2ASSB

Crystal structure of the skp1-skp2-cks1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
325
structure length
325
Chain Sequence
VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle/ligase/protein turnover
molecule keywords S-phase kinase-associated protein 1A
publication title Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2assB00
3OJAA 5IJBA 3O53A 4WP6A 1M9SA 2ASTB 3ULUA 4J4LA 2O6SA 2Z64A 4ECOA 3PMHG 3CIYA 3WPEA 4LSXA 4EZGA 4PSJA 4U06A 4FHOA 3UL8A 4CILA 3RFJA 4R6AA 3W3KA 2O6RA 2WQUA 3OGMB 3VQ1A 2WFHA 4AY9X 4P91A 2R9UA 3E6JA 1P9AG 5B0NA 2CA6A 4QBZA 4I6JB 1SQ0B 5AWBA 2P1OB 3RJ0A 1A4YA 3RIZA 3RFEA 3OGLB 4R5CA 4Z94G 4BSUA 2ELLA 2JQDA 3RW7A 3M18A 5CMNA 2BEXA 4ECNA 4HQ1A 1XWDC 1KOHA 1O6VA 4Q3IA 5HZLB 5A5CA 4ARNA 3UN9A 3E2JA 1W8AA 5D3IA 2Z63A 4H09A 5GS2B 4R09A 4B8CD 3W3LA 1IO0A 4KXFB 1O6SA 4M7EC 4PQ8A 1OGQA 3WPIA 3VQ2A 1OTNA 3CIGA 4FS7A 4R5DA 3BZ5A 4MQWX 4R6GA 3O6NA 2OMUA 4RCWA 3W3MA 3RW6A 3G04C 4QC0A 4CNCA 4V2CA 2JE1A 4XSQA 2UZYA 4MN8B 4XGOA 4V2EA 3G06A 2Z7XB 4BSRA 2OMVA 5AWDA 4GT6A 4BV4R 2O6QA 4FMZA 1OZNA 2XOTA 2Q4GW 5LFNA 4AW4A 2OMWA 2FT3A 3G39A 3W3GA 3CVRA 5IJDA 2Z66A 4Y61B 4Z79A 1M10B 5AZ5A 1OTOA 3C6PB 5B0TA 1H6UA 1H6TA 2Z7XA 1JL5A 4J0MA 5HDHA 4BSSA 1FS2A 3C6NB 1A9NA 2A0ZA 1P8TA 4LI2A 4R58A 3ZYOA 4C2BB 3JB9j 3W3JA 1GWBA 5AWAA 1XCDA 3C6OB 2OMXA 2RR6A 2Z65A 4NKHA 2Z81A 4G8AA 2IFGA 1DS9A 5GS0A 1XECA 4NKGA 4CC4C 2WQVA 2Z82A 2V70A 3WPDA 4YEBB 1K5DC 4LXSA 2XWTC 4R6JA 4KNGA 1M0ZA 4PEQB 1QYYA 5IJCA 4K17A 4P8SA 1WWLA 2ID5A 3ULVA 4LXRA 3ULAA 1XKUA 4XOSA 4U09A 2P1NB 3W3NA 4WYKA 4LSAA 1FO1A 4TZHA 5B4PA 3WPCA 3DZEA 1U0ND 3M19A 4LI1A 3UL9A 3E4GA 1O6TA 5FTTB 3WN4A 2RA8A 5GMHA 3REZA 4LSCA 2BNHA 3E3ZA 3TSRE 4CNMA 1D0BA 2P1QB 4CC4A 4Q3GA 4C2AB 5GMFA 3RGZA 2P1MB 2P1PB 4M7EA 3P72A 2ASSB 5CMPA 5GMGA 2Y5QA 3ZYJA 3GOZA 1YRGA 3WPBA 4KT1A 4Z61C 1DFJI 4IM6A 4OQTA 1Z7XW 1G9UA 3G3AA 1KOOA 2WQXA 1FQVA 4R0AA 2OMTA 4PERA 2Z62A 1LTXA 1PGVA 2OMZA 1K5GC 4U08A 4R08A 1M9LA 1OTMA 4V2DA 4CP6A 1OOKG 1P8VA 3KJ4A 5GQRK 2V9TB 3OGKB 5AWCA 5IYXC 4Z8GA 3SB4A 4RWTC 4Q62A 4ARRA 3ZYIA 4GLPA 4PKIG 4Z64C 1FT8A 4R07A 3OJAB 3WPGA 3FXIA 4LSXC 1DCEA 4UFRA 1XEUA 3WPFA 4RCAB 4QXEA 3UL7A 4FD0A 3RFSA 3RGXA 2JE0A 3WPHA 2UZXA 2WQWA 3G3BA 1ZIWA 4U7LA 4FDWA 4L3AA 2V9SA 4L3FA 2OMYA 4R6FA 3ZYNA 4FCGA 3A79B
chains in the Genus database with same CATH superfamily
3OJAA 5IJBA 3O53A 4WP6A 1M9SA 2ASTB 3ULUA 4J4LA 2O6SA 2Z64A 4ECOA 3PMHG 3CIYA 3WPEA 4LSXA 4EZGA 4PSJA 4U06A 4FHOA 3UL8A 4CILA 3RFJA 4R6AA 3W3KA 2O6RA 2WQUA 3OGMB 3VQ1A 2WFHA 4AY9X 4P91A 2R9UA 3E6JA 1P9AG 5B0NA 2CA6A 4QBZA 4I6JB 1SQ0B 5AWBA 2P1OB 3RJ0A 1A4YA 3RIZA 3RFEA 3OGLB 4R5CA 4Z94G 4BSUA 2ELLA 2JQDA 3RW7A 3M18A 5CMNA 2BEXA 4ECNA 4HQ1A 1XWDC 1KOHA 1O6VA 4Q3IA 5HZLB 5A5CA 4ARNA 3UN9A 3E2JA 1W8AA 5D3IA 2Z63A 4H09A 5GS2B 4R09A 4B8CD 3W3LA 1IO0A 4KXFB 1O6SA 4M7EC 4PQ8A 1OGQA 3WPIA 3VQ2A 1OTNA 3CIGA 4FS7A 4R5DA 3BZ5A 4MQWX 4R6GA 3O6NA 2OMUA 4RCWA 3W3MA 3RW6A 3G04C 4QC0A 4CNCA 4V2CA 2JE1A 4XSQA 2UZYA 4MN8B 4XGOA 4V2EA 3G06A 2Z7XB 4BSRA 2OMVA 5AWDA 4GT6A 4BV4R 2O6QA 4FMZA 1OZNA 2XOTA 2Q4GW 5LFNA 4AW4A 2OMWA 2FT3A 3G39A 3W3GA 3CVRA 5IJDA 2Z66A 4Y61B 4Z79A 1M10B 5AZ5A 1OTOA 3C6PB 5B0TA 1H6UA 1H6TA 2Z7XA 1JL5A 4J0MA 5HDHA 4BSSA 1FS2A 3C6NB 1A9NA 2A0ZA 1P8TA 4LI2A 4R58A 3ZYOA 4C2BB 3JB9j 3W3JA 1GWBA 5AWAA 1XCDA 3C6OB 2OMXA 2RR6A 2Z65A 4NKHA 2Z81A 4G8AA 2IFGA 1DS9A 5GS0A 1XECA 4NKGA 4CC4C 2WQVA 2Z82A 2V70A 3WPDA 4YEBB 1K5DC 4LXSA 2XWTC 4R6JA 4NZTM 4KNGA 1M0ZA 4PEQB 1QYYA 5IJCA 4K17A 4P8SA 1WWLA 2ID5A 3ULVA 4LXRA 3ULAA 1XKUA 4XOSA 4U09A 2P1NB 3W3NA 4WYKA 4LSAA 1FO1A 4TZHA 5B4PA 3WPCA 3DZEA 1U0ND 3M19A 4LI1A 3UL9A 3E4GA 1O6TA 5FTTB 3WN4A 2RA8A 5GMHA 3REZA 4LSCA 2BNHA 3E3ZA 3TSRE 4CNMA 1D0BA 2P1QB 4CC4A 4Q3GA 4C2AB 5GMFA 3RGZA 2P1MB 2P1PB 4M7EA 3P72A 2ASSB 5CMPA 5GMGA 2Y5QA 3ZYJA 3GOZA 1YRGA 3WPBA 4KT1A 4Z61C 1DFJI 4IM6A 4OQTA 1Z7XW 1G9UA 3G3AA 1KOOA 2WQXA 1FQVA 4R0AA 2OMTA 4PERA 2Z62A 1LTXA 1PGVA 2OMZA 1K5GC 4U08A 4R08A 1M9LA 1OTMA 4V2DA 4CP6A 1OOKG 1P8VA 3KJ4A 5GQRK 2V9TB 3OGKB 5AWCA 5IYXC 4Z8GA 3SB4A 4RWTC 4Q62A 4ARRA 3ZYIA 4GLPA 4PKIG 4Z64C 1FT8A 4R07A 3OJAB 3WPGA 3FXIA 4LSXC 1DCEA 4UFRA 1XEUA 3WPFA 4RCAB 4QXEA 3UL7A 4FD0A 3RFSA 3RGXA 2JE0A 3WPHA 2UZXA 2WQWA 3G3BA 1ZIWA 4U7LA 4FDWA 4L3AA 2V9SA 4L3FA 2OMYA 4R6FA 3ZYNA 4NZRM 4FCGA 3A79B
chains in the Genus database with same CATH topology
3OJAA 5IJBA 3O53A 4WP6A 1M9SA 2ASTB 3ULUA 4J4LA 2O6SA 2Z64A 4ECOA 3PMHG 3CIYA 3WPEA 4LSXA 4EZGA 4PSJA 4U06A 4FHOA 3UL8A 4CILA 3RFJA 4R6AA 3W3KA 2O6RA 2WQUA 3OGMB 3VQ1A 2WFHA 4AY9X 4P91A 2R9UA 3E6JA 1P9AG 5B0NA 2CA6A 4QBZA 4I6JB 1SQ0B 5AWBA 2P1OB 3RJ0A 1A4YA 3RIZA 3RFEA 3OGLB 4R5CA 4Z94G 4BSUA 2ELLA 2JQDA 3RW7A 3M18A 5CMNA 2BEXA 4ECNA 4HQ1A 1XWDC 1KOHA 1O6VA 4Q3IA 5HZLB 5A5CA 4ARNA 3UN9A 3E2JA 1W8AA 5D3IA 2Z63A 4H09A 5GS2B 4R09A 4B8CD 3W3LA 1IO0A 4KXFB 1O6SA 4M7EC 4PQ8A 1OGQA 3WPIA 3VQ2A 1OTNA 3CIGA 4FS7A 4R5DA 3BZ5A 4MQWX 4R6GA 3O6NA 2OMUA 4RCWA 3W3MA 3RW6A 3G04C 4QC0A 4CNCA 4V2CA 2JE1A 4XSQA 2UZYA 4MN8B 4XGOA 4V2EA 3G06A 2Z7XB 4BSRA 2OMVA 5AWDA 4GT6A 4BV4R 2O6QA 4FMZA 1OZNA 2XOTA 2Q4GW 5LFNA 4AW4A 2OMWA 2FT3A 3G39A 3W3GA 3CVRA 5IJDA 2Z66A 4Y61B 4Z79A 1M10B 5AZ5A 1OTOA 3C6PB 5B0TA 1H6UA 1H6TA 2Z7XA 1JL5A 4J0MA 5HDHA 4BSSA 1FS2A 3C6NB 1A9NA 2A0ZA 1P8TA 4LI2A 4R58A 3ZYOA 4C2BB 3JB9j 3W3JA 1GWBA 5AWAA 1XCDA 3C6OB 2OMXA 2RR6A 2Z65A 4NKHA 2Z81A 4G8AA 2IFGA 1DS9A 5GS0A 1XECA 4NKGA 4CC4C 2WQVA 2Z82A 2V70A 3WPDA 4YEBB 1K5DC 4LXSA 2XWTC 4R6JA 4KNGA 1M0ZA 4PEQB 1QYYA 5IJCA 4K17A 4P8SA 1WWLA 2ID5A 3ULVA 4LXRA 3ULAA 1XKUA 4XOSA 4U09A 2P1NB 3W3NA 4WYKA 4LSAA 1FO1A 4TZHA 5B4PA 3WPCA 3DZEA 1U0ND 3M19A 4LI1A 3UL9A 3E4GA 1O6TA 5FTTB 3WN4A 2RA8A 5GMHA 3REZA 4LSCA 2BNHA 3E3ZA 3TSRE 4CNMA 1D0BA 2P1QB 4CC4A 4Q3GA 4C2AB 5GMFA 3RGZA 2P1MB 2P1PB 4M7EA 3P72A 2ASSB 5CMPA 5GMGA 2Y5QA 3ZYJA 3GOZA 1YRGA 3WPBA 4KT1A 4Z61C 1DFJI 4IM6A 4OQTA 1Z7XW 1G9UA 3G3AA 1KOOA 2WQXA 1FQVA 4R0AA 2OMTA 4PERA 2Z62A 1LTXA 1PGVA 2OMZA 1K5GC 4U08A 4R08A 1M9LA 1OTMA 4V2DA 4CP6A 1OOKG 1P8VA 3KJ4A 5GQRK 2V9TB 3OGKB 5AWCA 5IYXC 4Z8GA 3SB4A 4RWTC 4Q62A 4ARRA 3ZYIA 4GLPA 4PKIG 4Z64C 1FT8A 4R07A 3OJAB 3WPGA 3FXIA 4LSXC 1DCEA 4UFRA 1XEUA 3WPFA 4RCAB 4QXEA 3UL7A 4FD0A 3RFSA 3RGXA 2JE0A 3WPHA 2UZXA 2WQWA 3G3BA 1ZIWA 4U7LA 4FDWA 4L3AA 2V9SA 4L3FA 2OMYA 4R6FA 3ZYNA 4FCGA 3A79B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJA A;  5IJB A;  3O53 A;  4WP6 A;  1M9S A;  2AST B;  3ULU A;  4J4L A;  2O6S A;  2Z64 A;  4ECO A;  3PMH G;  3CIY A;  3WPE A;  4LSX A;  4EZG A;  4PSJ A;  4U06 A;  4FHO A;  3UL8 A;  4CIL A;  3RFJ A;  4R6A A;  3W3K A;  2O6R A;  2WQU A;  3OGM B;  3VQ1 A;  2WFH A;  4AY9 X;  4P91 A;  2R9U A;  3E6J A;  1P9A G;  5B0N A;  2CA6 A;  4QBZ A;  4I6J B;  1SQ0 B;  5AWB A;  2P1O B;  3RJ0 A;  1A4Y A;  3RIZ A;  3RFE A;  3OGL B;  4R5C A;  4Z94 G;  4BSU A;  2ELL A;  2JQD A;  3RW7 A;  3M18 A;  5CMN A;  2BEX A;  4ECN A;  4HQ1 A;  1XWD C;  1KOH A;  1O6V A;  4Q3I A;  5HZL B;  5A5C A;  4ARN A;  3UN9 A;  3E2J A;  1W8A A;  5D3I A;  2Z63 A;  4H09 A;  5GS2 B;  4R09 A;  4B8C D;  3W3L A;  1IO0 A;  4KXF B;  1O6S A;  4M7E C;  4PQ8 A;  1OGQ A;  3WPI A;  3VQ2 A;  1OTN A;  3CIG A;  4FS7 A;  4R5D A;  3BZ5 A;  4MQW X;  4R6G A;  3O6N A;  2OMU A;  4RCW A;  3W3M A;  3RW6 A;  3G04 C;  4QC0 A;  4CNC A;  4V2C A;  2JE1 A;  4XSQ A;  2UZY A;  4MN8 B;  4XGO A;  4V2E A;  3G06 A;  2Z7X B;  4BSR A;  2OMV A;  5AWD A;  4GT6 A;  4BV4 R;  2O6Q A;  4FMZ A;  1OZN A;  2XOT A;  2Q4G W;  5LFN A;  4AW4 A;  2OMW A;  2FT3 A;  3G39 A;  3W3G A;  3CVR A;  5IJD A;  2Z66 A;  4Y61 B;  4Z79 A;  1M10 B;  5AZ5 A;  1OTO A;  3C6P B;  5B0T A;  1H6U A;  1H6T A;  2Z7X A;  1JL5 A;  4J0M A;  5HDH A;  4BSS A;  1FS2 A;  3C6N B;  1A9N A;  2A0Z A;  1P8T A;  4LI2 A;  4R58 A;  3ZYO A;  4C2B B;  3JB9 j;  3W3J A;  1GWB A;  5AWA A;  1XCD A;  3C6O B;  2OMX A;  2RR6 A;  2Z65 A;  4NKH A;  2Z81 A;  4G8A A;  2IFG A;  1DS9 A;  5GS0 A;  1XEC A;  4NKG A;  4CC4 C;  2WQV A;  2Z82 A;  2V70 A;  3WPD A;  4YEB B;  1K5D C;  4LXS A;  2XWT C;  4R6J A;  4KNG A;  1M0Z A;  4PEQ B;  1QYY A;  5IJC A;  4K17 A;  4P8S A;  1WWL A;  2ID5 A;  3ULV A;  4LXR A;  3ULA A;  1XKU A;  4XOS A;  4U09 A;  2P1N B;  3W3N A;  4WYK A;  4LSA A;  1FO1 A;  4TZH A;  5B4P A;  3WPC A;  3DZE A;  1U0N D;  3M19 A;  4LI1 A;  3UL9 A;  3E4G A;  1O6T A;  5FTT B;  3WN4 A;  2RA8 A;  5GMH A;  3REZ A;  4LSC A;  2BNH A;  3E3Z A;  3TSR E;  4CNM A;  1D0B A;  2P1Q B;  4CC4 A;  4Q3G A;  4C2A B;  5GMF A;  3RGZ A;  2P1M B;  2P1P B;  4M7E A;  3P72 A;  2ASS B;  5CMP A;  5GMG A;  2Y5Q A;  3ZYJ A;  3GOZ A;  1YRG A;  3WPB A;  4KT1 A;  4Z61 C;  1DFJ I;  4IM6 A;  4OQT A;  1Z7X W;  1G9U A;  3G3A A;  1KOO A;  2WQX A;  1FQV A;  4R0A A;  2OMT A;  4PER A;  2Z62 A;  1LTX A;  1PGV A;  2OMZ A;  1K5G C;  4U08 A;  4R08 A;  1M9L A;  1OTM A;  4V2D A;  4CP6 A;  1OOK G;  1P8V A;  3KJ4 A;  5GQR K;  2V9T B;  3OGK B;  5AWC A;  5IYX C;  4Z8G A;  3SB4 A;  4RWT C;  4Q62 A;  4ARR A;  3ZYI A;  4GLP A;  4PKI G;  4Z64 C;  1FT8 A;  4R07 A;  3OJA B;  3WPG A;  3FXI A;  4LSX C;  1DCE A;  4UFR A;  1XEU A;  3WPF A;  4RCA B;  4QXE A;  3UL7 A;  4FD0 A;  3RFS A;  3RGX A;  2JE0 A;  3WPH A;  2UZX A;  2WQW A;  3G3B A;  1ZIW A;  4U7L A;  4FDW A;  4L3A A;  2V9S A;  4L3F A;  2OMY A;  4R6F A;  3ZYN A;  4FCG A;  3A79 B; 
#chains in the Genus database with same CATH topology
 3OJA A;  5IJB A;  3O53 A;  4WP6 A;  1M9S A;  2AST B;  3ULU A;  4J4L A;  2O6S A;  2Z64 A;  4ECO A;  3PMH G;  3CIY A;  3WPE A;  4LSX A;  4EZG A;  4PSJ A;  4U06 A;  4FHO A;  3UL8 A;  4CIL A;  3RFJ A;  4R6A A;  3W3K A;  2O6R A;  2WQU A;  3OGM B;  3VQ1 A;  2WFH A;  4AY9 X;  4P91 A;  2R9U A;  3E6J A;  1P9A G;  5B0N A;  2CA6 A;  4QBZ A;  4I6J B;  1SQ0 B;  5AWB A;  2P1O B;  3RJ0 A;  1A4Y A;  3RIZ A;  3RFE A;  3OGL B;  4R5C A;  4Z94 G;  4BSU A;  2ELL A;  2JQD A;  3RW7 A;  3M18 A;  5CMN A;  2BEX A;  4ECN A;  4HQ1 A;  1XWD C;  1KOH A;  1O6V A;  4Q3I A;  5HZL B;  5A5C A;  4ARN A;  3UN9 A;  3E2J A;  1W8A A;  5D3I A;  2Z63 A;  4H09 A;  5GS2 B;  4R09 A;  4B8C D;  3W3L A;  1IO0 A;  4KXF B;  1O6S A;  4M7E C;  4PQ8 A;  1OGQ A;  3WPI A;  3VQ2 A;  1OTN A;  3CIG A;  4FS7 A;  4R5D A;  3BZ5 A;  4MQW X;  4R6G A;  3O6N A;  2OMU A;  4RCW A;  3W3M A;  3RW6 A;  3G04 C;  4QC0 A;  4CNC A;  4V2C A;  2JE1 A;  4XSQ A;  2UZY A;  4MN8 B;  4XGO A;  4V2E A;  3G06 A;  2Z7X B;  4BSR A;  2OMV A;  5AWD A;  4GT6 A;  4BV4 R;  2O6Q A;  4FMZ A;  1OZN A;  2XOT A;  2Q4G W;  5LFN A;  4AW4 A;  2OMW A;  2FT3 A;  3G39 A;  3W3G A;  3CVR A;  5IJD A;  2Z66 A;  4Y61 B;  4Z79 A;  1M10 B;  5AZ5 A;  1OTO A;  3C6P B;  5B0T A;  1H6U A;  1H6T A;  2Z7X A;  1JL5 A;  4J0M A;  5HDH A;  4BSS A;  1FS2 A;  3C6N B;  1A9N A;  2A0Z A;  1P8T A;  4LI2 A;  4R58 A;  3ZYO A;  4C2B B;  3JB9 j;  3W3J A;  1GWB A;  5AWA A;  1XCD A;  3C6O B;  2OMX A;  2RR6 A;  2Z65 A;  4NKH A;  2Z81 A;  4G8A A;  2IFG A;  1DS9 A;  5GS0 A;  1XEC A;  4NKG A;  4CC4 C;  2WQV A;  2Z82 A;  2V70 A;  3WPD A;  4YEB B;  1K5D C;  4LXS A;  2XWT C;  4R6J A;  4NZT M;  4KNG A;  1M0Z A;  4PEQ B;  1QYY A;  5IJC A;  4K17 A;  4P8S A;  1WWL A;  2ID5 A;  3ULV A;  4LXR A;  3ULA A;  1XKU A;  4XOS A;  4U09 A;  2P1N B;  3W3N A;  4WYK A;  4LSA A;  1FO1 A;  4TZH A;  5B4P A;  3WPC A;  3DZE A;  1U0N D;  3M19 A;  4LI1 A;  3UL9 A;  3E4G A;  1O6T A;  5FTT B;  3WN4 A;  2RA8 A;  5GMH A;  3REZ A;  4LSC A;  2BNH A;  3E3Z A;  3TSR E;  4CNM A;  1D0B A;  2P1Q B;  4CC4 A;  4Q3G A;  4C2A B;  5GMF A;  3RGZ A;  2P1M B;  2P1P B;  4M7E A;  3P72 A;  2ASS B;  5CMP A;  5GMG A;  2Y5Q A;  3ZYJ A;  3GOZ A;  1YRG A;  3WPB A;  4KT1 A;  4Z61 C;  1DFJ I;  4IM6 A;  4OQT A;  1Z7X W;  1G9U A;  3G3A A;  1KOO A;  2WQX A;  1FQV A;  4R0A A;  2OMT A;  4PER A;  2Z62 A;  1LTX A;  1PGV A;  2OMZ A;  1K5G C;  4U08 A;  4R08 A;  1M9L A;  1OTM A;  4V2D A;  4CP6 A;  1OOK G;  1P8V A;  3KJ4 A;  5GQR K;  2V9T B;  3OGK B;  5AWC A;  5IYX C;  4Z8G A;  3SB4 A;  4RWT C;  4Q62 A;  4ARR A;  3ZYI A;  4GLP A;  4PKI G;  4Z64 C;  1FT8 A;  4R07 A;  3OJA B;  3WPG A;  3FXI A;  4LSX C;  1DCE A;  4UFR A;  1XEU A;  3WPF A;  4RCA B;  4QXE A;  3UL7 A;  4FD0 A;  3RFS A;  3RGX A;  2JE0 A;  3WPH A;  2UZX A;  2WQW A;  3G3B A;  1ZIW A;  4U7L A;  4FDW A;  4L3A A;  2V9S A;  4L3F A;  2OMY A;  4R6F A;  3ZYN A;  4NZR M;  4FCG A;  3A79 B; 
#chains in the Genus database with same CATH homology
 3OJA A;  5IJB A;  3O53 A;  4WP6 A;  1M9S A;  2AST B;  3ULU A;  4J4L A;  2O6S A;  2Z64 A;  4ECO A;  3PMH G;  3CIY A;  3WPE A;  4LSX A;  4EZG A;  4PSJ A;  4U06 A;  4FHO A;  3UL8 A;  4CIL A;  3RFJ A;  4R6A A;  3W3K A;  2O6R A;  2WQU A;  3OGM B;  3VQ1 A;  2WFH A;  4AY9 X;  4P91 A;  2R9U A;  3E6J A;  1P9A G;  5B0N A;  2CA6 A;  4QBZ A;  4I6J B;  1SQ0 B;  5AWB A;  2P1O B;  3RJ0 A;  1A4Y A;  3RIZ A;  3RFE A;  3OGL B;  4R5C A;  4Z94 G;  4BSU A;  2ELL A;  2JQD A;  3RW7 A;  3M18 A;  5CMN A;  2BEX A;  4ECN A;  4HQ1 A;  1XWD C;  1KOH A;  1O6V A;  4Q3I A;  5HZL B;  5A5C A;  4ARN A;  3UN9 A;  3E2J A;  1W8A A;  5D3I A;  2Z63 A;  4H09 A;  5GS2 B;  4R09 A;  4B8C D;  3W3L A;  1IO0 A;  4KXF B;  1O6S A;  4M7E C;  4PQ8 A;  1OGQ A;  3WPI A;  3VQ2 A;  1OTN A;  3CIG A;  4FS7 A;  4R5D A;  3BZ5 A;  4MQW X;  4R6G A;  3O6N A;  2OMU A;  4RCW A;  3W3M A;  3RW6 A;  3G04 C;  4QC0 A;  4CNC A;  4V2C A;  2JE1 A;  4XSQ A;  2UZY A;  4MN8 B;  4XGO A;  4V2E A;  3G06 A;  2Z7X B;  4BSR A;  2OMV A;  5AWD A;  4GT6 A;  4BV4 R;  2O6Q A;  4FMZ A;  1OZN A;  2XOT A;  2Q4G W;  5LFN A;  4AW4 A;  2OMW A;  2FT3 A;  3G39 A;  3W3G A;  3CVR A;  5IJD A;  2Z66 A;  4Y61 B;  4Z79 A;  1M10 B;  5AZ5 A;  1OTO A;  3C6P B;  5B0T A;  1H6U A;  1H6T A;  2Z7X A;  1JL5 A;  4J0M A;  5HDH A;  4BSS A;  1FS2 A;  3C6N B;  1A9N A;  2A0Z A;  1P8T A;  4LI2 A;  4R58 A;  3ZYO A;  4C2B B;  3JB9 j;  3W3J A;  1GWB A;  5AWA A;  1XCD A;  3C6O B;  2OMX A;  2RR6 A;  2Z65 A;  4NKH A;  2Z81 A;  4G8A A;  2IFG A;  1DS9 A;  5GS0 A;  1XEC A;  4NKG A;  4CC4 C;  2WQV A;  2Z82 A;  2V70 A;  3WPD A;  4YEB B;  1K5D C;  4LXS A;  2XWT C;  4R6J A;  4KNG A;  1M0Z A;  4PEQ B;  1QYY A;  5IJC A;  4K17 A;  4P8S A;  1WWL A;  2ID5 A;  3ULV A;  4LXR A;  3ULA A;  1XKU A;  4XOS A;  4U09 A;  2P1N B;  3W3N A;  4WYK A;  4LSA A;  1FO1 A;  4TZH A;  5B4P A;  3WPC A;  3DZE A;  1U0N D;  3M19 A;  4LI1 A;  3UL9 A;  3E4G A;  1O6T A;  5FTT B;  3WN4 A;  2RA8 A;  5GMH A;  3REZ A;  4LSC A;  2BNH A;  3E3Z A;  3TSR E;  4CNM A;  1D0B A;  2P1Q B;  4CC4 A;  4Q3G A;  4C2A B;  5GMF A;  3RGZ A;  2P1M B;  2P1P B;  4M7E A;  3P72 A;  2ASS B;  5CMP A;  5GMG A;  2Y5Q A;  3ZYJ A;  3GOZ A;  1YRG A;  3WPB A;  4KT1 A;  4Z61 C;  1DFJ I;  4IM6 A;  4OQT A;  1Z7X W;  1G9U A;  3G3A A;  1KOO A;  2WQX A;  1FQV A;  4R0A A;  2OMT A;  4PER A;  2Z62 A;  1LTX A;  1PGV A;  2OMZ A;  1K5G C;  4U08 A;  4R08 A;  1M9L A;  1OTM A;  4V2D A;  4CP6 A;  1OOK G;  1P8V A;  3KJ4 A;  5GQR K;  2V9T B;  3OGK B;  5AWC A;  5IYX C;  4Z8G A;  3SB4 A;  4RWT C;  4Q62 A;  4ARR A;  3ZYI A;  4GLP A;  4PKI G;  4Z64 C;  1FT8 A;  4R07 A;  3OJA B;  3WPG A;  3FXI A;  4LSX C;  1DCE A;  4UFR A;  1XEU A;  3WPF A;  4RCA B;  4QXE A;  3UL7 A;  4FD0 A;  3RFS A;  3RGX A;  2JE0 A;  3WPH A;  2UZX A;  2WQW A;  3G3B A;  1ZIW A;  4U7L A;  4FDW A;  4L3A A;  2V9S A;  4L3F A;  2OMY A;  4R6F A;  3ZYN A;  4FCG A;  3A79 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...