4LSX C;  3UN9 A;  3MWM A;  1N32 H;  2Z65 A;  4DR1 H;  2XWT C;  3ZYI A;  3CIG A;  1DFJ I;  4JI2 H;  3FMA A;  1YRG A;  4FS7 A;  4U06 A;  2MCT A;  2Y5Q A;  4KXF B;  4R07 A;  4CC6 A;  1N34 H;  3G3B A;  5D1P A;  4P91 A;  1A4Y A;  3OGL B;  2V70 A;  3H20 A;  3OJA A;  3N41 B;  4MN8 B;  4DR4 H;  1WH2 A;  2VQE H;  1TAE A;  5GMH A;  1HR0 H;  2XIG A;  1Z7X W;  5LFN A;  4RB0 A;  2VUG A;  3RGZ A;  2OMW A;  1XNQ H;  5FTT B;  2WQW A;  2Z63 A;  3RGX A;  4APM A;  4UCS A;  4I6J B;  4R6J A;  2JE1 A;  1Z2P X;  2UU9 H;  1FQV A;  4GKJ H;  2V9T B;  1P8L A;  2V9S A;  2ELL A;  1XCD A;  3RFJ A;  4ETS A;  4LSA A;  4Z8G A;  3KAL A;  1G9U A;  4OQT A;  4J0M A;  4ECN A;  2R9U A;  4AW4 A;  4DR2 H;  4R08 A;  3RJ0 A;  3RFS A;  5GS2 B;  1OTM A;  4LFC H;  4V2C A;  4RCW A;  3C6O B;  1ZHS A;  4MV9 A;  3RTX A;  3RW7 A;  4BSU A;  1WWL A;  3L2P A;  4KT1 A;  2P1M B;  4LSC A;  3KJ4 A;  3W3K A;  1O6T A;  1FS2 A;  4MTE A;  4R58 A;  5HDH A;  4PKI G;  2Z7X B;  3A79 B;  2OWO A;  4BV4 R;  2HVR A;  4DV5 H;  5BR8 H;  5IJD A;  4JYA H;  3RF2 A;  4MQW X;  3N44 B;  4UCR A;  1FVI A;  4YEB B;  3RW6 A;  4CC4 C;  1Z2N X;  2WFH A;  1QYY A;  3UL9 A;  4LFA H;  4LFB H;  4X64 H;  1K5D C;  3JB9 j;  1LTX A;  4PER A;  4M7E C;  4UCT A;  3RIZ A;  4PSJ A;  1H6T A;  1M0T A;  5FPR A;  1FT8 A;  1DCE A;  2UUC H;  1OTO A;  4TZH A;  4IM6 A;  5CMN A;  1FO1 A;  3OGM B;  3W3G A;  2RGV A;  5FLX W;  3G3A A;  2ZM6 H;  4GT6 A;  3ZYN A;  1KOH A;  2UUA H;  4GKK H;  1GWB A;  4FM9 A;  2Q2U A;  3CVR A;  4A2A A;  3WPF A;  3DF7 A;  2BEX A;  1DS9 A;  3W3J A;  4R6A A;  4GLP A;  4DR3 H;  5IYX C;  4C2A B;  2P1Q B;  4DV1 H;  3RFE A;  2WQX A;  4LI1 A;  3PMH G;  4XSQ A;  4V2E A;  2Z7X A;  3ULA A;  1XNR H;  4UCO A;  3EYY A;  3M19 A;  4XGO A;  4WYK A;  4CIL A;  4EFE A;  2RGR A;  3ULV A;  2P1O B;  4Z94 G;  4LF4 H;  5GMG A;  1OGQ A;  1B04 A;  3WPC A;  3K3V A;  4IAJ A;  4B3M H;  1O75 A;  5AWC A;  3WPH A;  4Q3I A;  5LL6 b;  5IJC A;  3T1H H;  3BZ5 A;  4Z61 C;  3M18 A;  2Z81 A;  2IFG A;  3SB4 A;  1ZHQ A;  3IG0 A;  3BAA A;  4ARN A;  1IBM H;  5GQR K;  4L3F A;  3N42 B;  2UXB H;  3WPD A;  1IBL H;  4UCV A;  3J7A K;  4Z79 A;  1E4G T;  4RZQ A;  5D1O A;  2CW8 A;  1XMQ H;  2OMV A;  1HNW H;  1FJG H;  1E4F T;  1X9N A;  2ID5 A;  4JI0 H;  1H6U A;  4K0K H;  1D0B A;  1HNZ H;  4DR6 H;  4U09 A;  4X66 H;  2XOT A;  1S68 A;  1XEU A;  5LMU H;  2Z66 A;  5IWA H;  1XWD C;  3ZYJ A;  4CNM A;  1PGV A;  1L2Z A;  3F8N A;  4JV5 H;  5GMF A;  3ULU A;  2UXD H;  1SQ0 B;  3BAB A;  3J80 W;  2OMT A;  2YCH A;  3WPB A;  4B3S H;  1V9P A;  1BGW A;  2CW7 A;  4JI8 H;  4GLX A;  4JI7 H;  2VOB A;  4G8A A;  4JI6 H;  4DV4 H;  4C2B B;  5HZL B;  5EOY A;  5CMP A;  3L4K A;  4I7H A;  4NXN H;  4YY3 H;  4DV7 H;  4LXS A;  1M0Z A;  3L4J A;  2BNH A;  3W3L A;  2O6R A;  5GS0 A;  1XEC A;  1VS0 A;  5AWA A;  4LI2 A;  3BA9 A;  1I94 H;  4RB3 C;  3HXL A;  1M0W A;  4DV2 H;  4JI5 H;  1XMO H;  2OMX A;  5FPO A;  3JSN A;  2O6S A;  1SYX B;  4OX9 H;  4KHP H;  1XKU A;  2KSW A;  4FD0 A;  3E6J A;  4AQY H;  4DUY H;  3JAM W;  4RCA B;  4KNG A;  4PDB A;  5D1O B;  4R5C A;  4BWS C;  4R5D A;  4DR5 H;  1AN7 A;  4NXM H;  1P8T A;  3CIY A;  3VQ2 A;  4K17 A;  1SEI A;  2AST B;  2RA8 A;  2WQU A;  4J4L A;  4QXE A;  5IJB A;  4DV3 H;  2HVS A;  1P9A G;  3DZE A;  4EEQ A;  1XDN A;  1TA8 A;  4JI4 H;  4Q3G A;  4BSR A;  3N40 P;  2Z64 A;  4JI3 H;  2F4V H;  4R0A A;  3E2J A;  4LSX A;  4DR7 H;  4U08 A;  4UFR A;  4UFZ A;  4UCU A;  4QC0 A;  2OMZ A;  5AWB A;  2UZY A;  4CC5 A;  3O53 A;  3UQ8 A;  2ASS B;  4DV6 H;  2WYO A;  3OTO H;  3W3M A;  3E4G A;  1J5E H;  4CP6 A;  3KAK A;  4B3R H;  3WPG A;  4FDW A;  2W57 A;  1W8A A;  1IO0 A;  3KAJ A;  1OTN A;  4X65 H;  3FXI A;  4ECO A;  1I6U A;  1N36 H;  3J81 W;  4ARR A;  5FD6 A;  1BJT A;  2VQF H;  4LH7 A;  1OZN A;  4JI1 H;  4R6G A;  4RB2 C;  1JL5 A;  4LF6 H;  4B3T H;  2O03 A;  4U7L A;  4DV0 H;  5LMN H;  3C6P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...