4J0MA

Crystal structure of brl1 (lrr) in complex with brassinolide
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
727
structure length
724
Chain Sequence
b'DFNETALLLAFKQNSVKSDPNNVLGNWKYEGSCSWRGVSCSDDGRIVGLDLRNSGLTGTLNLVNLTALPNLQNLYLQGNYFSSGGDSSGSDCYLQVLDLSSNSISDYSMVDYVFSKCSNLVSVNISNNKLVGKLGFAPSSLQSLTTVDLSYNILSDKIPESFISDFPASLKYLDLTHNNLSGDFSDLSFGICGNLTFFSLSQNNLSGDKFPITLPNCKFLETLNISRNNLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGNTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPMELGKCKSLKTIDLSFNELTGPIPKEIWMLPNLSDLVMWANNLTGTIPEGVCVKGGNLETLILNNNLLTGSIPESISRCTNMIWISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEGIRAERLERLPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAVSGFIPPGYGNMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIPFGGQLTTFPVSRYANNSGLCGVPLRPCGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase BRI1-like 1
publication title Structural basis for differential recognition of brassinolide by its receptors
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 246
structure length 724
sequence length 727
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.310 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4j0mA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4j0mA01
1FT8A 3OGKB 1M9SA 2O6QA 4QXEA 2Z81A 4FCGA 3O53A 4R5DA 3RGXA 4PKIG 2RR6A 3WPDA 1O6VA 3OJAA 3RFEA 1XEUA 4RCWA 4CC4C 4U08A 4CNMA 4R08A 3W3NA 1XECA 1XWDC 4PQ8A 3WPHA 4PERA 2Z66A 3M19A 4LI1A 2O6SA 3WPBA 2UZXA 4Q3IA 2Z7XB 5IJCA 4I6JB 3ULVA 4KXFB 3KJ4A 3G3AA 1DS9A 1XCDA 2Z7XA 2OMXA 3ULUA 2Z82A 4LXRA 4C2AB 3G04C 5AWCA 4Q62A 5B0NA 1O6SA 3ZYIA 2WQVA 4LXSA 3UL9A 3UN9A 5GS2B 3VQ2A 4FHOA 4CILA 3UL7A 1OTNA 2CA6A 4R09A 1LTXA 2ID5A 3C6PB 1FQVA 3CIYA 4KT1A 5AZ5A 4B8CD 1DCEA 4HQ1A 2OMWA 2Q4GW 3GOZA 4LI2A 2Z65A 3RFJA 3CIGA 4AY9X 2ASSB 1U0ND 4FMZA 4L3FA 1OTOA 5A5CA 2ELLA 5GS0A 2Z62A 1OOKG 4L3AA 4R6GA 4U7LA 4Z64C 2V70A 3OGMB 3G06A 3M18A 4XOSA 1OTMA 3PMHG 4RWTC 1W8AA 3JB9j 4CC4A 1Z7XW 2OMVA 4P8SA 2ASTB 1PGVA 3W3KA 2R9UA 1DFJI 3E3ZA 3FXIA 4IM6A 4C2BB 3REZA 1WWLA 2OMUA 4MQWX 4XSQA 3O6NA 2WQWA 3ULAA 1YRGA 4GLPA 1P8VA 4LSXA 4V2EA 2A0ZA 2WFHA 4LSXC 5D3IA 3WPGA 4LSAA 1KOHA 2P1QB 3CVRA 4TZHA 4XGOA 2IFGA 4J0MA 3W3MA 4Y61B 4PEQB 2Y5QA 5FTTB 1K5DC 4R6FA 4Z94G 5IJBA 5GMGA 4R07A 4UFRA 4Z79A 4BSSA 4U06A 4QBZA 4ARRA 2P1NB 4R6JA 1ZIWA 2WQXA 4YEBB 2OMZA 3C6NB 2JQDA 5HZLB 4ECNA 1JL5A 4FS7A 2RA8A 3TSRE 1OGQA 2OMTA 3SB4A 1SQ0B 4LSCA 1OZNA 1FO1A 2P1MB 4CNCA 4RCAB 4ARNA 3RJ0A 4R5CA 3W3GA 2FT3A 4EZGA 1KOOA 3G3BA 4Q3GA 2V9TB 1M10B 1FS2A 2JE1A 5AWDA 1M9LA 2Z63A 2OMYA 4WYKA 5IJDA 4QC0A 2BNHA 3DZEA 1O6TA 4V2CA 2XWTC 5B0TA 3OJAB 3E4GA 4G8AA 4Z8GA 4M7EA 5LFNA 2Z64A 3RGZA 4WP6A 4NKHA 4CP6A 2WQUA 3G39A 4NKGA 4J4LA 3RIZA 4M7EC 4BSRA 1QYYA 5CMPA 4GT6A 2O6RA 4BSUA 4P91A 4V2DA 4FD0A 3WPFA 3W3JA 3A79B 3ZYNA 5IYXC 4H09A 3E2JA 5AWAA 1P9AG 4K17A 3OGLB 1D0BA 4OQTA 4FDWA 3E6JA 4R0AA 4BV4R 2BEXA 3P72A 1A9NA 4U09A 5GMHA 4R58A 4R6AA 5B4PA 3W3LA 1XKUA 3RFSA 2V9SA 4ECOA 3UL8A 1G9UA 4AW4A 4KNGA 1H6UA 2P1OB 5AWBA 5GMFA 3WPCA 3ZYOA 2XOTA 1IO0A 4MN8B 5HDHA 3BZ5A 3ZYJA 3RW6A 2P1PB 1H6TA 1GWBA 3VQ1A 3C6OB 3WPEA 1A4YA 1K5GC 5GQRK 3WN4A 3WPIA 2UZYA 4PSJA 2JE0A 1P8TA 1M0ZA 5CMNA 4Z61C 3RW7A
chains in the Genus database with same CATH superfamily
1EUCB 1WCMA 4L1KA 3GTMA 2HGSA 1W93A 4GLXA 4R5DA 1DIKA 4PKIG 1GLVA 5KFCA 5JUMA 3RFEA 3GIDA 3RV3A 5CB4F 4U08A 4R08A 3PW2A 1XWDC 5KFNA 2VPQA 3M19A 1DV2A 2UZXA 4Q3IA 1S0MA 5IJCA 4TV9F 2Y0SE 4I6JB 3TIIA 3KJ4A 3G3AA 4J9PA 1DS9A 5DLFA 2W6OA 3RAQA 2NU7B 4IWXA 2Z7XA 4C2AB 4YAJB 4HNTA 3RV4A 4Q62A 4OX9H 4BBSG 4KHPH 5GS2B 3DF7A 4CILA 2YZNA 1VS0A 4JI7H 1VAJA 3EPIA 4R09A 3C6PB 1FQVA 3CIYA 4U6PA 4KT1A 2YZGA 5J2UF 3GV7B 2R8KA 2W9BB 5H80A 5KKNB 5DGBA 4HQ1A 4JI0H 4NZRM 1WSCA 4RB2C 3T1HH 1UNNC 1KJJA 5T14A 3CIGA 1TWCA 2WYOA 5F9NA 4FU0A 5LL6b 2XIGA 3GQCA 2ASSB 4L3FA 5A5CA 1OTOA 4ED1A 4JI2H 4A2BA 4ECQA 5KFKA 1OOKG 2W6PA 3I12A 4J9LA 5C44G 4U7LA 4Z64C 2V70A 1S0NA 1T36A 4RWTC 4CC4A 4JI4H 4YBZB 4IHJF 4P8SA 2PN1A 2PBZA 2FJZA 3K5IA 3FXIA 4IM6A 3UFXB 3R5FA 1KJIA 3REZA 4A3FG 1JX4A 3O6NA 3K3PA 3R5HA 3LMLA 3ULAA 4GC7A 5IT9W 1BXRA 4LSXA 2UXDH 5KFYA 4V2EA 4R7RA 2W8KA 5EZYF 2DLNA 2HJWA 4TQSA 4EGJA 4MTEA 4GKKH 4UFZA 2E5LH 5KFMA 3WPGA 2C28A 2P1QB 2YZMA 3CVRA 4QIWE 4HNUA 4ECXA 5EDWA 3NGDA 2FE3A 5I47A 4PEQB 2PMZA 1IOVA 4UCUA 2R7NA 2UUCH 4MV3A 4XYMB 5FTTB 4R6FA 4ED3A 4YR0A 4R07A 3RB6A 4BSSA 3PO3G 3I4MG 2XGQA 4ECSA 1K1QA 1RJRA 5KG0A 2J6UA 1TWGA 2V58A 4FS1A 1ZIWA 5D1PA 4YEBB 2B63G 4EFBA 4EBCA 3J7AK 5L1KA 2JQDA 4ECYA 4JUZA 4ECNA 1V51A 1JL5A 2YRXA 4FS7A 4DUYH 4RZRA 4F50A 3TSRE 1HNWH 3T5LA 4ZOLF 2OWOA 4LSCA 1OZNA 2XCPA 1CQIB 4UCTA 1CQJB 4HYKA 4ED6A 4EZGA 3OTOH 2W6ZA 3G3BA 3MWEA 3U9SA 3V6KA 2GPWA 2JE1A 3RAXA 4J9SA 4DL6A 1M9LA 2Z63A 4WYKA 5IJDA 2W70A 4A3IG 2YCHA 3E4GA 4G8AA 3RGZA 2AQ4A 4FM9A 2VPSA 4YB8B 3GV5B 4O3QA 4DV1H 4QWBA 2WQUA 3ETHA 3MR3A 4M7EC 1XNQH 4BWSC 4J9OA 3GIQA 3OHAA 5JVLA 5KT7A 5FJ8G 5D1OB 4O2BF 4JI1H 1VBHA 3GTGA 4P91A 1RYRA 4FD0A 2IMWP 3W3JA 3HOZG 3ZYNA 3BQ2A 3T5HA 4MA5A 4O4IF 1J5EH 3OGLB 5KX5F 2NU8B 4RB0A 2WAQE 4BV4R 2BEXA 4QWAA 5LP6F 5B4PA 2C00A 5JQWA 3VPBA 2NU9B 3WO0A 3J80W 1VBGA 2BQRA 3GTOA 5BR8H 2VUMG 4HNVA 5KFLA 2P1OB 2YU9A 4AYBE 1Z2PX 2YL2A 3WPCA 1N34H 1TA8A 2XOTA 4MN8B 1KEEA 3ZYJA 4A3GG 3HKZE 2RGRA 3VQ1A 3C6OB 4IRCA 3R23A 3N43B 4A93G 5GQRK 2JA6G 2VQDA 3MJFA 4QIWA 2W57A 4Z61C 2C35B 2UVVA 4RUAA 3HOXG 3G6YA 1L2ZA 4UCSA 2BQUA 1O6VA 3M4IA 2WDTA 4RCWA 4ECZA 1JDBB 1TWFA 5KFRA 2C2DA 1Y1VG 1B6RA 3W3NA 1XECA 4QW8A 2FB9A 3G6XA 2M05A 4PERA 2Z66A 5LA6F 2JEIA 2V4RA 4JYAH 2O6SA 1K83A 3FKIG 2ZDQA 2OLSA 2Z7XB 2CW7A 4ECRA 3GILA 5D1OA 5KG1A 4TQRA 3VMMA 2UUBH 5IP7G 1XCDA 3ULUA 1ZHQA 3G04C 5HV6A 3PN1A 2JA5G 3ORQA 5J2TF 4LXSA 3L4JA 4TV8F 2JA8G 4J9NA 3UL9A 4IAJA 3GV8B 1Y1WG 4MA0A 1LTXA 2FPIB 5AZ5A 4M9UA 1IBMH 1GSOA 2DZDA 2ATLA 3EPGA 2R92G 3E5NA 1S9FA 1SEIA 5JH7F 2OMWA 1B33N 1E4EB 4LI2A 5LYJF 3GIKA 2Z65A 1XMOH 1RJPA 2R7LA 2PVPA 2JA7G 4FMZA 4APMA 4QWEA 3FMAA 5GS0A 2WB1E 4L3AA 4RB1A 1EHIA 1S10A 4C5CA 5C4XG 4BXXG 5KFBA 4F4WA 3KXYT 3M18A 4XOSA 2C2EA 4YJ2F 3JB9j 5C3EG 5DQGA 5HBRB 4EEYA 2OMVA 5KFHA 2ASTB 1X9NA 3BABA 1IBKH 3W3KA 3E3ZA 3H20A 2JEGA 3GIMA 3FDSA 1BNCA 1N56A 5DG9A 2OMUA 2WAQA 2WQWA 1YRGA 2UXCH 1P8VA 4DR7H 1N48A 4ECVA 3L2PA 3PW7A 1P8LA 3U9TA 5DQHA 5LMUH 1EYZA 3RTXA 3GTJA 1JDEA 5C5JA 2R6FA 1M7JA 5D3IA 5KFQA 3QFFA 3V4SA 3BA9A 4QW9A 2C2RA 4TZHA 4IRDA 4XGOA 4J0MA 5C1OA 3W3MA 1Z2NX 4A2AA 2XD4A 3EYYA 1K5DC 5IJBA 4DV7H 4UFRA 3VPDA 3HKZA 5KG2A 4QBZA 2R84A 3H0GA 4HQ6A 2UVRA 2P1NB 2XCLA 1TWAA 2WTFA 4DL4A 5EWEA 3Q1KA 4DR6H 3PVXA 3C6NB 4DR3H 3Q2OA 4YP3A 1SFOA 2R8JA 2DPJA 2AGQA 1E4FT 4RZQA 3BQ1A 3RUPA 4O4LF 3GTKA 3K3VA 2RA8A 4QWDA 2NU6B 4DV6H 4ED0A 3N42B 4XZ3B 1E4EA 2VA3A 5KT5A 1SQ0B 5EWFA 5KG6A 4XYLB 5KFSA 1FO1A 4RCAB 4ARNA 3RJ0A 4AQYH 2CKZB 2QYZA 5KT2A 4GKJH 1V4YA 2E2HA 2XC9A 2FK3A 4BY1G 1KOOA 1ZHSA 4Q3GA 5KFTA 1TAEA 5AWDA 3KHRA 1UC9A 4QC0A 4V2CA 2RDIA 1ULZA 1S68A 5EWGA 5B0TA 4QWCA 5IP9G 4M7EA 5LFNA 1B04A 4FBUA 4WP6A 3K5HA 5C8YF 3GIIA 3PR4A 1GO3E 4CP6A 3HBLA 4NKGA 4U7CA 1HNZH 4EGQA 3SI8A 4BSRA 2V9WA 5KG5A 2E2IA 5LOVF 5CMPA 4A3KG 2O6RA 3Q8PB 4V2DA 3J81W 4J9KA 1RYSA 3WPFA 3A79B 2I87A 2YYAA 4RNOA 3OUUA 1DV1A 5IYXC 5JVDF 4H09A 2YRWA 4I50F 3E2JA 2R85A 5AWAA 1CE8A 1KC7A 5KFWA 1T94A 4A3JG 5L1JA 2OH2A 3GTLA 4DV2H 3BA8A 2VOBA 4MV7A 4Q44A 2UUAH 4R58A 2RDJA 4R6AA 5KFEA 1K1SA 2FPGB 3W3LA 1IOWA 4O4HF 2JA6A 4YHHH 4O3OA 2V9SA 3UL8A 1G9UA 3RBEA 2JEFA 3KAKA 3I4NG 2V5AA 3N8DA 4BY7G 4DV0H 4J9QA 2GPSA 5GMFA 4EEQA 3BG5A 4C5BA 4ETSA 2WE6A 3RW6A 1Z2OX 1A9XA 5IYDG 1H6TA 2FLNA 4CC5A 1GSHA 2V59A 2Y0SA 3JAMW 3WPIA 4E4TA 2JE0A 2JEJA 3RW7A 3FKIA 1M9SA 2J6TA 4QXEA 3RBDA 2Z81A 4FCGA 5KG4A 3QZ7A 4I55F 4O3NA 2XCAA 2BQ3A 1R9TA 4CC4C 3HOYG 2JA5A 4A3BG 3LP8A 4BBRG 2ASLA 4LFAH 4PQ8A 2SCUB 1Y1WA 3F8NA 3M9OB 5CA0F 3WPBA 3GTQA 3ULVA 4X64H 2W6QA 1Y14B 4JV0A 5KFGA 2W9CB 2I80A 3RB4A 4ED7A 5FD6A 4HR7A 4LXRA 3N41B 4MAMA 3KHHA 2FK2A 5AWCA 3GIJA 1GGOA 5B0NA 1O6SA 3V6HA 4I4TF 2WQVA 4ECWA 4MTDA 2R93G 5CAEB 4FHOA 2ZJTA 3UL7A 3RF2A 1RK6A 1OTNA 2CA6A 5KT4A 2ASJA 1KJQA 2UVWA 4B8CD 1FKAH 4YQWA 3KTMA 3PO2G 3RB3A 3MR6A 3ORRA 3KALA 3LWBA 1SYXB 4A3CG 2W71A 2P0AA 3CQZA 2UVUA 3BJYA 4FBTA 3H40A 3OGMB 1JKJB 1I7NA 4F4ZA 3M9MB 2NVYA 4B3TH 2R7ZG 4A3EG 1PGVA 2R9UA 1DFJI 5KFJA 4ECTA 1W96A 3AYHB 1WWLA 4MQWX 4XSQA 5D8DA 1S03G 3TQTA 5GONF 2GLTA 4RUCA 4Q43A 1KJ8A 2A0ZA 1S97A 2KSWA 4JI6H 2FKLA 4UCOA 3T1YH 1B6SA 4LSAA 1KOHA 3N6XA 5DLGA 1E4GT 3MWDA 4ECUA 1JLLB 4NXNH 5LMNH 2IFGA 3T5KA 2Y5QA 5LXTF 5BPHA 5IYBG 2W9CA 4PWQA 4RNMA 4Z94G 3N40P 4QJFA 3IN5A 4U06A 1JIHA 2ZM6H 4JV5H 5F9LA 4A3LG 3KAJA 4UCVA 1KBLA 2R7KA 5FPOA 4DL3A 4MV6A 3IG0A 5IYCG 2W9AA 4MV4A 1XDNA 4LF6H 5KT6A 2R8IA 4O3RA 3GTPA 1OGQA 2AU0A 3SB4A 4JV2A 2PMZE 4O3PA 3HB9A 4CNCA 4IZOA 4R5CA 1I94H 4A3MG 3HXLA 2FT3A 5IWAH 2NUAB 4C5AA 1FS2A 4ZQIA 5KFFA 3H4DA 2IA6A 2O03A 2XWTC 3OJAB 2FMAA 2HVRA 1HR0H 4Z8GA 2RGVA 2RF4A 2W6NA 5DQIA 2UU9H 2Z64A 4J9MA 2W7OA 4DL2A 4NKHA 4X65H 2W6MA 3PW0A 3G39A 4J4LA 4O3SA 2FLPA 5DG8A 2B63A 3HOUG 2CW8A 4ZHQF 3N44B 4WBNF 4GT6A 1HNXH 4O2AF 2Q2TA 4BSUA 2VUGA 4XX0B 4AYBA 4J9RA 1M0WA 2FPPB 1C3OA 3MWMA 4K17A 4NZTM 1D0BA 3Q8SB 4DL5A 4FS2A 4U09A 3RB0A 5GMHA 5BPFA 2R8HA 2AGOA 3JRXA 4Q8FA 1XKUA 1T3NA 3G6VA 3RFSA 3C0FB 2VA2A 1AN7A 2YS6A 2VQFH 4AW4A 1OWTA 3CVZA 2IBKA 3WO1A 4B3MH 4R8UA 4WD3A 4UCRA 2ASDA 2NVXA 5C1PA 5HDHA 3BZ5A 3PZPA 5KFOA 1GWBA 5K2MA 3TQ1A 2QK4A 2UZYA 4PSJA 3H3VH 1S0OA 1P8TA 5CMNA 4IR1A 4X66H 1SCUB 4TUYF 1FT8A 3OGKB 1XMQH 2O6QA 2IP4A 5KT3A 1M0TA 5KFAA 1JXLA 1RJQA 3O53A 4Q0YA 3RGXA 2C22A 2RR6A 4YJ3F 4CC6A 3WPDA 4F4XA 4PDBA 1N36H 3OJAA 4LMYA 1V9PA 1XEUA 3PW4A 4RB3C 1TWHA 2R87A 4DLKA 2DWCA 4Y8VB 5KFPA 4CNMA 4DR4H 1ZQ7A 4JI5H 2DIKA 4YY3H 4JI3H 1A0IA 4RU9A 3WPHA 2R93A 5FPRA 1MZBA 2MCTA 2XGPA 4LI1A 1O75A 4NLGA 3JSLA 1WR2A 1WCMG 2VUMA 4KXFB 3OUZA 3RFCA 3V4ZA 2OMXA 3GIPA 2Z82A 2WB1A 3OSPA 1WH2A 3ZYIA 4YR2A 5BMVF 5CA1F 4LH7A 1RK5A 3UN9A 3VQ2A 3BAAA 1PK8A 4ME6A 1GYFA 3OHBA 2ID5A 3VPCA 2FP4B 3JZIA 4LF7H 1DCEA 5DG7A 2R7ZA 4DUZH 2Q4GW 3GOZA 1I7LA 5FLXW 5KFUA 3RFJA 4MV8A 2W9BA 4AY9X 4ED2A 1U0ND 2W7PA 5KFXA 2ELLA 1C30A 4X62H 3JSNA 2CQYA 1Y1VA 2Z62A 1BJTA 4DR1H 4LFBH 4DR5H 3H0GG 4IRKA 4LF8H 4R6GA 5KFZA 5L1LA 4EFEA 4F4YA 3G06A 1OTMA 3PMHG 3UQ8A 2HVSA 3G8CA 4YR3A 1W8AA 1AUXA 1Z7XW 2R86A 4DV3H 3SE7A 3R5XA 4LF9H 4C2BB 2UXBH 2R8GA 1ZETA 1EZ1A 4GLPA 3M9NB 1GSAA 5FLMG 4DL7A 4Q8EA 4C2MA 4MV1A 4MV9A 2WFHA 4A3DG 2J9GA 4LSXC 3PR5B 4I7HA 2R92A 3MR5A 3HOVG 4K0KH 4Y61B 2JA7A 1FVIA 4EG0A 2YS7A 4LF5H 2VR1A 5GMGA 3PW5A 4Z79A 2V4QA 3OSNA 5KFIA 4B3RH 2YW2A 4ARRA 3JRWA 4R6JA 4RAYA 2WQXA 5L1IA 4ZI7F 2OMZA 4YAKB 4JI8H 1N32H 4DV5H 2I8CA 2ZDHA 5HZLB 1FJGH 5FD5A 4RNNA 5IYZF 2F4VH 2OMTA 2VQEH 5EOYA 2P1MB 1CS0A 4EYHB 3W3GA 1IBLH 4LFCH 2DPIA 1XNRH 2FK1A 2V9TB 1M10B 1I6UA 5A2QW 4B3SH 2OMYA 1AUVA 1EUDB 3T5JA 4EYIB 2BNHA 3DZEA 1O6TA 2Q2UA 5L9XA 5DGAA 3WNZA 5KG7A 1UC8A 4GC6A 3RIZA 3L4KA 1I3QA 3MFHA 1QYYA 4EBEA 3MR2A 3TIGA 2CZGA 2J6SA 3GLKA 2ALZA 4LH6A 2HHHH 3KHGA 1DGSA 4DV4H 2R82A 3V6JA 3KHLA 4IR9A 1P9AG 3QZ8A 3HOWG 3BQ0A 3Q8RB 1N33H 4OQTA 4EBDA 4RAZA 4FDWA 3MFIA 3E6JA 2X0SA 4R0AA 1KJ9A 1M6VA 3P72A 1A9NA 2BR0A 4IWYA 4DR2H 3Q8QB 5KFDA 1BGWA 4JV1A 2R7MA 2HVQA 3TINA 4ED8A 4ECOA 2ZDGA 1I50A 4R8UB 4KNGA 2W8LA 5KFVA 1H6UA 3ETJA 5AWBA 1PX2A 2AGPA 3H4BA 3ZYOA 2FLLA 1IO0A 1VKZA 4G3IA 2P1PB 5KG3A 3WPEA 1A4YA 1K5GC 3WN4A 4Q45A 4LF4H 4NXMH 1M0ZA
chains in the Genus database with same CATH topology
4X66H 1FT8A 3OGKB 1M9SA 1XMQH 2O6QA 2HGSA 4QXEA 1M0TA 4GLXA 2Z81A 4FCGA 1L2ZA 3O53A 4Q0YA 4R5DA 3RGXA 4PKIG 4UCSA 2RR6A 4CC6A 3WPDA 4PDBA 1N36H 1O6VA 3OJAA 4LMYA 3RFEA 1V9PA 3M4IA 2WDTA 1XEUA 4RB3C 4RCWA 4CC4C 4U08A 4CNMA 4DR4H 4JI5H 4R08A 4YY3H 3W3NA 1XECA 1XWDC 4JI3H 4LFAH 1A0IA 4PQ8A 3WPHA 4PERA 2Z66A 5FPRA 1MZBA 2MCTA 4JYAH 3M19A 4LI1A 1O75A 2O6SA 3F8NA 3WPBA 2UZXA 3JSLA 4Q3IA 2Z7XB 2CW7A 5IJCA 5D1OA 4I6JB 3ULVA 4KXFB 4X64H 3KJ4A 3G3AA 1DS9A 2UUBH 1XCDA 5FD6A 2Z7XA 2OMXA 3ULUA 2Z82A 4LXRA 1ZHQA 3N41B 4C2AB 1WH2A 3G04C 3PN1A 5AWCA 4Q62A 5B0NA 1O6SA 3ZYIA 4OX9H 2WQVA 4LXSA 3L4JA 4MTDA 4KHPH 4LH7A 3UL9A 3UN9A 5GS2B 3VQ2A 4FHOA 3DF7A 4IAJA 4CILA 3BAAA 1VS0A 4JI7H 2ZJTA 3UL7A 3RF2A 1GYFA 1OTNA 2CA6A 4R09A 1LTXA 2ID5A 3C6PB 1FQVA 3CIYA 4KT1A 5AZ5A 1IBMH 4B8CD 1FKAH 4LF7H 1DCEA 4JI0H 4HQ1A 1SEIA 2OMWA 4DUZH 2Q4GW 4RB2C 3T1HH 3GOZA 4LI2A 5FLXW 2Z65A 1XMOH 3RFJA 3CIGA 2WYOA 4AY9X 5LL6b 2XIGA 2ASSB 3KALA 1U0ND 4FMZA 4L3FA 1OTOA 5A5CA 4APMA 2ELLA 3FMAA 4JI2H 5GS0A 4A2BA 4X62H 3JSNA 2Z62A 1BJTA 1OOKG 1SYXB 4DR1H 4L3AA 4RB1A 4LFBH 4DR5H 4LF8H 4R6GA 4U7LA 4Z64C 4EFEA 2V70A 3OGMB 3G06A 3KXYT 3M18A 4XOSA 1OTMA 3PMHG 3UQ8A 2HVSA 4RWTC 1W8AA 3JB9j 4CC4A 4JI4H 1Z7XW 4B3TH 2OMVA 4P8SA 2ASTB 1X9NA 1PGVA 4DV3H 3BABA 1IBKH 3W3KA 2R9UA 1DFJI 3E3ZA 3H20A 3FXIA 4IM6A 4LF9H 4C2BB 3REZA 2UXBH 1WWLA 2OMUA 4MQWX 4XSQA 3O6NA 1S03G 3LMLA 2WQWA 3ULAA 1YRGA 4GLPA 2UXCH 1P8VA 4DR7H 5IT9W 4LSXA 2UXDH 3L2PA 1P8LA 4V2EA 5LMUH 4R7RA 2A0ZA 3RTXA 2KSWA 4MV9A 4MTEA 2WFHA 4JI6H 4GKKH 4UFZA 4UCOA 2E5LH 5D3IA 4LSXC 3WPGA 3T1YH 4LSAA 1KOHA 3N6XA 2P1QB 3CVRA 4I7HA 3BA9A 1E4GT 4TZHA 4NXNH 5LMNH 2IFGA 4XGOA 4J0MA 2FE3A 4K0KH 4PEQB 1Z2NX 4A2AA 4Y61B 3W3MA 2Y5QA 4UCUA 1FVIA 2UUCH 5FTTB 3EYYA 1K5DC 4LF5H 4R6FA 4Z94G 5IJBA 5GMGA 4DV7H 3N40P 4R07A 4UFRA 4Z79A 4BSSA 4U06A 2ZM6H 4B3RH 4QBZA 4ARRA 4JV5H 2P1NB 4R6JA 4RAYA 1ZIWA 5D1PA 2WQXA 4YEBB 3KAJA 4DR6H 4UCVA 4EFBA 2OMZA 3C6NB 4DR3H 4JI8H 1N32H 3J7AK 4DV5H 5FPOA 2JQDA 3IG0A 1E4FT 5HZLB 4RZQA 4ECNA 1FJGH 1JL5A 1XDNA 3K3VA 4FS7A 4LF6H 2RA8A 5FD5A 4DUYH 4DV6H 3N42B 3TSRE 1HNWH 1OGQA 2F4VH 2OMTA 3SB4A 1SQ0B 2OWOA 4LSCA 2VQEH 5EOYA 1OZNA 1FO1A 2P1MB 4CNCA 4RCAB 4UCTA 4ARNA 3RJ0A 1I94H 4AQYH 1IBLH 4LFCH 4R5CA 3W3GA 4GKJH 3HXLA 2FT3A 4EZGA 3OTOH 5IWAH 1KOOA 1ZHSA 3G3BA 1XNRH 4Q3GA 2V9TB 1M10B 1FS2A 2JE1A 1TAEA 1I6UA 5A2QW 5AWDA 1M9LA 2Z63A 4B3SH 2OMYA 4WYKA 5IJDA 4QC0A 2BNHA 3DZEA 2YCHA 1O6TA 4V2CA 2O03A 2Q2UA 1S68A 2XWTC 5B0TA 3OJAB 3E4GA 2HVRA 1HR0H 4G8AA 4Z8GA 2RGVA 4M7EA 2UU9H 5LFNA 2Z64A 3RGZA 1B04A 4FM9A 2VPSA 4WP6A 4NKHA 4X65H 4DV1H 4CP6A 2WQUA 3G39A 4NKGA 4J4LA 3RIZA 4M7EC 1XNQH 4BWSC 1HNZH 3L4KA 4BSRA 1QYYA 2CW8A 5CMPA 3N44B 4GT6A 1HNXH 5D1OB 2O6RA 2Q2TA 4BSUA 4JI1H 2VUGA 4P91A 4LH6A 4V2DA 1M0WA 3J81W 4FD0A 2HHHH 3WPFA 3W3JA 3A79B 1DGSA 3ZYNA 5IYXC 4DV4H 4H09A 3MWMA 3E2JA 5AWAA 1P9AG 4K17A 1J5EH 1N33H 3OGLB 1D0BA 4OQTA 4RAZA 4FDWA 3E6JA 4R0AA 4RB0A 4BV4R 4DV2H 3BA8A 2VOBA 4MV7A 2BEXA 2UUAH 3P72A 1A9NA 4U09A 5GMHA 4R58A 4R6AA 4DR2H 5B4PA 1BGWA 2HVQA 3W3LA 1XKUA 3J80W 4YHHH 3RFSA 2V9SA 4ECOA 3UL8A 1G9UA 3C0FB 1AN7A 5BR8H 2VQFH 4AW4A 4KNGA 3KAKA 1H6UA 2P1OB 4DV0H 3CVZA 4B3MH 5AWBA 5GMFA 1Z2PX 4UCRA 4EEQA 3WPCA 3ZYOA 1N34H 1TA8A 2XOTA 1IO0A 4MN8B 4ETSA 5HDHA 2WE6A 3BZ5A 3ZYJA 3RW6A 1Z2OX 2RGRA 2P1PB 1H6TA 1GWBA 3VQ1A 3C6OB 4CC5A 3WPEA 1A4YA 1K5GC 3N43B 3JAMW 5GQRK 3WN4A 3WPIA 2UZYA 4PSJA 4LF4H 4NXMH 2JE0A 1P8TA 1M0ZA 5CMNA 2W57A 4Z61C 3RW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT8 A;  3OGK B;  1M9S A;  2O6Q A;  4QXE A;  2Z81 A;  4FCG A;  3O53 A;  4R5D A;  3RGX A;  4PKI G;  2RR6 A;  3WPD A;  1O6V A;  3OJA A;  3RFE A;  1XEU A;  4RCW A;  4CC4 C;  4U08 A;  4CNM A;  4R08 A;  3W3N A;  1XEC A;  1XWD C;  4PQ8 A;  3WPH A;  4PER A;  2Z66 A;  3M19 A;  4LI1 A;  2O6S A;  3WPB A;  2UZX A;  4Q3I A;  2Z7X B;  5IJC A;  4I6J B;  3ULV A;  4KXF B;  3KJ4 A;  3G3A A;  1DS9 A;  1XCD A;  2Z7X A;  2OMX A;  3ULU A;  2Z82 A;  4LXR A;  4C2A B;  3G04 C;  5AWC A;  4Q62 A;  5B0N A;  1O6S A;  3ZYI A;  2WQV A;  4LXS A;  3UL9 A;  3UN9 A;  5GS2 B;  3VQ2 A;  4FHO A;  4CIL A;  3UL7 A;  1OTN A;  2CA6 A;  4R09 A;  1LTX A;  2ID5 A;  3C6P B;  1FQV A;  3CIY A;  4KT1 A;  5AZ5 A;  4B8C D;  1DCE A;  4HQ1 A;  2OMW A;  2Q4G W;  3GOZ A;  4LI2 A;  2Z65 A;  3RFJ A;  3CIG A;  4AY9 X;  2ASS B;  1U0N D;  4FMZ A;  4L3F A;  1OTO A;  5A5C A;  2ELL A;  5GS0 A;  2Z62 A;  1OOK G;  4L3A A;  4R6G A;  4U7L A;  4Z64 C;  2V70 A;  3OGM B;  3G06 A;  3M18 A;  4XOS A;  1OTM A;  3PMH G;  4RWT C;  1W8A A;  3JB9 j;  4CC4 A;  1Z7X W;  2OMV A;  4P8S A;  2AST B;  1PGV A;  3W3K A;  2R9U A;  1DFJ I;  3E3Z A;  3FXI A;  4IM6 A;  4C2B B;  3REZ A;  1WWL A;  2OMU A;  4MQW X;  4XSQ A;  3O6N A;  2WQW A;  3ULA A;  1YRG A;  4GLP A;  1P8V A;  4LSX A;  4V2E A;  2A0Z A;  2WFH A;  4LSX C;  5D3I A;  3WPG A;  4LSA A;  1KOH A;  2P1Q B;  3CVR A;  4TZH A;  4XGO A;  2IFG A;  4J0M A;  3W3M A;  4Y61 B;  4PEQ B;  2Y5Q A;  5FTT B;  1K5D C;  4R6F A;  4Z94 G;  5IJB A;  5GMG A;  4R07 A;  4UFR A;  4Z79 A;  4BSS A;  4U06 A;  4QBZ A;  4ARR A;  2P1N B;  4R6J A;  1ZIW A;  2WQX A;  4YEB B;  2OMZ A;  3C6N B;  2JQD A;  5HZL B;  4ECN A;  1JL5 A;  4FS7 A;  2RA8 A;  3TSR E;  1OGQ A;  2OMT A;  3SB4 A;  1SQ0 B;  4LSC A;  1OZN A;  1FO1 A;  2P1M B;  4CNC A;  4RCA B;  4ARN A;  3RJ0 A;  4R5C A;  3W3G A;  2FT3 A;  4EZG A;  1KOO A;  3G3B A;  4Q3G A;  2V9T B;  1M10 B;  1FS2 A;  2JE1 A;  5AWD A;  1M9L A;  2Z63 A;  2OMY A;  4WYK A;  5IJD A;  4QC0 A;  2BNH A;  3DZE A;  1O6T A;  4V2C A;  2XWT C;  5B0T A;  3OJA B;  3E4G A;  4G8A A;  4Z8G A;  4M7E A;  5LFN A;  2Z64 A;  3RGZ A;  4WP6 A;  4NKH A;  4CP6 A;  2WQU A;  3G39 A;  4NKG A;  4J4L A;  3RIZ A;  4M7E C;  4BSR A;  1QYY A;  5CMP A;  4GT6 A;  2O6R A;  4BSU A;  4P91 A;  4V2D A;  4FD0 A;  3WPF A;  3W3J A;  3A79 B;  3ZYN A;  5IYX C;  4H09 A;  3E2J A;  5AWA A;  1P9A G;  4K17 A;  3OGL B;  1D0B A;  4OQT A;  4FDW A;  3E6J A;  4R0A A;  4BV4 R;  2BEX A;  3P72 A;  1A9N A;  4U09 A;  5GMH A;  4R58 A;  4R6A A;  5B4P A;  3W3L A;  1XKU A;  3RFS A;  2V9S A;  4ECO A;  3UL8 A;  1G9U A;  4AW4 A;  4KNG A;  1H6U A;  2P1O B;  5AWB A;  5GMF A;  3WPC A;  3ZYO A;  2XOT A;  1IO0 A;  4MN8 B;  5HDH A;  3BZ5 A;  3ZYJ A;  3RW6 A;  2P1P B;  1H6T A;  1GWB A;  3VQ1 A;  3C6O B;  3WPE A;  1A4Y A;  1K5G C;  5GQR K;  3WN4 A;  3WPI A;  2UZY A;  4PSJ A;  2JE0 A;  1P8T A;  1M0Z A;  5CMN A;  4Z61 C;  3RW7 A; 
#chains in the Genus database with same CATH topology
 1EUC B;  1WCM A;  4L1K A;  3GTM A;  2HGS A;  1W93 A;  4GLX A;  4R5D A;  1DIK A;  4PKI G;  1GLV A;  5KFC A;  5JUM A;  3RFE A;  3GID A;  3RV3 A;  5CB4 F;  4U08 A;  4R08 A;  3PW2 A;  1XWD C;  5KFN A;  2VPQ A;  3M19 A;  1DV2 A;  2UZX A;  4Q3I A;  1S0M A;  5IJC A;  4TV9 F;  2Y0S E;  4I6J B;  3TII A;  3KJ4 A;  3G3A A;  4J9P A;  1DS9 A;  5DLF A;  2W6O A;  3RAQ A;  2NU7 B;  4IWX A;  2Z7X A;  4C2A B;  4YAJ B;  4HNT A;  3RV4 A;  4Q62 A;  4OX9 H;  4BBS G;  4KHP H;  5GS2 B;  3DF7 A;  4CIL A;  2YZN A;  1VS0 A;  4JI7 H;  1VAJ A;  3EPI A;  4R09 A;  3C6P B;  1FQV A;  3CIY A;  4U6P A;  4KT1 A;  2YZG A;  5J2U F;  3GV7 B;  2R8K A;  2W9B B;  5H80 A;  5KKN B;  5DGB A;  4HQ1 A;  4JI0 H;  4NZR M;  1WSC A;  4RB2 C;  3T1H H;  1UNN C;  1KJJ A;  5T14 A;  3CIG A;  1TWC A;  2WYO A;  5F9N A;  4FU0 A;  5LL6 b;  2XIG A;  3GQC A;  2ASS B;  4L3F A;  5A5C A;  1OTO A;  4ED1 A;  4JI2 H;  4A2B A;  4ECQ A;  5KFK A;  1OOK G;  2W6P A;  3I12 A;  4J9L A;  5C44 G;  4U7L A;  4Z64 C;  2V70 A;  1S0N A;  1T36 A;  4RWT C;  4CC4 A;  4JI4 H;  4YBZ B;  4IHJ F;  4P8S A;  2PN1 A;  2PBZ A;  2FJZ A;  3K5I A;  3FXI A;  4IM6 A;  3UFX B;  3R5F A;  1KJI A;  3REZ A;  4A3F G;  1JX4 A;  3O6N A;  3K3P A;  3R5H A;  3LML A;  3ULA A;  4GC7 A;  5IT9 W;  1BXR A;  4LSX A;  2UXD H;  5KFY A;  4V2E A;  4R7R A;  2W8K A;  5EZY F;  2DLN A;  2HJW A;  4TQS A;  4EGJ A;  4MTE A;  4GKK H;  4UFZ A;  2E5L H;  5KFM A;  3WPG A;  2C28 A;  2P1Q B;  2YZM A;  3CVR A;  4QIW E;  4HNU A;  4ECX A;  5EDW A;  3NGD A;  2FE3 A;  5I47 A;  4PEQ B;  2PMZ A;  1IOV A;  4UCU A;  2R7N A;  2UUC H;  4MV3 A;  4XYM B;  5FTT B;  4R6F A;  4ED3 A;  4YR0 A;  4R07 A;  3RB6 A;  4BSS A;  3PO3 G;  3I4M G;  2XGQ A;  4ECS A;  1K1Q A;  1RJR A;  5KG0 A;  2J6U A;  1TWG A;  2V58 A;  4FS1 A;  1ZIW A;  5D1P A;  4YEB B;  2B63 G;  4EFB A;  4EBC A;  3J7A K;  5L1K A;  2JQD A;  4ECY A;  4JUZ A;  4ECN A;  1V51 A;  1JL5 A;  2YRX A;  4FS7 A;  4DUY H;  4RZR A;  4F50 A;  3TSR E;  1HNW H;  3T5L A;  4ZOL F;  2OWO A;  4LSC A;  1OZN A;  2XCP A;  1CQI B;  4UCT A;  1CQJ B;  4HYK A;  4ED6 A;  4EZG A;  3OTO H;  2W6Z A;  3G3B A;  3MWE A;  3U9S A;  3V6K A;  2GPW A;  2JE1 A;  3RAX A;  4J9S A;  4DL6 A;  1M9L A;  2Z63 A;  4WYK A;  5IJD A;  2W70 A;  4A3I G;  2YCH A;  3E4G A;  4G8A A;  3RGZ A;  2AQ4 A;  4FM9 A;  2VPS A;  4YB8 B;  3GV5 B;  4O3Q A;  4DV1 H;  4QWB A;  2WQU A;  3ETH A;  3MR3 A;  4M7E C;  1XNQ H;  4BWS C;  4J9O A;  3GIQ A;  3OHA A;  5JVL A;  5KT7 A;  5FJ8 G;  5D1O B;  4O2B F;  4JI1 H;  1VBH A;  3GTG A;  4P91 A;  1RYR A;  4FD0 A;  2IMW P;  3W3J A;  3HOZ G;  3ZYN A;  3BQ2 A;  3T5H A;  4MA5 A;  4O4I F;  1J5E H;  3OGL B;  5KX5 F;  2NU8 B;  4RB0 A;  2WAQ E;  4BV4 R;  2BEX A;  4QWA A;  5LP6 F;  5B4P A;  2C00 A;  5JQW A;  3VPB A;  2NU9 B;  3WO0 A;  3J80 W;  1VBG A;  2BQR A;  3GTO A;  5BR8 H;  2VUM G;  4HNV A;  5KFL A;  2P1O B;  2YU9 A;  4AYB E;  1Z2P X;  2YL2 A;  3WPC A;  1N34 H;  1TA8 A;  2XOT A;  4MN8 B;  1KEE A;  3ZYJ A;  4A3G G;  3HKZ E;  2RGR A;  3VQ1 A;  3C6O B;  4IRC A;  3R23 A;  3N43 B;  4A93 G;  5GQR K;  2JA6 G;  2VQD A;  3MJF A;  4QIW A;  2W57 A;  4Z61 C;  2C35 B;  2UVV A;  4RUA A;  3HOX G;  3G6Y A;  1L2Z A;  4UCS A;  2BQU A;  1O6V A;  3M4I A;  2WDT A;  4RCW A;  4ECZ A;  1JDB B;  1TWF A;  5KFR A;  2C2D A;  1Y1V G;  1B6R A;  3W3N A;  1XEC A;  4QW8 A;  2FB9 A;  3G6X A;  2M05 A;  4PER A;  2Z66 A;  5LA6 F;  2JEI A;  2V4R A;  4JYA H;  2O6S A;  1K83 A;  3FKI G;  2ZDQ A;  2OLS A;  2Z7X B;  2CW7 A;  4ECR A;  3GIL A;  5D1O A;  5KG1 A;  4TQR A;  3VMM A;  2UUB H;  5IP7 G;  1XCD A;  3ULU A;  1ZHQ A;  3G04 C;  5HV6 A;  3PN1 A;  2JA5 G;  3ORQ A;  5J2T F;  4LXS A;  3L4J A;  4TV8 F;  2JA8 G;  4J9N A;  3UL9 A;  4IAJ A;  3GV8 B;  1Y1W G;  4MA0 A;  1LTX A;  2FPI B;  5AZ5 A;  4M9U A;  1IBM H;  1GSO A;  2DZD A;  2ATL A;  3EPG A;  2R92 G;  3E5N A;  1S9F A;  1SEI A;  5JH7 F;  2OMW A;  1B33 N;  1E4E B;  4LI2 A;  5LYJ F;  3GIK A;  2Z65 A;  1XMO H;  1RJP A;  2R7L A;  2PVP A;  2JA7 G;  4FMZ A;  4APM A;  4QWE A;  3FMA A;  5GS0 A;  2WB1 E;  4L3A A;  4RB1 A;  1EHI A;  1S10 A;  4C5C A;  5C4X G;  4BXX G;  5KFB A;  4F4W A;  3KXY T;  3M18 A;  4XOS A;  2C2E A;  4YJ2 F;  3JB9 j;  5C3E G;  5DQG A;  5HBR B;  4EEY A;  2OMV A;  5KFH A;  2AST B;  1X9N A;  3BAB A;  1IBK H;  3W3K A;  3E3Z A;  3H20 A;  2JEG A;  3GIM A;  3FDS A;  1BNC A;  1N56 A;  5DG9 A;  2OMU A;  2WAQ A;  2WQW A;  1YRG A;  2UXC H;  1P8V A;  4DR7 H;  1N48 A;  4ECV A;  3L2P A;  3PW7 A;  1P8L A;  3U9T A;  5DQH A;  5LMU H;  1EYZ A;  3RTX A;  3GTJ A;  1JDE A;  5C5J A;  2R6F A;  1M7J A;  5D3I A;  5KFQ A;  3QFF A;  3V4S A;  3BA9 A;  4QW9 A;  2C2R A;  4TZH A;  4IRD A;  4XGO A;  4J0M A;  5C1O A;  3W3M A;  1Z2N X;  4A2A A;  2XD4 A;  3EYY A;  1K5D C;  5IJB A;  4DV7 H;  4UFR A;  3VPD A;  3HKZ A;  5KG2 A;  4QBZ A;  2R84 A;  3H0G A;  4HQ6 A;  2UVR A;  2P1N B;  2XCL A;  1TWA A;  2WTF A;  4DL4 A;  5EWE A;  3Q1K A;  4DR6 H;  3PVX A;  3C6N B;  4DR3 H;  3Q2O A;  4YP3 A;  1SFO A;  2R8J A;  2DPJ A;  2AGQ A;  1E4F T;  4RZQ A;  3BQ1 A;  3RUP A;  4O4L F;  3GTK A;  3K3V A;  2RA8 A;  4QWD A;  2NU6 B;  4DV6 H;  4ED0 A;  3N42 B;  4XZ3 B;  1E4E A;  2VA3 A;  5KT5 A;  1SQ0 B;  5EWF A;  5KG6 A;  4XYL B;  5KFS A;  1FO1 A;  4RCA B;  4ARN A;  3RJ0 A;  4AQY H;  2CKZ B;  2QYZ A;  5KT2 A;  4GKJ H;  1V4Y A;  2E2H A;  2XC9 A;  2FK3 A;  4BY1 G;  1KOO A;  1ZHS A;  4Q3G A;  5KFT A;  1TAE A;  5AWD A;  3KHR A;  1UC9 A;  4QC0 A;  4V2C A;  2RDI A;  1ULZ A;  1S68 A;  5EWG A;  5B0T A;  4QWC A;  5IP9 G;  4M7E A;  5LFN A;  1B04 A;  4FBU A;  4WP6 A;  3K5H A;  5C8Y F;  3GII A;  3PR4 A;  1GO3 E;  4CP6 A;  3HBL A;  4NKG A;  4U7C A;  1HNZ H;  4EGQ A;  3SI8 A;  4BSR A;  2V9W A;  5KG5 A;  2E2I A;  5LOV F;  5CMP A;  4A3K G;  2O6R A;  3Q8P B;  4V2D A;  3J81 W;  4J9K A;  1RYS A;  3WPF A;  3A79 B;  2I87 A;  2YYA A;  4RNO A;  3OUU A;  1DV1 A;  5IYX C;  5JVD F;  4H09 A;  2YRW A;  4I50 F;  3E2J A;  2R85 A;  5AWA A;  1CE8 A;  1KC7 A;  5KFW A;  1T94 A;  4A3J G;  5L1J A;  2OH2 A;  3GTL A;  4DV2 H;  3BA8 A;  2VOB A;  4MV7 A;  4Q44 A;  2UUA H;  4R58 A;  2RDJ A;  4R6A A;  5KFE A;  1K1S A;  2FPG B;  3W3L A;  1IOW A;  4O4H F;  2JA6 A;  4YHH H;  4O3O A;  2V9S A;  3UL8 A;  1G9U A;  3RBE A;  2JEF A;  3KAK A;  3I4N G;  2V5A A;  3N8D A;  4BY7 G;  4DV0 H;  4J9Q A;  2GPS A;  5GMF A;  4EEQ A;  3BG5 A;  4C5B A;  4ETS A;  2WE6 A;  3RW6 A;  1Z2O X;  1A9X A;  5IYD G;  1H6T A;  2FLN A;  4CC5 A;  1GSH A;  2V59 A;  2Y0S A;  3JAM W;  3WPI A;  4E4T A;  2JE0 A;  2JEJ A;  3RW7 A;  3FKI A;  1M9S A;  2J6T A;  4QXE A;  3RBD A;  2Z81 A;  4FCG A;  5KG4 A;  3QZ7 A;  4I55 F;  4O3N A;  2XCA A;  2BQ3 A;  1R9T A;  4CC4 C;  3HOY G;  2JA5 A;  4A3B G;  3LP8 A;  4BBR G;  2ASL A;  4LFA H;  4PQ8 A;  2SCU B;  1Y1W A;  3F8N A;  3M9O B;  5CA0 F;  3WPB A;  3GTQ A;  3ULV A;  4X64 H;  2W6Q A;  1Y14 B;  4JV0 A;  5KFG A;  2W9C B;  2I80 A;  3RB4 A;  4ED7 A;  5FD6 A;  4HR7 A;  4LXR A;  3N41 B;  4MAM A;  3KHH A;  2FK2 A;  5AWC A;  3GIJ A;  1GGO A;  5B0N A;  1O6S A;  3V6H A;  4I4T F;  2WQV A;  4ECW A;  4MTD A;  2R93 G;  5CAE B;  4FHO A;  2ZJT A;  3UL7 A;  3RF2 A;  1RK6 A;  1OTN A;  2CA6 A;  5KT4 A;  2ASJ A;  1KJQ A;  2UVW A;  4B8C D;  1FKA H;  4YQW A;  3KTM A;  3PO2 G;  3RB3 A;  3MR6 A;  3ORR A;  3KAL A;  3LWB A;  1SYX B;  4A3C G;  2W71 A;  2P0A A;  3CQZ A;  2UVU A;  3BJY A;  4FBT A;  3H40 A;  3OGM B;  1JKJ B;  1I7N A;  4F4Z A;  3M9M B;  2NVY A;  4B3T H;  2R7Z G;  4A3E G;  1PGV A;  2R9U A;  1DFJ I;  5KFJ A;  4ECT A;  1W96 A;  3AYH B;  1WWL A;  4MQW X;  4XSQ A;  5D8D A;  1S03 G;  3TQT A;  5GON F;  2GLT A;  4RUC A;  4Q43 A;  1KJ8 A;  2A0Z A;  1S97 A;  2KSW A;  4JI6 H;  2FKL A;  4UCO A;  3T1Y H;  1B6S A;  4LSA A;  1KOH A;  3N6X A;  5DLG A;  1E4G T;  3MWD A;  4ECU A;  1JLL B;  4NXN H;  5LMN H;  2IFG A;  3T5K A;  2Y5Q A;  5LXT F;  5BPH A;  5IYB G;  2W9C A;  4PWQ A;  4RNM A;  4Z94 G;  3N40 P;  4QJF A;  3IN5 A;  4U06 A;  1JIH A;  2ZM6 H;  4JV5 H;  5F9L A;  4A3L G;  3KAJ A;  4UCV A;  1KBL A;  2R7K A;  5FPO A;  4DL3 A;  4MV6 A;  3IG0 A;  5IYC G;  2W9A A;  4MV4 A;  1XDN A;  4LF6 H;  5KT6 A;  2R8I A;  4O3R A;  3GTP A;  1OGQ A;  2AU0 A;  3SB4 A;  4JV2 A;  2PMZ E;  4O3P A;  3HB9 A;  4CNC A;  4IZO A;  4R5C A;  1I94 H;  4A3M G;  3HXL A;  2FT3 A;  5IWA H;  2NUA B;  4C5A A;  1FS2 A;  4ZQI A;  5KFF A;  3H4D A;  2IA6 A;  2O03 A;  2XWT C;  3OJA B;  2FMA A;  2HVR A;  1HR0 H;  4Z8G A;  2RGV A;  2RF4 A;  2W6N A;  5DQI A;  2UU9 H;  2Z64 A;  4J9M A;  2W7O A;  4DL2 A;  4NKH A;  4X65 H;  2W6M A;  3PW0 A;  3G39 A;  4J4L A;  4O3S A;  2FLP A;  5DG8 A;  2B63 A;  3HOU G;  2CW8 A;  4ZHQ F;  3N44 B;  4WBN F;  4GT6 A;  1HNX H;  4O2A F;  2Q2T A;  4BSU A;  2VUG A;  4XX0 B;  4AYB A;  4J9R A;  1M0W A;  2FPP B;  1C3O A;  3MWM A;  4K17 A;  4NZT M;  1D0B A;  3Q8S B;  4DL5 A;  4FS2 A;  4U09 A;  3RB0 A;  5GMH A;  5BPF A;  2R8H A;  2AGO A;  3JRX A;  4Q8F A;  1XKU A;  1T3N A;  3G6V A;  3RFS A;  3C0F B;  2VA2 A;  1AN7 A;  2YS6 A;  2VQF H;  4AW4 A;  1OWT A;  3CVZ A;  2IBK A;  3WO1 A;  4B3M H;  4R8U A;  4WD3 A;  4UCR A;  2ASD A;  2NVX A;  5C1P A;  5HDH A;  3BZ5 A;  3PZP A;  5KFO A;  1GWB A;  5K2M A;  3TQ1 A;  2QK4 A;  2UZY A;  4PSJ A;  3H3V H;  1S0O A;  1P8T A;  5CMN A;  4IR1 A;  4X66 H;  1SCU B;  4TUY F;  1FT8 A;  3OGK B;  1XMQ H;  2O6Q A;  2IP4 A;  5KT3 A;  1M0T A;  5KFA A;  1JXL A;  1RJQ A;  3O53 A;  4Q0Y A;  3RGX A;  2C22 A;  2RR6 A;  4YJ3 F;  4CC6 A;  3WPD A;  4F4X A;  4PDB A;  1N36 H;  3OJA A;  4LMY A;  1V9P A;  1XEU A;  3PW4 A;  4RB3 C;  1TWH A;  2R87 A;  4DLK A;  2DWC A;  4Y8V B;  5KFP A;  4CNM A;  4DR4 H;  1ZQ7 A;  4JI5 H;  2DIK A;  4YY3 H;  4JI3 H;  1A0I A;  4RU9 A;  3WPH A;  2R93 A;  5FPR A;  1MZB A;  2MCT A;  2XGP A;  4LI1 A;  1O75 A;  4NLG A;  3JSL A;  1WR2 A;  1WCM G;  2VUM A;  4KXF B;  3OUZ A;  3RFC A;  3V4Z A;  2OMX A;  3GIP A;  2Z82 A;  2WB1 A;  3OSP A;  1WH2 A;  3ZYI A;  4YR2 A;  5BMV F;  5CA1 F;  4LH7 A;  1RK5 A;  3UN9 A;  3VQ2 A;  3BAA A;  1PK8 A;  4ME6 A;  1GYF A;  3OHB A;  2ID5 A;  3VPC A;  2FP4 B;  3JZI A;  4LF7 H;  1DCE A;  5DG7 A;  2R7Z A;  4DUZ H;  2Q4G W;  3GOZ A;  1I7L A;  5FLX W;  5KFU A;  3RFJ A;  4MV8 A;  2W9B A;  4AY9 X;  4ED2 A;  1U0N D;  2W7P A;  5KFX A;  2ELL A;  1C30 A;  4X62 H;  3JSN A;  2CQY A;  1Y1V A;  2Z62 A;  1BJT A;  4DR1 H;  4LFB H;  4DR5 H;  3H0G G;  4IRK A;  4LF8 H;  4R6G A;  5KFZ A;  5L1L A;  4EFE A;  4F4Y A;  3G06 A;  1OTM A;  3PMH G;  3UQ8 A;  2HVS A;  3G8C A;  4YR3 A;  1W8A A;  1AUX A;  1Z7X W;  2R86 A;  4DV3 H;  3SE7 A;  3R5X A;  4LF9 H;  4C2B B;  2UXB H;  2R8G A;  1ZET A;  1EZ1 A;  4GLP A;  3M9N B;  1GSA A;  5FLM G;  4DL7 A;  4Q8E A;  4C2M A;  4MV1 A;  4MV9 A;  2WFH A;  4A3D G;  2J9G A;  4LSX C;  3PR5 B;  4I7H A;  2R92 A;  3MR5 A;  3HOV G;  4K0K H;  4Y61 B;  2JA7 A;  1FVI A;  4EG0 A;  2YS7 A;  4LF5 H;  2VR1 A;  5GMG A;  3PW5 A;  4Z79 A;  2V4Q A;  3OSN A;  5KFI A;  4B3R H;  2YW2 A;  4ARR A;  3JRW A;  4R6J A;  4RAY A;  2WQX A;  5L1I A;  4ZI7 F;  2OMZ A;  4YAK B;  4JI8 H;  1N32 H;  4DV5 H;  2I8C A;  2ZDH A;  5HZL B;  1FJG H;  5FD5 A;  4RNN A;  5IYZ F;  2F4V H;  2OMT A;  2VQE H;  5EOY A;  2P1M B;  1CS0 A;  4EYH B;  3W3G A;  1IBL H;  4LFC H;  2DPI A;  1XNR H;  2FK1 A;  2V9T B;  1M10 B;  1I6U A;  5A2Q W;  4B3S H;  2OMY A;  1AUV A;  1EUD B;  3T5J A;  4EYI B;  2BNH A;  3DZE A;  1O6T A;  2Q2U A;  5L9X A;  5DGA A;  3WNZ A;  5KG7 A;  1UC8 A;  4GC6 A;  3RIZ A;  3L4K A;  1I3Q A;  3MFH A;  1QYY A;  4EBE A;  3MR2 A;  3TIG A;  2CZG A;  2J6S A;  3GLK A;  2ALZ A;  4LH6 A;  2HHH H;  3KHG A;  1DGS A;  4DV4 H;  2R82 A;  3V6J A;  3KHL A;  4IR9 A;  1P9A G;  3QZ8 A;  3HOW G;  3BQ0 A;  3Q8R B;  1N33 H;  4OQT A;  4EBD A;  4RAZ A;  4FDW A;  3MFI A;  3E6J A;  2X0S A;  4R0A A;  1KJ9 A;  1M6V A;  3P72 A;  1A9N A;  2BR0 A;  4IWY A;  4DR2 H;  3Q8Q B;  5KFD A;  1BGW A;  4JV1 A;  2R7M A;  2HVQ A;  3TIN A;  4ED8 A;  4ECO A;  2ZDG A;  1I50 A;  4R8U B;  4KNG A;  2W8L A;  5KFV A;  1H6U A;  3ETJ A;  5AWB A;  1PX2 A;  2AGP A;  3H4B A;  3ZYO A;  2FLL A;  1IO0 A;  1VKZ A;  4G3I A;  2P1P B;  5KG3 A;  3WPE A;  1A4Y A;  1K5G C;  3WN4 A;  4Q45 A;  4LF4 H;  4NXM H;  1M0Z A; 
#chains in the Genus database with same CATH homology
 4X66 H;  1FT8 A;  3OGK B;  1M9S A;  1XMQ H;  2O6Q A;  2HGS A;  4QXE A;  1M0T A;  4GLX A;  2Z81 A;  4FCG A;  1L2Z A;  3O53 A;  4Q0Y A;  4R5D A;  3RGX A;  4PKI G;  4UCS A;  2RR6 A;  4CC6 A;  3WPD A;  4PDB A;  1N36 H;  1O6V A;  3OJA A;  4LMY A;  3RFE A;  1V9P A;  3M4I A;  2WDT A;  1XEU A;  4RB3 C;  4RCW A;  4CC4 C;  4U08 A;  4CNM A;  4DR4 H;  4JI5 H;  4R08 A;  4YY3 H;  3W3N A;  1XEC A;  1XWD C;  4JI3 H;  4LFA H;  1A0I A;  4PQ8 A;  3WPH A;  4PER A;  2Z66 A;  5FPR A;  1MZB A;  2MCT A;  4JYA H;  3M19 A;  4LI1 A;  1O75 A;  2O6S A;  3F8N A;  3WPB A;  2UZX A;  3JSL A;  4Q3I A;  2Z7X B;  2CW7 A;  5IJC A;  5D1O A;  4I6J B;  3ULV A;  4KXF B;  4X64 H;  3KJ4 A;  3G3A A;  1DS9 A;  2UUB H;  1XCD A;  5FD6 A;  2Z7X A;  2OMX A;  3ULU A;  2Z82 A;  4LXR A;  1ZHQ A;  3N41 B;  4C2A B;  1WH2 A;  3G04 C;  3PN1 A;  5AWC A;  4Q62 A;  5B0N A;  1O6S A;  3ZYI A;  4OX9 H;  2WQV A;  4LXS A;  3L4J A;  4MTD A;  4KHP H;  4LH7 A;  3UL9 A;  3UN9 A;  5GS2 B;  3VQ2 A;  4FHO A;  3DF7 A;  4IAJ A;  4CIL A;  3BAA A;  1VS0 A;  4JI7 H;  2ZJT A;  3UL7 A;  3RF2 A;  1GYF A;  1OTN A;  2CA6 A;  4R09 A;  1LTX A;  2ID5 A;  3C6P B;  1FQV A;  3CIY A;  4KT1 A;  5AZ5 A;  1IBM H;  4B8C D;  1FKA H;  4LF7 H;  1DCE A;  4JI0 H;  4HQ1 A;  1SEI A;  2OMW A;  4DUZ H;  2Q4G W;  4RB2 C;  3T1H H;  3GOZ A;  4LI2 A;  5FLX W;  2Z65 A;  1XMO H;  3RFJ A;  3CIG A;  2WYO A;  4AY9 X;  5LL6 b;  2XIG A;  2ASS B;  3KAL A;  1U0N D;  4FMZ A;  4L3F A;  1OTO A;  5A5C A;  4APM A;  2ELL A;  3FMA A;  4JI2 H;  5GS0 A;  4A2B A;  4X62 H;  3JSN A;  2Z62 A;  1BJT A;  1OOK G;  1SYX B;  4DR1 H;  4L3A A;  4RB1 A;  4LFB H;  4DR5 H;  4LF8 H;  4R6G A;  4U7L A;  4Z64 C;  4EFE A;  2V70 A;  3OGM B;  3G06 A;  3KXY T;  3M18 A;  4XOS A;  1OTM A;  3PMH G;  3UQ8 A;  2HVS A;  4RWT C;  1W8A A;  3JB9 j;  4CC4 A;  4JI4 H;  1Z7X W;  4B3T H;  2OMV A;  4P8S A;  2AST B;  1X9N A;  1PGV A;  4DV3 H;  3BAB A;  1IBK H;  3W3K A;  2R9U A;  1DFJ I;  3E3Z A;  3H20 A;  3FXI A;  4IM6 A;  4LF9 H;  4C2B B;  3REZ A;  2UXB H;  1WWL A;  2OMU A;  4MQW X;  4XSQ A;  3O6N A;  1S03 G;  3LML A;  2WQW A;  3ULA A;  1YRG A;  4GLP A;  2UXC H;  1P8V A;  4DR7 H;  5IT9 W;  4LSX A;  2UXD H;  3L2P A;  1P8L A;  4V2E A;  5LMU H;  4R7R A;  2A0Z A;  3RTX A;  2KSW A;  4MV9 A;  4MTE A;  2WFH A;  4JI6 H;  4GKK H;  4UFZ A;  4UCO A;  2E5L H;  5D3I A;  4LSX C;  3WPG A;  3T1Y H;  4LSA A;  1KOH A;  3N6X A;  2P1Q B;  3CVR A;  4I7H A;  3BA9 A;  1E4G T;  4TZH A;  4NXN H;  5LMN H;  2IFG A;  4XGO A;  4J0M A;  2FE3 A;  4K0K H;  4PEQ B;  1Z2N X;  4A2A A;  4Y61 B;  3W3M A;  2Y5Q A;  4UCU A;  1FVI A;  2UUC H;  5FTT B;  3EYY A;  1K5D C;  4LF5 H;  4R6F A;  4Z94 G;  5IJB A;  5GMG A;  4DV7 H;  3N40 P;  4R07 A;  4UFR A;  4Z79 A;  4BSS A;  4U06 A;  2ZM6 H;  4B3R H;  4QBZ A;  4ARR A;  4JV5 H;  2P1N B;  4R6J A;  4RAY A;  1ZIW A;  5D1P A;  2WQX A;  4YEB B;  3KAJ A;  4DR6 H;  4UCV A;  4EFB A;  2OMZ A;  3C6N B;  4DR3 H;  4JI8 H;  1N32 H;  3J7A K;  4DV5 H;  5FPO A;  2JQD A;  3IG0 A;  1E4F T;  5HZL B;  4RZQ A;  4ECN A;  1FJG H;  1JL5 A;  1XDN A;  3K3V A;  4FS7 A;  4LF6 H;  2RA8 A;  5FD5 A;  4DUY H;  4DV6 H;  3N42 B;  3TSR E;  1HNW H;  1OGQ A;  2F4V H;  2OMT A;  3SB4 A;  1SQ0 B;  2OWO A;  4LSC A;  2VQE H;  5EOY A;  1OZN A;  1FO1 A;  2P1M B;  4CNC A;  4RCA B;  4UCT A;  4ARN A;  3RJ0 A;  1I94 H;  4AQY H;  1IBL H;  4LFC H;  4R5C A;  3W3G A;  4GKJ H;  3HXL A;  2FT3 A;  4EZG A;  3OTO H;  5IWA H;  1KOO A;  1ZHS A;  3G3B A;  1XNR H;  4Q3G A;  2V9T B;  1M10 B;  1FS2 A;  2JE1 A;  1TAE A;  1I6U A;  5A2Q W;  5AWD A;  1M9L A;  2Z63 A;  4B3S H;  2OMY A;  4WYK A;  5IJD A;  4QC0 A;  2BNH A;  3DZE A;  2YCH A;  1O6T A;  4V2C A;  2O03 A;  2Q2U A;  1S68 A;  2XWT C;  5B0T A;  3OJA B;  3E4G A;  2HVR A;  1HR0 H;  4G8A A;  4Z8G A;  2RGV A;  4M7E A;  2UU9 H;  5LFN A;  2Z64 A;  3RGZ A;  1B04 A;  4FM9 A;  2VPS A;  4WP6 A;  4NKH A;  4X65 H;  4DV1 H;  4CP6 A;  2WQU A;  3G39 A;  4NKG A;  4J4L A;  3RIZ A;  4M7E C;  1XNQ H;  4BWS C;  1HNZ H;  3L4K A;  4BSR A;  1QYY A;  2CW8 A;  5CMP A;  3N44 B;  4GT6 A;  1HNX H;  5D1O B;  2O6R A;  2Q2T A;  4BSU A;  4JI1 H;  2VUG A;  4P91 A;  4LH6 A;  4V2D A;  1M0W A;  3J81 W;  4FD0 A;  2HHH H;  3WPF A;  3W3J A;  3A79 B;  1DGS A;  3ZYN A;  5IYX C;  4DV4 H;  4H09 A;  3MWM A;  3E2J A;  5AWA A;  1P9A G;  4K17 A;  1J5E H;  1N33 H;  3OGL B;  1D0B A;  4OQT A;  4RAZ A;  4FDW A;  3E6J A;  4R0A A;  4RB0 A;  4BV4 R;  4DV2 H;  3BA8 A;  2VOB A;  4MV7 A;  2BEX A;  2UUA H;  3P72 A;  1A9N A;  4U09 A;  5GMH A;  4R58 A;  4R6A A;  4DR2 H;  5B4P A;  1BGW A;  2HVQ A;  3W3L A;  1XKU A;  3J80 W;  4YHH H;  3RFS A;  2V9S A;  4ECO A;  3UL8 A;  1G9U A;  3C0F B;  1AN7 A;  5BR8 H;  2VQF H;  4AW4 A;  4KNG A;  3KAK A;  1H6U A;  2P1O B;  4DV0 H;  3CVZ A;  4B3M H;  5AWB A;  5GMF A;  1Z2P X;  4UCR A;  4EEQ A;  3WPC A;  3ZYO A;  1N34 H;  1TA8 A;  2XOT A;  1IO0 A;  4MN8 B;  4ETS A;  5HDH A;  2WE6 A;  3BZ5 A;  3ZYJ A;  3RW6 A;  1Z2O X;  2RGR A;  2P1P B;  1H6T A;  1GWB A;  3VQ1 A;  3C6O B;  4CC5 A;  3WPE A;  1A4Y A;  1K5G C;  3N43 B;  3JAM W;  5GQR K;  3WN4 A;  3WPI A;  2UZY A;  4PSJ A;  4LF4 H;  4NXM H;  2JE0 A;  1P8T A;  1M0Z A;  5CMN A;  2W57 A;  4Z61 C;  3RW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...