2ASSB

Crystal structure of the skp1-skp2-cks1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
325
structure length
325
Chain Sequence
VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/ligase/protein turnover
molecule keywords S-phase kinase-associated protein 1A
total genus 112
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2assB00
2WQWA 2Z7XB 2R9UA 4PERA 4V2EA 3ULVA 1XWDC 4ARRA 3RIZA 4LI1A 2Z82A 2O6QA 2JE1A 4R08A 4U7LA 3W3GA 2OMXA 3VQ1A 3WPBA 3E3ZA 3G04C 4R07A 4J4LA 2Z81A 4UFRA 1DS9A 1M10B 1XCDA 5HZLB 4Q3GA 1YRGA 1M0ZA 1IO0A 2P1PB 1FQVA 3BZ5A 4FHOA 4FCGA 1Z7XW 4PQ8A 3UL9A 3WPHA 3W3MA 3OGLB 3UL7A 2WQUA 3O53A 3REZA 3WN4A 3P72A 5FTTB 3W3JA 4C2BB 1OTMA 1O6SA 4LSXA 5IJCA 5LFNA 2Z65A 4Z94G 3M19A 1OGQA 1A4YA 2ASTB 3A79B 3M18A 4Q62A 4FD0A 3RJ0A 2OMUA 1XECA 4XSQA 5AWDA 1W8AA 2WFHA 4R6FA 2WQVA 3OJAB 4KT1A 1P9AG 2O6RA 3WPFA 2V70A 4Y61B 1WWLA 4FS7A 4G8AA 4V2CA 3E4GA 1U0ND 4CNCA 3ULUA 1P8VA 2Z63A 3W3NA 4CILA 3WPCA 3WPGA 2UZXA 4LI2A 1K5DC 2OMVA 4ECOA 5HDHA 3PMHG 3VQ2A 4R6JA 4KXFB 4BSSA 2ELLA 2P1NB 2CA6A 1OZNA 4GLPA 4L3FA 4YEBB 4LXRA 5AWCA 3W3KA 4U09A 3ULAA 1FT8A 1G9UA 4ARNA 4ECNA 4R58A 4WYKA 1QYYA 4RCWA 5AWBA 5CMPA 5GS2B 2RR6A 3CVRA 4XGOA 4M7EC 5D3IA 3WPIA 3KJ4A 3ZYOA 4Z8GA 2O6SA 5B4PA 4FMZA 2BEXA 4V2DA 3RW6A 2OMWA 5B0TA 2V9SA 5GMFA 4BV4R 2FT3A 3OGKB 4CC4C 1LTXA 5GMHA 1O6TA 2ASSB 4BSUA 1XEUA 1PGVA 2P1MB 4IM6A 2Z64A 4OQTA 4CC4A 4Z64C 4Z79A 4MN8B 2BNHA 4C2AB 3RGXA 4QBZA 3G39A 2Q4GW 1SQ0B 5CMNA 1M9LA 3WPDA 3G06A 2UZYA 3JB9j 4BSRA 4QC0A 4L3AA 2OMYA 5IJDA 4LSAA 3DZEA 3GOZA 3W3LA 3FXIA 5IYXC 4R5DA 4R6GA 5B0NA 3SB4A 3CIYA 2Z62A 4M7EA 5IJBA 1M9SA 3ZYJA 1DCEA 1OTNA 4HQ1A 4LSCA 3TSRE 4AW4A 2Y5QA 1FO1A 2Z66A 2P1OB 4PEQB 5AZ5A 2XWTC 3RGZA 4NKGA 2V9TB 3C6PB 1XKUA 4U06A 4RWTC 5GQRK 2JQDA 1GWBA 1OOKG 4P8SA 4GT6A 4LXSA 4PSJA 2WQXA 4TZHA 1OTOA 3RFSA 3UN9A 4RCAB 4XOSA 4R6AA 4Z61C 4QXEA 5A5CA 1H6UA 4R09A 3CIGA 2Z7XA 4AY9X 2IFGA 3ZYNA 2OMTA 4FDWA 1ZIWA 3C6NB 3OGMB 4PKIG 4P91A 4J0MA 5GS0A 3E6JA 3RFJA 3UL8A 4KNGA 4K17A 3G3BA 4CNMA 1KOOA 1JL5A 2JE0A 1FS2A 2OMZA 2P1QB 3WPEA 2A0ZA 3RW7A 4WP6A 2RA8A 2XOTA 1H6TA 1D0BA 3C6OB 1KOHA 3OJAA 4NKHA 5GMGA 3ZYIA 4LSXC 4Q3IA 5AWAA 1A9NA 4U08A 4B8CD 1P8TA 3E2JA 3O6NA 4I6JB 1K5GC 4MQWX 4R5CA 3RFEA 4EZGA 4R0AA 3G3AA 2ID5A 4CP6A 1DFJI 1O6VA 4H09A
chains in the Genus database with same CATH superfamily
2WQWA 2Z7XB 2R9UA 4PERA 4V2EA 3ULVA 1XWDC 4ARRA 3RIZA 4LI1A 2Z82A 2O6QA 2JE1A 4R08A 4U7LA 3W3GA 2OMXA 3VQ1A 3WPBA 3E3ZA 3G04C 4R07A 4J4LA 2Z81A 4UFRA 1DS9A 1M10B 1XCDA 5HZLB 4Q3GA 1YRGA 1M0ZA 1IO0A 2P1PB 1FQVA 3BZ5A 4FHOA 4FCGA 1Z7XW 4PQ8A 3UL9A 3WPHA 3W3MA 3OGLB 3UL7A 2WQUA 3O53A 3REZA 3WN4A 3P72A 5FTTB 3W3JA 4C2BB 1OTMA 1O6SA 4LSXA 5IJCA 5LFNA 2Z65A 4Z94G 3M19A 1OGQA 1A4YA 2ASTB 3A79B 3M18A 4Q62A 4FD0A 3RJ0A 2OMUA 1XECA 4XSQA 5AWDA 1W8AA 2WFHA 4NZTM 4R6FA 2WQVA 3OJAB 4KT1A 1P9AG 2O6RA 3WPFA 2V70A 4Y61B 1WWLA 4FS7A 4G8AA 4V2CA 3E4GA 1U0ND 4CNCA 3ULUA 1P8VA 2Z63A 3W3NA 4CILA 3WPCA 3WPGA 2UZXA 4LI2A 1K5DC 2OMVA 4ECOA 5HDHA 3PMHG 3VQ2A 4R6JA 4KXFB 4BSSA 2ELLA 2P1NB 2CA6A 1OZNA 4GLPA 4L3FA 4YEBB 4LXRA 5AWCA 3W3KA 4U09A 3ULAA 1FT8A 1G9UA 4ARNA 4ECNA 4R58A 4WYKA 1QYYA 4RCWA 5AWBA 5CMPA 5GS2B 2RR6A 3CVRA 4XGOA 4M7EC 5D3IA 3WPIA 3KJ4A 3ZYOA 4Z8GA 2O6SA 5B4PA 4FMZA 2BEXA 4V2DA 3RW6A 2OMWA 5B0TA 2V9SA 5GMFA 4BV4R 2FT3A 3OGKB 4CC4C 1LTXA 5GMHA 1O6TA 2ASSB 4BSUA 1XEUA 1PGVA 2P1MB 4IM6A 2Z64A 4OQTA 4CC4A 4Z64C 4Z79A 4MN8B 2BNHA 4C2AB 3RGXA 4QBZA 3G39A 2Q4GW 1SQ0B 5CMNA 1M9LA 3WPDA 3G06A 2UZYA 3JB9j 4BSRA 4QC0A 4L3AA 2OMYA 5IJDA 4LSAA 3DZEA 3GOZA 3W3LA 3FXIA 5IYXC 4R5DA 4R6GA 5B0NA 3SB4A 3CIYA 2Z62A 4M7EA 5IJBA 1M9SA 3ZYJA 1DCEA 1OTNA 4HQ1A 4LSCA 3TSRE 4AW4A 2Y5QA 1FO1A 2Z66A 2P1OB 4PEQB 5AZ5A 2XWTC 3RGZA 4NKGA 2V9TB 3C6PB 1XKUA 4U06A 4RWTC 5GQRK 2JQDA 1GWBA 1OOKG 4P8SA 4GT6A 4LXSA 4PSJA 2WQXA 4TZHA 1OTOA 3RFSA 3UN9A 4RCAB 4XOSA 4R6AA 4Z61C 4QXEA 5A5CA 1H6UA 4R09A 3CIGA 2Z7XA 4AY9X 2IFGA 3ZYNA 2OMTA 4FDWA 1ZIWA 3C6NB 3OGMB 4PKIG 4P91A 4J0MA 5GS0A 3E6JA 3RFJA 3UL8A 4KNGA 4K17A 3G3BA 4CNMA 1KOOA 1JL5A 2JE0A 1FS2A 2OMZA 2P1QB 3WPEA 2A0ZA 3RW7A 4WP6A 2RA8A 2XOTA 1H6TA 1D0BA 3C6OB 1KOHA 3OJAA 4NKHA 5GMGA 3ZYIA 4LSXC 4Q3IA 4NZRM 5AWAA 1A9NA 4U08A 4B8CD 1P8TA 3E2JA 3O6NA 4I6JB 1K5GC 4MQWX 4R5CA 3RFEA 4EZGA 4R0AA 3G3AA 2ID5A 4CP6A 1DFJI 1O6VA 4H09A
chains in the Genus database with same CATH topology
2WQWA 2Z7XB 2R9UA 4PERA 4V2EA 3ULVA 1XWDC 4ARRA 3RIZA 4LI1A 2Z82A 2O6QA 2JE1A 4R08A 4U7LA 3W3GA 2OMXA 3VQ1A 3WPBA 3E3ZA 3G04C 4R07A 4J4LA 2Z81A 4UFRA 1DS9A 1M10B 1XCDA 5HZLB 4Q3GA 1YRGA 1M0ZA 1IO0A 2P1PB 1FQVA 3BZ5A 4FHOA 4FCGA 1Z7XW 4PQ8A 3UL9A 3WPHA 3W3MA 3OGLB 3UL7A 2WQUA 3O53A 3REZA 3WN4A 3P72A 5FTTB 3W3JA 4C2BB 1OTMA 1O6SA 4LSXA 5IJCA 5LFNA 2Z65A 4Z94G 3M19A 1OGQA 1A4YA 2ASTB 3A79B 3M18A 4Q62A 4FD0A 3RJ0A 2OMUA 1XECA 4XSQA 5AWDA 1W8AA 2WFHA 4R6FA 2WQVA 3OJAB 4KT1A 1P9AG 2O6RA 3WPFA 2V70A 4Y61B 1WWLA 4FS7A 4G8AA 4V2CA 3E4GA 1U0ND 4CNCA 3ULUA 1P8VA 2Z63A 3W3NA 4CILA 3WPCA 3WPGA 2UZXA 4LI2A 1K5DC 2OMVA 4ECOA 5HDHA 3PMHG 3VQ2A 4R6JA 4KXFB 4BSSA 2ELLA 2P1NB 2CA6A 1OZNA 4GLPA 4L3FA 4YEBB 4LXRA 5AWCA 3W3KA 4U09A 3ULAA 1FT8A 1G9UA 4ARNA 4ECNA 4R58A 4WYKA 1QYYA 4RCWA 5AWBA 5CMPA 5GS2B 2RR6A 3CVRA 4XGOA 4M7EC 5D3IA 3WPIA 3KJ4A 3ZYOA 4Z8GA 2O6SA 5B4PA 4FMZA 2BEXA 4V2DA 3RW6A 2OMWA 5B0TA 2V9SA 5GMFA 4BV4R 2FT3A 3OGKB 4CC4C 1LTXA 5GMHA 1O6TA 2ASSB 4BSUA 1XEUA 1PGVA 2P1MB 4IM6A 2Z64A 4OQTA 4CC4A 4Z64C 4Z79A 4MN8B 2BNHA 4C2AB 3RGXA 4QBZA 3G39A 2Q4GW 1SQ0B 5CMNA 1M9LA 3WPDA 3G06A 2UZYA 3JB9j 4BSRA 4QC0A 4L3AA 2OMYA 5IJDA 4LSAA 3DZEA 3GOZA 3W3LA 3FXIA 5IYXC 4R5DA 4R6GA 5B0NA 3SB4A 3CIYA 2Z62A 4M7EA 5IJBA 1M9SA 3ZYJA 1DCEA 1OTNA 4HQ1A 4LSCA 3TSRE 4AW4A 2Y5QA 1FO1A 2Z66A 2P1OB 4PEQB 5AZ5A 2XWTC 3RGZA 4NKGA 2V9TB 3C6PB 1XKUA 4U06A 4RWTC 5GQRK 2JQDA 1GWBA 1OOKG 4P8SA 4GT6A 4LXSA 4PSJA 2WQXA 4TZHA 1OTOA 3RFSA 3UN9A 4RCAB 4XOSA 4R6AA 4Z61C 4QXEA 5A5CA 1H6UA 4R09A 3CIGA 2Z7XA 4AY9X 2IFGA 3ZYNA 2OMTA 4FDWA 1ZIWA 3C6NB 3OGMB 4PKIG 4P91A 4J0MA 5GS0A 3E6JA 3RFJA 3UL8A 4KNGA 4K17A 3G3BA 4CNMA 1KOOA 1JL5A 2JE0A 1FS2A 2OMZA 2P1QB 3WPEA 2A0ZA 3RW7A 4WP6A 2RA8A 2XOTA 1H6TA 1D0BA 3C6OB 1KOHA 3OJAA 4NKHA 5GMGA 3ZYIA 4LSXC 4Q3IA 5AWAA 1A9NA 4U08A 4B8CD 1P8TA 3E2JA 3O6NA 4I6JB 1K5GC 4MQWX 4R5CA 3RFEA 4EZGA 4R0AA 3G3AA 2ID5A 4CP6A 1DFJI 1O6VA 4H09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQW A;  2Z7X B;  2R9U A;  4PER A;  4V2E A;  3ULV A;  1XWD C;  4ARR A;  3RIZ A;  4LI1 A;  2Z82 A;  2O6Q A;  2JE1 A;  4R08 A;  4U7L A;  3W3G A;  2OMX A;  3VQ1 A;  3WPB A;  3E3Z A;  3G04 C;  4R07 A;  4J4L A;  2Z81 A;  4UFR A;  1DS9 A;  1M10 B;  1XCD A;  5HZL B;  4Q3G A;  1YRG A;  1M0Z A;  1IO0 A;  2P1P B;  1FQV A;  3BZ5 A;  4FHO A;  4FCG A;  1Z7X W;  4PQ8 A;  3UL9 A;  3WPH A;  3W3M A;  3OGL B;  3UL7 A;  2WQU A;  3O53 A;  3REZ A;  3WN4 A;  3P72 A;  5FTT B;  3W3J A;  4C2B B;  1OTM A;  1O6S A;  4LSX A;  5IJC A;  5LFN A;  2Z65 A;  4Z94 G;  3M19 A;  1OGQ A;  1A4Y A;  2AST B;  3A79 B;  3M18 A;  4Q62 A;  4FD0 A;  3RJ0 A;  2OMU A;  1XEC A;  4XSQ A;  5AWD A;  1W8A A;  2WFH A;  4R6F A;  2WQV A;  3OJA B;  4KT1 A;  1P9A G;  2O6R A;  3WPF A;  2V70 A;  4Y61 B;  1WWL A;  4FS7 A;  4G8A A;  4V2C A;  3E4G A;  1U0N D;  4CNC A;  3ULU A;  1P8V A;  2Z63 A;  3W3N A;  4CIL A;  3WPC A;  3WPG A;  2UZX A;  4LI2 A;  1K5D C;  2OMV A;  4ECO A;  5HDH A;  3PMH G;  3VQ2 A;  4R6J A;  4KXF B;  4BSS A;  2ELL A;  2P1N B;  2CA6 A;  1OZN A;  4GLP A;  4L3F A;  4YEB B;  4LXR A;  5AWC A;  3W3K A;  4U09 A;  3ULA A;  1FT8 A;  1G9U A;  4ARN A;  4ECN A;  4R58 A;  4WYK A;  1QYY A;  4RCW A;  5AWB A;  5CMP A;  5GS2 B;  2RR6 A;  3CVR A;  4XGO A;  4M7E C;  5D3I A;  3WPI A;  3KJ4 A;  3ZYO A;  4Z8G A;  2O6S A;  5B4P A;  4FMZ A;  2BEX A;  4V2D A;  3RW6 A;  2OMW A;  5B0T A;  2V9S A;  5GMF A;  4BV4 R;  2FT3 A;  3OGK B;  4CC4 C;  1LTX A;  5GMH A;  1O6T A;  2ASS B;  4BSU A;  1XEU A;  1PGV A;  2P1M B;  4IM6 A;  2Z64 A;  4OQT A;  4CC4 A;  4Z64 C;  4Z79 A;  4MN8 B;  2BNH A;  4C2A B;  3RGX A;  4QBZ A;  3G39 A;  2Q4G W;  1SQ0 B;  5CMN A;  1M9L A;  3WPD A;  3G06 A;  2UZY A;  3JB9 j;  4BSR A;  4QC0 A;  4L3A A;  2OMY A;  5IJD A;  4LSA A;  3DZE A;  3GOZ A;  3W3L A;  3FXI A;  5IYX C;  4R5D A;  4R6G A;  5B0N A;  3SB4 A;  3CIY A;  2Z62 A;  4M7E A;  5IJB A;  1M9S A;  3ZYJ A;  1DCE A;  1OTN A;  4HQ1 A;  4LSC A;  3TSR E;  4AW4 A;  2Y5Q A;  1FO1 A;  2Z66 A;  2P1O B;  4PEQ B;  5AZ5 A;  2XWT C;  3RGZ A;  4NKG A;  2V9T B;  3C6P B;  1XKU A;  4U06 A;  4RWT C;  5GQR K;  2JQD A;  1GWB A;  1OOK G;  4P8S A;  4GT6 A;  4LXS A;  4PSJ A;  2WQX A;  4TZH A;  1OTO A;  3RFS A;  3UN9 A;  4RCA B;  4XOS A;  4R6A A;  4Z61 C;  4QXE A;  5A5C A;  1H6U A;  4R09 A;  3CIG A;  2Z7X A;  4AY9 X;  2IFG A;  3ZYN A;  2OMT A;  4FDW A;  1ZIW A;  3C6N B;  3OGM B;  4PKI G;  4P91 A;  4J0M A;  5GS0 A;  3E6J A;  3RFJ A;  3UL8 A;  4KNG A;  4K17 A;  3G3B A;  4CNM A;  1KOO A;  1JL5 A;  2JE0 A;  1FS2 A;  2OMZ A;  2P1Q B;  3WPE A;  2A0Z A;  3RW7 A;  4WP6 A;  2RA8 A;  2XOT A;  1H6T A;  1D0B A;  3C6O B;  1KOH A;  3OJA A;  4NKH A;  5GMG A;  3ZYI A;  4LSX C;  4Q3I A;  5AWA A;  1A9N A;  4U08 A;  4B8C D;  1P8T A;  3E2J A;  3O6N A;  4I6J B;  1K5G C;  4MQW X;  4R5C A;  3RFE A;  4EZG A;  4R0A A;  3G3A A;  2ID5 A;  4CP6 A;  1DFJ I;  1O6V A;  4H09 A; 
#chains in the Genus database with same CATH topology
 2WQW A;  2Z7X B;  2R9U A;  4PER A;  4V2E A;  3ULV A;  1XWD C;  4ARR A;  3RIZ A;  4LI1 A;  2Z82 A;  2O6Q A;  2JE1 A;  4R08 A;  4U7L A;  3W3G A;  2OMX A;  3VQ1 A;  3WPB A;  3E3Z A;  3G04 C;  4R07 A;  4J4L A;  2Z81 A;  4UFR A;  1DS9 A;  1M10 B;  1XCD A;  5HZL B;  4Q3G A;  1YRG A;  1M0Z A;  1IO0 A;  2P1P B;  1FQV A;  3BZ5 A;  4FHO A;  4FCG A;  1Z7X W;  4PQ8 A;  3UL9 A;  3WPH A;  3W3M A;  3OGL B;  3UL7 A;  2WQU A;  3O53 A;  3REZ A;  3WN4 A;  3P72 A;  5FTT B;  3W3J A;  4C2B B;  1OTM A;  1O6S A;  4LSX A;  5IJC A;  5LFN A;  2Z65 A;  4Z94 G;  3M19 A;  1OGQ A;  1A4Y A;  2AST B;  3A79 B;  3M18 A;  4Q62 A;  4FD0 A;  3RJ0 A;  2OMU A;  1XEC A;  4XSQ A;  5AWD A;  1W8A A;  2WFH A;  4NZT M;  4R6F A;  2WQV A;  3OJA B;  4KT1 A;  1P9A G;  2O6R A;  3WPF A;  2V70 A;  4Y61 B;  1WWL A;  4FS7 A;  4G8A A;  4V2C A;  3E4G A;  1U0N D;  4CNC A;  3ULU A;  1P8V A;  2Z63 A;  3W3N A;  4CIL A;  3WPC A;  3WPG A;  2UZX A;  4LI2 A;  1K5D C;  2OMV A;  4ECO A;  5HDH A;  3PMH G;  3VQ2 A;  4R6J A;  4KXF B;  4BSS A;  2ELL A;  2P1N B;  2CA6 A;  1OZN A;  4GLP A;  4L3F A;  4YEB B;  4LXR A;  5AWC A;  3W3K A;  4U09 A;  3ULA A;  1FT8 A;  1G9U A;  4ARN A;  4ECN A;  4R58 A;  4WYK A;  1QYY A;  4RCW A;  5AWB A;  5CMP A;  5GS2 B;  2RR6 A;  3CVR A;  4XGO A;  4M7E C;  5D3I A;  3WPI A;  3KJ4 A;  3ZYO A;  4Z8G A;  2O6S A;  5B4P A;  4FMZ A;  2BEX A;  4V2D A;  3RW6 A;  2OMW A;  5B0T A;  2V9S A;  5GMF A;  4BV4 R;  2FT3 A;  3OGK B;  4CC4 C;  1LTX A;  5GMH A;  1O6T A;  2ASS B;  4BSU A;  1XEU A;  1PGV A;  2P1M B;  4IM6 A;  2Z64 A;  4OQT A;  4CC4 A;  4Z64 C;  4Z79 A;  4MN8 B;  2BNH A;  4C2A B;  3RGX A;  4QBZ A;  3G39 A;  2Q4G W;  1SQ0 B;  5CMN A;  1M9L A;  3WPD A;  3G06 A;  2UZY A;  3JB9 j;  4BSR A;  4QC0 A;  4L3A A;  2OMY A;  5IJD A;  4LSA A;  3DZE A;  3GOZ A;  3W3L A;  3FXI A;  5IYX C;  4R5D A;  4R6G A;  5B0N A;  3SB4 A;  3CIY A;  2Z62 A;  4M7E A;  5IJB A;  1M9S A;  3ZYJ A;  1DCE A;  1OTN A;  4HQ1 A;  4LSC A;  3TSR E;  4AW4 A;  2Y5Q A;  1FO1 A;  2Z66 A;  2P1O B;  4PEQ B;  5AZ5 A;  2XWT C;  3RGZ A;  4NKG A;  2V9T B;  3C6P B;  1XKU A;  4U06 A;  4RWT C;  5GQR K;  2JQD A;  1GWB A;  1OOK G;  4P8S A;  4GT6 A;  4LXS A;  4PSJ A;  2WQX A;  4TZH A;  1OTO A;  3RFS A;  3UN9 A;  4RCA B;  4XOS A;  4R6A A;  4Z61 C;  4QXE A;  5A5C A;  1H6U A;  4R09 A;  3CIG A;  2Z7X A;  4AY9 X;  2IFG A;  3ZYN A;  2OMT A;  4FDW A;  1ZIW A;  3C6N B;  3OGM B;  4PKI G;  4P91 A;  4J0M A;  5GS0 A;  3E6J A;  3RFJ A;  3UL8 A;  4KNG A;  4K17 A;  3G3B A;  4CNM A;  1KOO A;  1JL5 A;  2JE0 A;  1FS2 A;  2OMZ A;  2P1Q B;  3WPE A;  2A0Z A;  3RW7 A;  4WP6 A;  2RA8 A;  2XOT A;  1H6T A;  1D0B A;  3C6O B;  1KOH A;  3OJA A;  4NKH A;  5GMG A;  3ZYI A;  4LSX C;  4Q3I A;  4NZR M;  5AWA A;  1A9N A;  4U08 A;  4B8C D;  1P8T A;  3E2J A;  3O6N A;  4I6J B;  1K5G C;  4MQW X;  4R5C A;  3RFE A;  4EZG A;  4R0A A;  3G3A A;  2ID5 A;  4CP6 A;  1DFJ I;  1O6V A;  4H09 A; 
#chains in the Genus database with same CATH homology
 2WQW A;  2Z7X B;  2R9U A;  4PER A;  4V2E A;  3ULV A;  1XWD C;  4ARR A;  3RIZ A;  4LI1 A;  2Z82 A;  2O6Q A;  2JE1 A;  4R08 A;  4U7L A;  3W3G A;  2OMX A;  3VQ1 A;  3WPB A;  3E3Z A;  3G04 C;  4R07 A;  4J4L A;  2Z81 A;  4UFR A;  1DS9 A;  1M10 B;  1XCD A;  5HZL B;  4Q3G A;  1YRG A;  1M0Z A;  1IO0 A;  2P1P B;  1FQV A;  3BZ5 A;  4FHO A;  4FCG A;  1Z7X W;  4PQ8 A;  3UL9 A;  3WPH A;  3W3M A;  3OGL B;  3UL7 A;  2WQU A;  3O53 A;  3REZ A;  3WN4 A;  3P72 A;  5FTT B;  3W3J A;  4C2B B;  1OTM A;  1O6S A;  4LSX A;  5IJC A;  5LFN A;  2Z65 A;  4Z94 G;  3M19 A;  1OGQ A;  1A4Y A;  2AST B;  3A79 B;  3M18 A;  4Q62 A;  4FD0 A;  3RJ0 A;  2OMU A;  1XEC A;  4XSQ A;  5AWD A;  1W8A A;  2WFH A;  4R6F A;  2WQV A;  3OJA B;  4KT1 A;  1P9A G;  2O6R A;  3WPF A;  2V70 A;  4Y61 B;  1WWL A;  4FS7 A;  4G8A A;  4V2C A;  3E4G A;  1U0N D;  4CNC A;  3ULU A;  1P8V A;  2Z63 A;  3W3N A;  4CIL A;  3WPC A;  3WPG A;  2UZX A;  4LI2 A;  1K5D C;  2OMV A;  4ECO A;  5HDH A;  3PMH G;  3VQ2 A;  4R6J A;  4KXF B;  4BSS A;  2ELL A;  2P1N B;  2CA6 A;  1OZN A;  4GLP A;  4L3F A;  4YEB B;  4LXR A;  5AWC A;  3W3K A;  4U09 A;  3ULA A;  1FT8 A;  1G9U A;  4ARN A;  4ECN A;  4R58 A;  4WYK A;  1QYY A;  4RCW A;  5AWB A;  5CMP A;  5GS2 B;  2RR6 A;  3CVR A;  4XGO A;  4M7E C;  5D3I A;  3WPI A;  3KJ4 A;  3ZYO A;  4Z8G A;  2O6S A;  5B4P A;  4FMZ A;  2BEX A;  4V2D A;  3RW6 A;  2OMW A;  5B0T A;  2V9S A;  5GMF A;  4BV4 R;  2FT3 A;  3OGK B;  4CC4 C;  1LTX A;  5GMH A;  1O6T A;  2ASS B;  4BSU A;  1XEU A;  1PGV A;  2P1M B;  4IM6 A;  2Z64 A;  4OQT A;  4CC4 A;  4Z64 C;  4Z79 A;  4MN8 B;  2BNH A;  4C2A B;  3RGX A;  4QBZ A;  3G39 A;  2Q4G W;  1SQ0 B;  5CMN A;  1M9L A;  3WPD A;  3G06 A;  2UZY A;  3JB9 j;  4BSR A;  4QC0 A;  4L3A A;  2OMY A;  5IJD A;  4LSA A;  3DZE A;  3GOZ A;  3W3L A;  3FXI A;  5IYX C;  4R5D A;  4R6G A;  5B0N A;  3SB4 A;  3CIY A;  2Z62 A;  4M7E A;  5IJB A;  1M9S A;  3ZYJ A;  1DCE A;  1OTN A;  4HQ1 A;  4LSC A;  3TSR E;  4AW4 A;  2Y5Q A;  1FO1 A;  2Z66 A;  2P1O B;  4PEQ B;  5AZ5 A;  2XWT C;  3RGZ A;  4NKG A;  2V9T B;  3C6P B;  1XKU A;  4U06 A;  4RWT C;  5GQR K;  2JQD A;  1GWB A;  1OOK G;  4P8S A;  4GT6 A;  4LXS A;  4PSJ A;  2WQX A;  4TZH A;  1OTO A;  3RFS A;  3UN9 A;  4RCA B;  4XOS A;  4R6A A;  4Z61 C;  4QXE A;  5A5C A;  1H6U A;  4R09 A;  3CIG A;  2Z7X A;  4AY9 X;  2IFG A;  3ZYN A;  2OMT A;  4FDW A;  1ZIW A;  3C6N B;  3OGM B;  4PKI G;  4P91 A;  4J0M A;  5GS0 A;  3E6J A;  3RFJ A;  3UL8 A;  4KNG A;  4K17 A;  3G3B A;  4CNM A;  1KOO A;  1JL5 A;  2JE0 A;  1FS2 A;  2OMZ A;  2P1Q B;  3WPE A;  2A0Z A;  3RW7 A;  4WP6 A;  2RA8 A;  2XOT A;  1H6T A;  1D0B A;  3C6O B;  1KOH A;  3OJA A;  4NKH A;  5GMG A;  3ZYI A;  4LSX C;  4Q3I A;  5AWA A;  1A9N A;  4U08 A;  4B8C D;  1P8T A;  3E2J A;  3O6N A;  4I6J B;  1K5G C;  4MQW X;  4R5C A;  3RFE A;  4EZG A;  4R0A A;  3G3A A;  2ID5 A;  4CP6 A;  1DFJ I;  1O6V A;  4H09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...