2ASSB

Crystal structure of the skp1-skp2-cks1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
325
structure length
325
Chain Sequence
b'VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/ligase/protein turnover
total genus 112
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2assB00
1QYYA 4U09A 3WPGA 3RFSA 2O6SA 2OMUA 1O6SA 3FXIA 3E4GA 4PEQB 1OTNA 4BSSA 5AWCA 4LSXC 1P9AG 3ZYIA 1FT8A 2A0ZA 3E3ZA 2ASSB 5HZLB 1XECA 5CMPA 2OMXA 4LSAA 3RGXA 2IFGA 4M7EC 4AW4A 2P1PB 2V9TB 4BSUA 4V2CA 4L3FA 4C2AB 4G8AA 4CNMA 2Z7XB 3A79B 2V9SA 2OMWA 3UL9A 2P1NB 3O53A 4IM6A 4CP6A 4ARRA 4GLPA 2Y5QA 4FS7A 1W8AA 4FHOA 3W3JA 5D3IA 3W3GA 4CC4A 2ELLA 1OGQA 1XCDA 5AWAA 4KT1A 1XKUA 4Q3GA 1GWBA 1YRGA 4XOSA 2Z66A 2UZYA 3KJ4A 3W3KA 4R6FA 5AWBA 2Z81A 4FD0A 5LFNA 2WQXA 3RW6A 1P8VA 3JB9j 4R08A 5GMFA 4YEBB 5IJDA 1DCEA 2JQDA 4R0AA 1M0ZA 4MN8B 3WPEA 4FDWA 4OQTA 4J4LA 3PMHG 4LSCA 2BEXA 2P1QB 4Z64C 1OTOA 3ULUA 2FT3A 1KOOA 3OGLB 4U08A 1Z7XW 1FS2A 3OJAB 4R58A 3WPFA 3C6OB 4R6GA 2WQVA 2O6RA 5GMHA 1G9UA 2O6QA 4XSQA 3RW7A 1DS9A 4NKHA 4RCAB 4LSXA 1O6TA 4ARNA 1K5GC 1SQ0B 2XWTC 4R09A 3WPIA 2Z63A 2XOTA 4Z61C 2R9UA 4J0MA 4R6AA 4P8SA 3CVRA 4V2DA 4M7EA 3C6PB 3REZA 1OOKG 2Z65A 4R07A 3ULVA 3DZEA 3M18A 3P72A 5B0TA 1KOHA 5A5CA 4RWTC 1U0ND 3RJ0A 1FQVA 5GMGA 4Q3IA 4XGOA 4CNCA 2OMVA 4UFRA 3W3NA 2ASTB 2WQUA 1K5DC 3ZYOA 4H09A 4QC0A 1H6UA 4EZGA 1DFJI 4PKIG 4BSRA 4LI1A 1ZIWA 3O6NA 3G04C 2Z64A 2WQWA 3WPHA 4I6JB 4QBZA 2UZXA 2V70A 5FTTB 4CILA 3WPDA 2CA6A 5HDHA 2Z7XA 2Z82A 5B0NA 4C2BB 2JE1A 1M9LA 5IJCA 5GS2B 3G3BA 2Z62A 3WPCA 3E6JA 1WWLA 2RR6A 4Z94G 4R5DA 5B4PA 3CIGA 4TZHA 3SB4A 3ZYNA 1H6TA 4PERA 4QXEA 3BZ5A 3G06A 5IYXC 2P1MB 3TSRE 2OMZA 4U7LA 3UL7A 4FMZA 4AY9X 1LTXA 1OTMA 1O6VA 3OGKB 4Z8GA 4KXFB 3RGZA 3ZYJA 3OGMB 3UL8A 4R6JA 1JL5A 3ULAA 2RA8A 3G3AA 3RFEA 3C6NB 4R5CA 1XWDC 3VQ1A 5IJBA 3CIYA 3OJAA 4MQWX 1A9NA 3E2JA 4ECOA 2WFHA 3VQ2A 4Y61B 2OMYA 3G39A 4KNGA 3RIZA 4LXRA 2P1OB 3W3LA 4WYKA 4RCWA 1XEUA 5AWDA 4V2EA 1D0BA 2ID5A 5GS0A 4P91A 4CC4C 1P8TA 4U06A 4Z79A 4BV4R 4L3AA 4WP6A 5CMNA 4Q62A 1IO0A 2OMTA 5GQRK 4ECNA 4K17A 5AZ5A 3M19A 3UN9A 4B8CD 4LXSA 1M10B 1FO1A 4LI2A 1M9SA 3RFJA 3WN4A 2BNHA 1A4YA 1PGVA 4NKGA 4FCGA 1OZNA 2Q4GW 4HQ1A 4PSJA 3WPBA 2JE0A 3GOZA 4PQ8A 3W3MA 4GT6A
chains in the Genus database with same CATH superfamily
1QYYA 4U09A 3WPGA 3RFSA 2O6SA 2OMUA 1O6SA 3FXIA 3E4GA 4PEQB 1OTNA 4BSSA 5AWCA 4LSXC 1P9AG 3ZYIA 1FT8A 2A0ZA 3E3ZA 2ASSB 5HZLB 1XECA 5CMPA 2OMXA 4LSAA 3RGXA 2IFGA 4M7EC 4AW4A 2P1PB 2V9TB 4BSUA 4V2CA 4L3FA 4C2AB 4G8AA 4CNMA 2Z7XB 3A79B 2V9SA 2OMWA 3UL9A 2P1NB 3O53A 4IM6A 4CP6A 4ARRA 4GLPA 2Y5QA 4FS7A 1W8AA 4FHOA 3W3JA 5D3IA 3W3GA 4CC4A 2ELLA 1OGQA 1XCDA 5AWAA 4KT1A 1XKUA 4Q3GA 1GWBA 1YRGA 4XOSA 2Z66A 2UZYA 3KJ4A 3W3KA 4R6FA 5AWBA 2Z81A 4FD0A 5LFNA 2WQXA 3RW6A 1P8VA 3JB9j 4R08A 5GMFA 4YEBB 5IJDA 1DCEA 2JQDA 4R0AA 1M0ZA 4MN8B 3WPEA 4FDWA 4OQTA 4J4LA 3PMHG 4LSCA 2BEXA 2P1QB 4Z64C 1OTOA 3ULUA 2FT3A 1KOOA 3OGLB 4U08A 1Z7XW 1FS2A 3OJAB 4R58A 3WPFA 3C6OB 4R6GA 2WQVA 2O6RA 5GMHA 1G9UA 2O6QA 4XSQA 3RW7A 1DS9A 4NKHA 4RCAB 4LSXA 1O6TA 4ARNA 1K5GC 1SQ0B 2XWTC 4R09A 3WPIA 2Z63A 2XOTA 4Z61C 2R9UA 4J0MA 4R6AA 4P8SA 3CVRA 4V2DA 4M7EA 3C6PB 3REZA 1OOKG 2Z65A 4R07A 3ULVA 3DZEA 3M18A 3P72A 5B0TA 4NZRM 1KOHA 5A5CA 4RWTC 1U0ND 3RJ0A 1FQVA 5GMGA 4Q3IA 4XGOA 4CNCA 2OMVA 4UFRA 3W3NA 2ASTB 2WQUA 1K5DC 3ZYOA 4H09A 4QC0A 1H6UA 4EZGA 1DFJI 4PKIG 4BSRA 4LI1A 1ZIWA 3O6NA 3G04C 2Z64A 2WQWA 3WPHA 4I6JB 4QBZA 2UZXA 2V70A 5FTTB 4CILA 3WPDA 2CA6A 5HDHA 2Z7XA 4NZTM 2Z82A 5B0NA 4C2BB 2JE1A 1M9LA 5IJCA 5GS2B 3G3BA 2Z62A 3WPCA 3E6JA 1WWLA 2RR6A 4Z94G 4R5DA 5B4PA 3CIGA 4TZHA 3SB4A 3ZYNA 1H6TA 4PERA 4QXEA 3BZ5A 3G06A 5IYXC 2P1MB 3TSRE 2OMZA 4U7LA 3UL7A 4FMZA 4AY9X 1LTXA 1OTMA 1O6VA 3OGKB 4Z8GA 4KXFB 3RGZA 3ZYJA 3OGMB 3UL8A 4R6JA 1JL5A 3ULAA 2RA8A 3G3AA 3RFEA 3C6NB 4R5CA 1XWDC 3VQ1A 5IJBA 3CIYA 3OJAA 4MQWX 1A9NA 3E2JA 4ECOA 2WFHA 3VQ2A 4Y61B 2OMYA 3G39A 4KNGA 3RIZA 4LXRA 2P1OB 3W3LA 4WYKA 4RCWA 1XEUA 5AWDA 4V2EA 1D0BA 2ID5A 5GS0A 4P91A 4CC4C 1P8TA 4U06A 4Z79A 4BV4R 4L3AA 4WP6A 5CMNA 4Q62A 1IO0A 2OMTA 5GQRK 4ECNA 4K17A 5AZ5A 3M19A 3UN9A 4B8CD 4LXSA 1M10B 1FO1A 4LI2A 1M9SA 3RFJA 3WN4A 2BNHA 1A4YA 1PGVA 4NKGA 4FCGA 1OZNA 2Q4GW 4HQ1A 4PSJA 3WPBA 2JE0A 3GOZA 4PQ8A 3W3MA 4GT6A
chains in the Genus database with same CATH topology
1QYYA 4U09A 3WPGA 3RFSA 2O6SA 2OMUA 1O6SA 3FXIA 3E4GA 4PEQB 1OTNA 4BSSA 5AWCA 4LSXC 1P9AG 3ZYIA 1FT8A 2A0ZA 3E3ZA 2ASSB 5HZLB 1XECA 5CMPA 2OMXA 4LSAA 3RGXA 2IFGA 4M7EC 4AW4A 2P1PB 2V9TB 4BSUA 4V2CA 4L3FA 4C2AB 4G8AA 4CNMA 2Z7XB 3A79B 2V9SA 2OMWA 3UL9A 2P1NB 3O53A 4IM6A 4CP6A 4ARRA 4GLPA 2Y5QA 4FS7A 1W8AA 4FHOA 3W3JA 5D3IA 3W3GA 4CC4A 2ELLA 1OGQA 1XCDA 5AWAA 4KT1A 1XKUA 4Q3GA 1GWBA 1YRGA 4XOSA 2Z66A 2UZYA 3KJ4A 3W3KA 4R6FA 5AWBA 2Z81A 4FD0A 5LFNA 2WQXA 3RW6A 1P8VA 3JB9j 4R08A 5GMFA 4YEBB 5IJDA 1DCEA 2JQDA 4R0AA 1M0ZA 4MN8B 3WPEA 4FDWA 4OQTA 4J4LA 3PMHG 4LSCA 2BEXA 2P1QB 4Z64C 1OTOA 3ULUA 2FT3A 1KOOA 3OGLB 4U08A 1Z7XW 1FS2A 3OJAB 4R58A 3WPFA 3C6OB 4R6GA 2WQVA 2O6RA 5GMHA 1G9UA 2O6QA 4XSQA 3RW7A 1DS9A 4NKHA 4RCAB 4LSXA 1O6TA 4ARNA 1K5GC 1SQ0B 2XWTC 4R09A 3WPIA 2Z63A 2XOTA 4Z61C 2R9UA 4J0MA 4R6AA 4P8SA 3CVRA 4V2DA 4M7EA 3C6PB 3REZA 1OOKG 2Z65A 4R07A 3ULVA 3DZEA 3M18A 3P72A 5B0TA 1KOHA 5A5CA 4RWTC 1U0ND 3RJ0A 1FQVA 5GMGA 4Q3IA 4XGOA 4CNCA 2OMVA 4UFRA 3W3NA 2ASTB 2WQUA 1K5DC 3ZYOA 4H09A 4QC0A 1H6UA 4EZGA 1DFJI 4PKIG 4BSRA 4LI1A 1ZIWA 3O6NA 3G04C 2Z64A 2WQWA 3WPHA 4I6JB 4QBZA 2UZXA 2V70A 5FTTB 4CILA 3WPDA 2CA6A 5HDHA 2Z7XA 2Z82A 5B0NA 4C2BB 2JE1A 1M9LA 5IJCA 5GS2B 3G3BA 2Z62A 3WPCA 3E6JA 1WWLA 2RR6A 4Z94G 4R5DA 5B4PA 3CIGA 4TZHA 3SB4A 3ZYNA 1H6TA 4PERA 4QXEA 3BZ5A 3G06A 5IYXC 2P1MB 3TSRE 2OMZA 4U7LA 3UL7A 4FMZA 4AY9X 1LTXA 1OTMA 1O6VA 3OGKB 4Z8GA 4KXFB 3RGZA 3ZYJA 3OGMB 3UL8A 4R6JA 1JL5A 3ULAA 2RA8A 3G3AA 3RFEA 3C6NB 4R5CA 1XWDC 3VQ1A 5IJBA 3CIYA 3OJAA 4MQWX 1A9NA 3E2JA 4ECOA 2WFHA 3VQ2A 4Y61B 2OMYA 3G39A 4KNGA 3RIZA 4LXRA 2P1OB 3W3LA 4WYKA 4RCWA 1XEUA 5AWDA 4V2EA 1D0BA 2ID5A 5GS0A 4P91A 4CC4C 1P8TA 4U06A 4Z79A 4BV4R 4L3AA 4WP6A 5CMNA 4Q62A 1IO0A 2OMTA 5GQRK 4ECNA 4K17A 5AZ5A 3M19A 3UN9A 4B8CD 4LXSA 1M10B 1FO1A 4LI2A 1M9SA 3RFJA 3WN4A 2BNHA 1A4YA 1PGVA 4NKGA 4FCGA 1OZNA 2Q4GW 4HQ1A 4PSJA 3WPBA 2JE0A 3GOZA 4PQ8A 3W3MA 4GT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYY A;  4U09 A;  3WPG A;  3RFS A;  2O6S A;  2OMU A;  1O6S A;  3FXI A;  3E4G A;  4PEQ B;  1OTN A;  4BSS A;  5AWC A;  4LSX C;  1P9A G;  3ZYI A;  1FT8 A;  2A0Z A;  3E3Z A;  2ASS B;  5HZL B;  1XEC A;  5CMP A;  2OMX A;  4LSA A;  3RGX A;  2IFG A;  4M7E C;  4AW4 A;  2P1P B;  2V9T B;  4BSU A;  4V2C A;  4L3F A;  4C2A B;  4G8A A;  4CNM A;  2Z7X B;  3A79 B;  2V9S A;  2OMW A;  3UL9 A;  2P1N B;  3O53 A;  4IM6 A;  4CP6 A;  4ARR A;  4GLP A;  2Y5Q A;  4FS7 A;  1W8A A;  4FHO A;  3W3J A;  5D3I A;  3W3G A;  4CC4 A;  2ELL A;  1OGQ A;  1XCD A;  5AWA A;  4KT1 A;  1XKU A;  4Q3G A;  1GWB A;  1YRG A;  4XOS A;  2Z66 A;  2UZY A;  3KJ4 A;  3W3K A;  4R6F A;  5AWB A;  2Z81 A;  4FD0 A;  5LFN A;  2WQX A;  3RW6 A;  1P8V A;  3JB9 j;  4R08 A;  5GMF A;  4YEB B;  5IJD A;  1DCE A;  2JQD A;  4R0A A;  1M0Z A;  4MN8 B;  3WPE A;  4FDW A;  4OQT A;  4J4L A;  3PMH G;  4LSC A;  2BEX A;  2P1Q B;  4Z64 C;  1OTO A;  3ULU A;  2FT3 A;  1KOO A;  3OGL B;  4U08 A;  1Z7X W;  1FS2 A;  3OJA B;  4R58 A;  3WPF A;  3C6O B;  4R6G A;  2WQV A;  2O6R A;  5GMH A;  1G9U A;  2O6Q A;  4XSQ A;  3RW7 A;  1DS9 A;  4NKH A;  4RCA B;  4LSX A;  1O6T A;  4ARN A;  1K5G C;  1SQ0 B;  2XWT C;  4R09 A;  3WPI A;  2Z63 A;  2XOT A;  4Z61 C;  2R9U A;  4J0M A;  4R6A A;  4P8S A;  3CVR A;  4V2D A;  4M7E A;  3C6P B;  3REZ A;  1OOK G;  2Z65 A;  4R07 A;  3ULV A;  3DZE A;  3M18 A;  3P72 A;  5B0T A;  1KOH A;  5A5C A;  4RWT C;  1U0N D;  3RJ0 A;  1FQV A;  5GMG A;  4Q3I A;  4XGO A;  4CNC A;  2OMV A;  4UFR A;  3W3N A;  2AST B;  2WQU A;  1K5D C;  3ZYO A;  4H09 A;  4QC0 A;  1H6U A;  4EZG A;  1DFJ I;  4PKI G;  4BSR A;  4LI1 A;  1ZIW A;  3O6N A;  3G04 C;  2Z64 A;  2WQW A;  3WPH A;  4I6J B;  4QBZ A;  2UZX A;  2V70 A;  5FTT B;  4CIL A;  3WPD A;  2CA6 A;  5HDH A;  2Z7X A;  2Z82 A;  5B0N A;  4C2B B;  2JE1 A;  1M9L A;  5IJC A;  5GS2 B;  3G3B A;  2Z62 A;  3WPC A;  3E6J A;  1WWL A;  2RR6 A;  4Z94 G;  4R5D A;  5B4P A;  3CIG A;  4TZH A;  3SB4 A;  3ZYN A;  1H6T A;  4PER A;  4QXE A;  3BZ5 A;  3G06 A;  5IYX C;  2P1M B;  3TSR E;  2OMZ A;  4U7L A;  3UL7 A;  4FMZ A;  4AY9 X;  1LTX A;  1OTM A;  1O6V A;  3OGK B;  4Z8G A;  4KXF B;  3RGZ A;  3ZYJ A;  3OGM B;  3UL8 A;  4R6J A;  1JL5 A;  3ULA A;  2RA8 A;  3G3A A;  3RFE A;  3C6N B;  4R5C A;  1XWD C;  3VQ1 A;  5IJB A;  3CIY A;  3OJA A;  4MQW X;  1A9N A;  3E2J A;  4ECO A;  2WFH A;  3VQ2 A;  4Y61 B;  2OMY A;  3G39 A;  4KNG A;  3RIZ A;  4LXR A;  2P1O B;  3W3L A;  4WYK A;  4RCW A;  1XEU A;  5AWD A;  4V2E A;  1D0B A;  2ID5 A;  5GS0 A;  4P91 A;  4CC4 C;  1P8T A;  4U06 A;  4Z79 A;  4BV4 R;  4L3A A;  4WP6 A;  5CMN A;  4Q62 A;  1IO0 A;  2OMT A;  5GQR K;  4ECN A;  4K17 A;  5AZ5 A;  3M19 A;  3UN9 A;  4B8C D;  4LXS A;  1M10 B;  1FO1 A;  4LI2 A;  1M9S A;  3RFJ A;  3WN4 A;  2BNH A;  1A4Y A;  1PGV A;  4NKG A;  4FCG A;  1OZN A;  2Q4G W;  4HQ1 A;  4PSJ A;  3WPB A;  2JE0 A;  3GOZ A;  4PQ8 A;  3W3M A;  4GT6 A; 
#chains in the Genus database with same CATH topology
 1QYY A;  4U09 A;  3WPG A;  3RFS A;  2O6S A;  2OMU A;  1O6S A;  3FXI A;  3E4G A;  4PEQ B;  1OTN A;  4BSS A;  5AWC A;  4LSX C;  1P9A G;  3ZYI A;  1FT8 A;  2A0Z A;  3E3Z A;  2ASS B;  5HZL B;  1XEC A;  5CMP A;  2OMX A;  4LSA A;  3RGX A;  2IFG A;  4M7E C;  4AW4 A;  2P1P B;  2V9T B;  4BSU A;  4V2C A;  4L3F A;  4C2A B;  4G8A A;  4CNM A;  2Z7X B;  3A79 B;  2V9S A;  2OMW A;  3UL9 A;  2P1N B;  3O53 A;  4IM6 A;  4CP6 A;  4ARR A;  4GLP A;  2Y5Q A;  4FS7 A;  1W8A A;  4FHO A;  3W3J A;  5D3I A;  3W3G A;  4CC4 A;  2ELL A;  1OGQ A;  1XCD A;  5AWA A;  4KT1 A;  1XKU A;  4Q3G A;  1GWB A;  1YRG A;  4XOS A;  2Z66 A;  2UZY A;  3KJ4 A;  3W3K A;  4R6F A;  5AWB A;  2Z81 A;  4FD0 A;  5LFN A;  2WQX A;  3RW6 A;  1P8V A;  3JB9 j;  4R08 A;  5GMF A;  4YEB B;  5IJD A;  1DCE A;  2JQD A;  4R0A A;  1M0Z A;  4MN8 B;  3WPE A;  4FDW A;  4OQT A;  4J4L A;  3PMH G;  4LSC A;  2BEX A;  2P1Q B;  4Z64 C;  1OTO A;  3ULU A;  2FT3 A;  1KOO A;  3OGL B;  4U08 A;  1Z7X W;  1FS2 A;  3OJA B;  4R58 A;  3WPF A;  3C6O B;  4R6G A;  2WQV A;  2O6R A;  5GMH A;  1G9U A;  2O6Q A;  4XSQ A;  3RW7 A;  1DS9 A;  4NKH A;  4RCA B;  4LSX A;  1O6T A;  4ARN A;  1K5G C;  1SQ0 B;  2XWT C;  4R09 A;  3WPI A;  2Z63 A;  2XOT A;  4Z61 C;  2R9U A;  4J0M A;  4R6A A;  4P8S A;  3CVR A;  4V2D A;  4M7E A;  3C6P B;  3REZ A;  1OOK G;  2Z65 A;  4R07 A;  3ULV A;  3DZE A;  3M18 A;  3P72 A;  5B0T A;  4NZR M;  1KOH A;  5A5C A;  4RWT C;  1U0N D;  3RJ0 A;  1FQV A;  5GMG A;  4Q3I A;  4XGO A;  4CNC A;  2OMV A;  4UFR A;  3W3N A;  2AST B;  2WQU A;  1K5D C;  3ZYO A;  4H09 A;  4QC0 A;  1H6U A;  4EZG A;  1DFJ I;  4PKI G;  4BSR A;  4LI1 A;  1ZIW A;  3O6N A;  3G04 C;  2Z64 A;  2WQW A;  3WPH A;  4I6J B;  4QBZ A;  2UZX A;  2V70 A;  5FTT B;  4CIL A;  3WPD A;  2CA6 A;  5HDH A;  2Z7X A;  4NZT M;  2Z82 A;  5B0N A;  4C2B B;  2JE1 A;  1M9L A;  5IJC A;  5GS2 B;  3G3B A;  2Z62 A;  3WPC A;  3E6J A;  1WWL A;  2RR6 A;  4Z94 G;  4R5D A;  5B4P A;  3CIG A;  4TZH A;  3SB4 A;  3ZYN A;  1H6T A;  4PER A;  4QXE A;  3BZ5 A;  3G06 A;  5IYX C;  2P1M B;  3TSR E;  2OMZ A;  4U7L A;  3UL7 A;  4FMZ A;  4AY9 X;  1LTX A;  1OTM A;  1O6V A;  3OGK B;  4Z8G A;  4KXF B;  3RGZ A;  3ZYJ A;  3OGM B;  3UL8 A;  4R6J A;  1JL5 A;  3ULA A;  2RA8 A;  3G3A A;  3RFE A;  3C6N B;  4R5C A;  1XWD C;  3VQ1 A;  5IJB A;  3CIY A;  3OJA A;  4MQW X;  1A9N A;  3E2J A;  4ECO A;  2WFH A;  3VQ2 A;  4Y61 B;  2OMY A;  3G39 A;  4KNG A;  3RIZ A;  4LXR A;  2P1O B;  3W3L A;  4WYK A;  4RCW A;  1XEU A;  5AWD A;  4V2E A;  1D0B A;  2ID5 A;  5GS0 A;  4P91 A;  4CC4 C;  1P8T A;  4U06 A;  4Z79 A;  4BV4 R;  4L3A A;  4WP6 A;  5CMN A;  4Q62 A;  1IO0 A;  2OMT A;  5GQR K;  4ECN A;  4K17 A;  5AZ5 A;  3M19 A;  3UN9 A;  4B8C D;  4LXS A;  1M10 B;  1FO1 A;  4LI2 A;  1M9S A;  3RFJ A;  3WN4 A;  2BNH A;  1A4Y A;  1PGV A;  4NKG A;  4FCG A;  1OZN A;  2Q4G W;  4HQ1 A;  4PSJ A;  3WPB A;  2JE0 A;  3GOZ A;  4PQ8 A;  3W3M A;  4GT6 A; 
#chains in the Genus database with same CATH homology
 1QYY A;  4U09 A;  3WPG A;  3RFS A;  2O6S A;  2OMU A;  1O6S A;  3FXI A;  3E4G A;  4PEQ B;  1OTN A;  4BSS A;  5AWC A;  4LSX C;  1P9A G;  3ZYI A;  1FT8 A;  2A0Z A;  3E3Z A;  2ASS B;  5HZL B;  1XEC A;  5CMP A;  2OMX A;  4LSA A;  3RGX A;  2IFG A;  4M7E C;  4AW4 A;  2P1P B;  2V9T B;  4BSU A;  4V2C A;  4L3F A;  4C2A B;  4G8A A;  4CNM A;  2Z7X B;  3A79 B;  2V9S A;  2OMW A;  3UL9 A;  2P1N B;  3O53 A;  4IM6 A;  4CP6 A;  4ARR A;  4GLP A;  2Y5Q A;  4FS7 A;  1W8A A;  4FHO A;  3W3J A;  5D3I A;  3W3G A;  4CC4 A;  2ELL A;  1OGQ A;  1XCD A;  5AWA A;  4KT1 A;  1XKU A;  4Q3G A;  1GWB A;  1YRG A;  4XOS A;  2Z66 A;  2UZY A;  3KJ4 A;  3W3K A;  4R6F A;  5AWB A;  2Z81 A;  4FD0 A;  5LFN A;  2WQX A;  3RW6 A;  1P8V A;  3JB9 j;  4R08 A;  5GMF A;  4YEB B;  5IJD A;  1DCE A;  2JQD A;  4R0A A;  1M0Z A;  4MN8 B;  3WPE A;  4FDW A;  4OQT A;  4J4L A;  3PMH G;  4LSC A;  2BEX A;  2P1Q B;  4Z64 C;  1OTO A;  3ULU A;  2FT3 A;  1KOO A;  3OGL B;  4U08 A;  1Z7X W;  1FS2 A;  3OJA B;  4R58 A;  3WPF A;  3C6O B;  4R6G A;  2WQV A;  2O6R A;  5GMH A;  1G9U A;  2O6Q A;  4XSQ A;  3RW7 A;  1DS9 A;  4NKH A;  4RCA B;  4LSX A;  1O6T A;  4ARN A;  1K5G C;  1SQ0 B;  2XWT C;  4R09 A;  3WPI A;  2Z63 A;  2XOT A;  4Z61 C;  2R9U A;  4J0M A;  4R6A A;  4P8S A;  3CVR A;  4V2D A;  4M7E A;  3C6P B;  3REZ A;  1OOK G;  2Z65 A;  4R07 A;  3ULV A;  3DZE A;  3M18 A;  3P72 A;  5B0T A;  1KOH A;  5A5C A;  4RWT C;  1U0N D;  3RJ0 A;  1FQV A;  5GMG A;  4Q3I A;  4XGO A;  4CNC A;  2OMV A;  4UFR A;  3W3N A;  2AST B;  2WQU A;  1K5D C;  3ZYO A;  4H09 A;  4QC0 A;  1H6U A;  4EZG A;  1DFJ I;  4PKI G;  4BSR A;  4LI1 A;  1ZIW A;  3O6N A;  3G04 C;  2Z64 A;  2WQW A;  3WPH A;  4I6J B;  4QBZ A;  2UZX A;  2V70 A;  5FTT B;  4CIL A;  3WPD A;  2CA6 A;  5HDH A;  2Z7X A;  2Z82 A;  5B0N A;  4C2B B;  2JE1 A;  1M9L A;  5IJC A;  5GS2 B;  3G3B A;  2Z62 A;  3WPC A;  3E6J A;  1WWL A;  2RR6 A;  4Z94 G;  4R5D A;  5B4P A;  3CIG A;  4TZH A;  3SB4 A;  3ZYN A;  1H6T A;  4PER A;  4QXE A;  3BZ5 A;  3G06 A;  5IYX C;  2P1M B;  3TSR E;  2OMZ A;  4U7L A;  3UL7 A;  4FMZ A;  4AY9 X;  1LTX A;  1OTM A;  1O6V A;  3OGK B;  4Z8G A;  4KXF B;  3RGZ A;  3ZYJ A;  3OGM B;  3UL8 A;  4R6J A;  1JL5 A;  3ULA A;  2RA8 A;  3G3A A;  3RFE A;  3C6N B;  4R5C A;  1XWD C;  3VQ1 A;  5IJB A;  3CIY A;  3OJA A;  4MQW X;  1A9N A;  3E2J A;  4ECO A;  2WFH A;  3VQ2 A;  4Y61 B;  2OMY A;  3G39 A;  4KNG A;  3RIZ A;  4LXR A;  2P1O B;  3W3L A;  4WYK A;  4RCW A;  1XEU A;  5AWD A;  4V2E A;  1D0B A;  2ID5 A;  5GS0 A;  4P91 A;  4CC4 C;  1P8T A;  4U06 A;  4Z79 A;  4BV4 R;  4L3A A;  4WP6 A;  5CMN A;  4Q62 A;  1IO0 A;  2OMT A;  5GQR K;  4ECN A;  4K17 A;  5AZ5 A;  3M19 A;  3UN9 A;  4B8C D;  4LXS A;  1M10 B;  1FO1 A;  4LI2 A;  1M9S A;  3RFJ A;  3WN4 A;  2BNH A;  1A4Y A;  1PGV A;  4NKG A;  4FCG A;  1OZN A;  2Q4G W;  4HQ1 A;  4PSJ A;  3WPB A;  2JE0 A;  3GOZ A;  4PQ8 A;  3W3M A;  4GT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...