2ASSB

Crystal structure of the skp1-skp2-cks1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
325
structure length
325
Chain Sequence
VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/ligase/protein turnover
total genus 112
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2assB00
4Q3IA 4R5DA 1GWBA 4ECNA 1H6UA 4R6AA 2Z64A 2WQXA 4KNGA 2OMTA 4BSSA 1IO0A 3RJ0A 5AWAA 3CIGA 3OGKB 1M9SA 4V2CA 2Z81A 2Z82A 3ZYIA 4WYKA 4XSQA 4Z94G 4I6JB 4LSCA 5IJDA 3UL7A 1DFJI 5GMFA 2P1QB 1KOHA 3M18A 3RFJA 4RWTC 1OTOA 2O6RA 5B0TA 2V70A 2Y5QA 1P8TA 1OOKG 4ECOA 3UL9A 1XCDA 1G9UA 3VQ1A 4P8SA 3CVRA 3O53A 1FQVA 4IM6A 3WPBA 4KXFB 5IJBA 4MQWX 4LSXA 4BSUA 5CMNA 3W3GA 1H6TA 3TSRE 1P8VA 4M7EA 2WQWA 4RCWA 1JL5A 3ZYNA 4ARRA 3W3NA 2P1PB 3WPCA 1M9LA 3E4GA 2O6SA 4H09A 4LSXC 5IJCA 3WPGA 4FHOA 3UN9A 5LFNA 2P1NB 3RGZA 4M7EC 3CIYA 4C2BB 3DZEA 3E3ZA 4LXSA 2WQVA 4R0AA 3G39A 1U0ND 1FO1A 4LSAA 5AWBA 5HZLB 1DS9A 3ULAA 3ZYOA 3OJAB 4NKHA 4R6GA 3UL8A 5GS0A 1LTXA 4P91A 1FS2A 1KOOA 2JQDA 5IYXC 2UZXA 2V9TB 2WFHA 4U09A 1SQ0B 1P9AG 4LI2A 4Z79A 2V9SA 2WQUA 3W3MA 4CILA 2RR6A 4FCGA 3WN4A 5AWDA 2Z7XA 4R6FA 2OMVA 2OMWA 4LI1A 4U08A 4TZHA 1W8AA 1O6TA 5B0NA 4XGOA 3RIZA 1D0BA 4R08A 3C6OB 1PGVA 4PEQB 5CMPA 5GS2B 4K17A 4GLPA 3OGMB 4L3FA 4R09A 4PSJA 3WPIA 2Z65A 2P1MB 1OGQA 3GOZA 3RFSA 4YEBB 5A5CA 3RW6A 4CNCA 4FDWA 3G06A 3BZ5A 2ASSB 4LXRA 1A9NA 3WPDA 4GT6A 4CC4C 3P72A 4QC0A 4PERA 3ULUA 2RA8A 2O6QA 4J0MA 3PMHG 2ID5A 4FS7A 4PKIG 4MN8B 2Z62A 1DCEA 3G3BA 2Z66A 4Z61C 5GMGA 2ASTB 3E6JA 4Q3GA 4R5CA 2BEXA 3OGLB 4CNMA 1K5DC 4FMZA 1ZIWA 1K5GC 4Q62A 1QYYA 4J4LA 4B8CD 5HDHA 3A79B 3JB9j 3W3JA 4C2AB 1YRGA 2UZYA 3RFEA 4UFRA 3WPFA 2OMXA 2R9UA 3SB4A 1O6SA 4Z8GA 4QBZA 1A4YA 5AZ5A 4V2DA 2XWTC 1WWLA 5GMHA 4KT1A 3ZYJA 4R6JA 5AWCA 1O6VA 4U7LA 4BV4R 2Q4GW 3C6NB 3C6PB 3M19A 4XOSA 3E2JA 1M10B 1FT8A 1M0ZA 4PQ8A 3KJ4A 4FD0A 2XOTA 1OZNA 2OMZA 1OTMA 2BNHA 5FTTB 3O6NA 4V2EA 5B4PA 4CC4A 2OMUA 1XWDC 4EZGA 2CA6A 2JE1A 1XEUA 2IFGA 3RW7A 3G3AA 4WP6A 2OMYA 2FT3A 2Z7XB 1OTNA 3RGXA 2ELLA 4BSRA 1XECA 3FXIA 2A0ZA 2P1OB 3OJAA 4QXEA 4AY9X 2Z63A 3ULVA 4CP6A 4HQ1A 3WPEA 4G8AA 3G04C 3REZA 3VQ2A 4R07A 1Z7XW 3W3LA 3WPHA 4RCAB 4Y61B 5GQRK 2JE0A 1XKUA 5D3IA 4AW4A 4OQTA 4U06A 4Z64C 4NKGA 4R58A 3W3KA 4ARNA 4L3AA
chains in the Genus database with same CATH superfamily
4Q3IA 4R5DA 1GWBA 4ECNA 1H6UA 4R6AA 2Z64A 2WQXA 4KNGA 2OMTA 4BSSA 1IO0A 3RJ0A 5AWAA 3CIGA 3OGKB 1M9SA 4V2CA 2Z81A 2Z82A 3ZYIA 4WYKA 4XSQA 4Z94G 4I6JB 4LSCA 5IJDA 3UL7A 1DFJI 5GMFA 2P1QB 1KOHA 3M18A 3RFJA 4RWTC 1OTOA 2O6RA 5B0TA 2V70A 2Y5QA 1P8TA 1OOKG 4ECOA 3UL9A 1XCDA 1G9UA 3VQ1A 4P8SA 3CVRA 3O53A 1FQVA 4IM6A 4NZRM 3WPBA 4KXFB 5IJBA 4MQWX 4LSXA 4BSUA 5CMNA 3W3GA 1H6TA 3TSRE 1P8VA 4M7EA 2WQWA 4RCWA 4NZTM 1JL5A 3ZYNA 4ARRA 3W3NA 2P1PB 3WPCA 1M9LA 3E4GA 2O6SA 4H09A 4LSXC 5IJCA 3WPGA 4FHOA 3UN9A 5LFNA 2P1NB 3RGZA 4M7EC 3CIYA 4C2BB 3DZEA 3E3ZA 4LXSA 2WQVA 4R0AA 3G39A 1U0ND 1FO1A 4LSAA 5AWBA 5HZLB 1DS9A 3ULAA 3ZYOA 3OJAB 4NKHA 4R6GA 3UL8A 5GS0A 1LTXA 4P91A 1FS2A 1KOOA 2JQDA 5IYXC 2UZXA 2V9TB 2WFHA 4U09A 1SQ0B 1P9AG 4LI2A 4Z79A 2V9SA 2WQUA 3W3MA 4CILA 2RR6A 4FCGA 3WN4A 5AWDA 2Z7XA 4R6FA 2OMVA 2OMWA 4LI1A 4U08A 4TZHA 1W8AA 1O6TA 5B0NA 4XGOA 3RIZA 1D0BA 4R08A 3C6OB 1PGVA 4PEQB 5CMPA 5GS2B 4K17A 4GLPA 3OGMB 4L3FA 4R09A 4PSJA 3WPIA 2Z65A 2P1MB 1OGQA 3GOZA 3RFSA 4YEBB 5A5CA 3RW6A 4CNCA 4FDWA 3G06A 3BZ5A 2ASSB 4LXRA 1A9NA 3WPDA 4GT6A 4CC4C 3P72A 4QC0A 4PERA 3ULUA 2RA8A 2O6QA 4J0MA 3PMHG 2ID5A 4FS7A 4PKIG 4MN8B 2Z62A 1DCEA 3G3BA 2Z66A 4Z61C 5GMGA 2ASTB 3E6JA 4Q3GA 4R5CA 2BEXA 3OGLB 4CNMA 1K5DC 4FMZA 1ZIWA 1K5GC 4Q62A 1QYYA 4J4LA 4B8CD 5HDHA 3A79B 3JB9j 3W3JA 4C2AB 1YRGA 2UZYA 3RFEA 4UFRA 3WPFA 2OMXA 2R9UA 3SB4A 1O6SA 4Z8GA 4QBZA 1A4YA 5AZ5A 4V2DA 2XWTC 1WWLA 5GMHA 4KT1A 3ZYJA 4R6JA 5AWCA 1O6VA 4U7LA 4BV4R 2Q4GW 3C6NB 3C6PB 3M19A 4XOSA 3E2JA 1M10B 1FT8A 1M0ZA 4PQ8A 3KJ4A 4FD0A 2XOTA 1OZNA 2OMZA 1OTMA 2BNHA 5FTTB 3O6NA 4V2EA 5B4PA 4CC4A 2OMUA 1XWDC 4EZGA 2CA6A 2JE1A 1XEUA 2IFGA 3RW7A 3G3AA 4WP6A 2OMYA 2FT3A 2Z7XB 1OTNA 3RGXA 2ELLA 4BSRA 1XECA 3FXIA 2A0ZA 2P1OB 3OJAA 4QXEA 4AY9X 2Z63A 3ULVA 4CP6A 4HQ1A 3WPEA 4G8AA 3G04C 3REZA 3VQ2A 4R07A 1Z7XW 3W3LA 3WPHA 4RCAB 4Y61B 5GQRK 2JE0A 1XKUA 5D3IA 4AW4A 4OQTA 4U06A 4Z64C 4NKGA 4R58A 3W3KA 4ARNA 4L3AA
chains in the Genus database with same CATH topology
4Q3IA 4R5DA 1GWBA 4ECNA 1H6UA 4R6AA 2Z64A 2WQXA 4KNGA 2OMTA 4BSSA 1IO0A 3RJ0A 5AWAA 3CIGA 3OGKB 1M9SA 4V2CA 2Z81A 2Z82A 3ZYIA 4WYKA 4XSQA 4Z94G 4I6JB 4LSCA 5IJDA 3UL7A 1DFJI 5GMFA 2P1QB 1KOHA 3M18A 3RFJA 4RWTC 1OTOA 2O6RA 5B0TA 2V70A 2Y5QA 1P8TA 1OOKG 4ECOA 3UL9A 1XCDA 1G9UA 3VQ1A 4P8SA 3CVRA 3O53A 1FQVA 4IM6A 3WPBA 4KXFB 5IJBA 4MQWX 4LSXA 4BSUA 5CMNA 3W3GA 1H6TA 3TSRE 1P8VA 4M7EA 2WQWA 4RCWA 1JL5A 3ZYNA 4ARRA 3W3NA 2P1PB 3WPCA 1M9LA 3E4GA 2O6SA 4H09A 4LSXC 5IJCA 3WPGA 4FHOA 3UN9A 5LFNA 2P1NB 3RGZA 4M7EC 3CIYA 4C2BB 3DZEA 3E3ZA 4LXSA 2WQVA 4R0AA 3G39A 1U0ND 1FO1A 4LSAA 5AWBA 5HZLB 1DS9A 3ULAA 3ZYOA 3OJAB 4NKHA 4R6GA 3UL8A 5GS0A 1LTXA 4P91A 1FS2A 1KOOA 2JQDA 5IYXC 2UZXA 2V9TB 2WFHA 4U09A 1SQ0B 1P9AG 4LI2A 4Z79A 2V9SA 2WQUA 3W3MA 4CILA 2RR6A 4FCGA 3WN4A 5AWDA 2Z7XA 4R6FA 2OMVA 2OMWA 4LI1A 4U08A 4TZHA 1W8AA 1O6TA 5B0NA 4XGOA 3RIZA 1D0BA 4R08A 3C6OB 1PGVA 4PEQB 5CMPA 5GS2B 4K17A 4GLPA 3OGMB 4L3FA 4R09A 4PSJA 3WPIA 2Z65A 2P1MB 1OGQA 3GOZA 3RFSA 4YEBB 5A5CA 3RW6A 4CNCA 4FDWA 3G06A 3BZ5A 2ASSB 4LXRA 1A9NA 3WPDA 4GT6A 4CC4C 3P72A 4QC0A 4PERA 3ULUA 2RA8A 2O6QA 4J0MA 3PMHG 2ID5A 4FS7A 4PKIG 4MN8B 2Z62A 1DCEA 3G3BA 2Z66A 4Z61C 5GMGA 2ASTB 3E6JA 4Q3GA 4R5CA 2BEXA 3OGLB 4CNMA 1K5DC 4FMZA 1ZIWA 1K5GC 4Q62A 1QYYA 4J4LA 4B8CD 5HDHA 3A79B 3JB9j 3W3JA 4C2AB 1YRGA 2UZYA 3RFEA 4UFRA 3WPFA 2OMXA 2R9UA 3SB4A 1O6SA 4Z8GA 4QBZA 1A4YA 5AZ5A 4V2DA 2XWTC 1WWLA 5GMHA 4KT1A 3ZYJA 4R6JA 5AWCA 1O6VA 4U7LA 4BV4R 2Q4GW 3C6NB 3C6PB 3M19A 4XOSA 3E2JA 1M10B 1FT8A 1M0ZA 4PQ8A 3KJ4A 4FD0A 2XOTA 1OZNA 2OMZA 1OTMA 2BNHA 5FTTB 3O6NA 4V2EA 5B4PA 4CC4A 2OMUA 1XWDC 4EZGA 2CA6A 2JE1A 1XEUA 2IFGA 3RW7A 3G3AA 4WP6A 2OMYA 2FT3A 2Z7XB 1OTNA 3RGXA 2ELLA 4BSRA 1XECA 3FXIA 2A0ZA 2P1OB 3OJAA 4QXEA 4AY9X 2Z63A 3ULVA 4CP6A 4HQ1A 3WPEA 4G8AA 3G04C 3REZA 3VQ2A 4R07A 1Z7XW 3W3LA 3WPHA 4RCAB 4Y61B 5GQRK 2JE0A 1XKUA 5D3IA 4AW4A 4OQTA 4U06A 4Z64C 4NKGA 4R58A 3W3KA 4ARNA 4L3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q3I A;  4R5D A;  1GWB A;  4ECN A;  1H6U A;  4R6A A;  2Z64 A;  2WQX A;  4KNG A;  2OMT A;  4BSS A;  1IO0 A;  3RJ0 A;  5AWA A;  3CIG A;  3OGK B;  1M9S A;  4V2C A;  2Z81 A;  2Z82 A;  3ZYI A;  4WYK A;  4XSQ A;  4Z94 G;  4I6J B;  4LSC A;  5IJD A;  3UL7 A;  1DFJ I;  5GMF A;  2P1Q B;  1KOH A;  3M18 A;  3RFJ A;  4RWT C;  1OTO A;  2O6R A;  5B0T A;  2V70 A;  2Y5Q A;  1P8T A;  1OOK G;  4ECO A;  3UL9 A;  1XCD A;  1G9U A;  3VQ1 A;  4P8S A;  3CVR A;  3O53 A;  1FQV A;  4IM6 A;  3WPB A;  4KXF B;  5IJB A;  4MQW X;  4LSX A;  4BSU A;  5CMN A;  3W3G A;  1H6T A;  3TSR E;  1P8V A;  4M7E A;  2WQW A;  4RCW A;  1JL5 A;  3ZYN A;  4ARR A;  3W3N A;  2P1P B;  3WPC A;  1M9L A;  3E4G A;  2O6S A;  4H09 A;  4LSX C;  5IJC A;  3WPG A;  4FHO A;  3UN9 A;  5LFN A;  2P1N B;  3RGZ A;  4M7E C;  3CIY A;  4C2B B;  3DZE A;  3E3Z A;  4LXS A;  2WQV A;  4R0A A;  3G39 A;  1U0N D;  1FO1 A;  4LSA A;  5AWB A;  5HZL B;  1DS9 A;  3ULA A;  3ZYO A;  3OJA B;  4NKH A;  4R6G A;  3UL8 A;  5GS0 A;  1LTX A;  4P91 A;  1FS2 A;  1KOO A;  2JQD A;  5IYX C;  2UZX A;  2V9T B;  2WFH A;  4U09 A;  1SQ0 B;  1P9A G;  4LI2 A;  4Z79 A;  2V9S A;  2WQU A;  3W3M A;  4CIL A;  2RR6 A;  4FCG A;  3WN4 A;  5AWD A;  2Z7X A;  4R6F A;  2OMV A;  2OMW A;  4LI1 A;  4U08 A;  4TZH A;  1W8A A;  1O6T A;  5B0N A;  4XGO A;  3RIZ A;  1D0B A;  4R08 A;  3C6O B;  1PGV A;  4PEQ B;  5CMP A;  5GS2 B;  4K17 A;  4GLP A;  3OGM B;  4L3F A;  4R09 A;  4PSJ A;  3WPI A;  2Z65 A;  2P1M B;  1OGQ A;  3GOZ A;  3RFS A;  4YEB B;  5A5C A;  3RW6 A;  4CNC A;  4FDW A;  3G06 A;  3BZ5 A;  2ASS B;  4LXR A;  1A9N A;  3WPD A;  4GT6 A;  4CC4 C;  3P72 A;  4QC0 A;  4PER A;  3ULU A;  2RA8 A;  2O6Q A;  4J0M A;  3PMH G;  2ID5 A;  4FS7 A;  4PKI G;  4MN8 B;  2Z62 A;  1DCE A;  3G3B A;  2Z66 A;  4Z61 C;  5GMG A;  2AST B;  3E6J A;  4Q3G A;  4R5C A;  2BEX A;  3OGL B;  4CNM A;  1K5D C;  4FMZ A;  1ZIW A;  1K5G C;  4Q62 A;  1QYY A;  4J4L A;  4B8C D;  5HDH A;  3A79 B;  3JB9 j;  3W3J A;  4C2A B;  1YRG A;  2UZY A;  3RFE A;  4UFR A;  3WPF A;  2OMX A;  2R9U A;  3SB4 A;  1O6S A;  4Z8G A;  4QBZ A;  1A4Y A;  5AZ5 A;  4V2D A;  2XWT C;  1WWL A;  5GMH A;  4KT1 A;  3ZYJ A;  4R6J A;  5AWC A;  1O6V A;  4U7L A;  4BV4 R;  2Q4G W;  3C6N B;  3C6P B;  3M19 A;  4XOS A;  3E2J A;  1M10 B;  1FT8 A;  1M0Z A;  4PQ8 A;  3KJ4 A;  4FD0 A;  2XOT A;  1OZN A;  2OMZ A;  1OTM A;  2BNH A;  5FTT B;  3O6N A;  4V2E A;  5B4P A;  4CC4 A;  2OMU A;  1XWD C;  4EZG A;  2CA6 A;  2JE1 A;  1XEU A;  2IFG A;  3RW7 A;  3G3A A;  4WP6 A;  2OMY A;  2FT3 A;  2Z7X B;  1OTN A;  3RGX A;  2ELL A;  4BSR A;  1XEC A;  3FXI A;  2A0Z A;  2P1O B;  3OJA A;  4QXE A;  4AY9 X;  2Z63 A;  3ULV A;  4CP6 A;  4HQ1 A;  3WPE A;  4G8A A;  3G04 C;  3REZ A;  3VQ2 A;  4R07 A;  1Z7X W;  3W3L A;  3WPH A;  4RCA B;  4Y61 B;  5GQR K;  2JE0 A;  1XKU A;  5D3I A;  4AW4 A;  4OQT A;  4U06 A;  4Z64 C;  4NKG A;  4R58 A;  3W3K A;  4ARN A;  4L3A A; 
#chains in the Genus database with same CATH topology
 4Q3I A;  4R5D A;  1GWB A;  4ECN A;  1H6U A;  4R6A A;  2Z64 A;  2WQX A;  4KNG A;  2OMT A;  4BSS A;  1IO0 A;  3RJ0 A;  5AWA A;  3CIG A;  3OGK B;  1M9S A;  4V2C A;  2Z81 A;  2Z82 A;  3ZYI A;  4WYK A;  4XSQ A;  4Z94 G;  4I6J B;  4LSC A;  5IJD A;  3UL7 A;  1DFJ I;  5GMF A;  2P1Q B;  1KOH A;  3M18 A;  3RFJ A;  4RWT C;  1OTO A;  2O6R A;  5B0T A;  2V70 A;  2Y5Q A;  1P8T A;  1OOK G;  4ECO A;  3UL9 A;  1XCD A;  1G9U A;  3VQ1 A;  4P8S A;  3CVR A;  3O53 A;  1FQV A;  4IM6 A;  4NZR M;  3WPB A;  4KXF B;  5IJB A;  4MQW X;  4LSX A;  4BSU A;  5CMN A;  3W3G A;  1H6T A;  3TSR E;  1P8V A;  4M7E A;  2WQW A;  4RCW A;  4NZT M;  1JL5 A;  3ZYN A;  4ARR A;  3W3N A;  2P1P B;  3WPC A;  1M9L A;  3E4G A;  2O6S A;  4H09 A;  4LSX C;  5IJC A;  3WPG A;  4FHO A;  3UN9 A;  5LFN A;  2P1N B;  3RGZ A;  4M7E C;  3CIY A;  4C2B B;  3DZE A;  3E3Z A;  4LXS A;  2WQV A;  4R0A A;  3G39 A;  1U0N D;  1FO1 A;  4LSA A;  5AWB A;  5HZL B;  1DS9 A;  3ULA A;  3ZYO A;  3OJA B;  4NKH A;  4R6G A;  3UL8 A;  5GS0 A;  1LTX A;  4P91 A;  1FS2 A;  1KOO A;  2JQD A;  5IYX C;  2UZX A;  2V9T B;  2WFH A;  4U09 A;  1SQ0 B;  1P9A G;  4LI2 A;  4Z79 A;  2V9S A;  2WQU A;  3W3M A;  4CIL A;  2RR6 A;  4FCG A;  3WN4 A;  5AWD A;  2Z7X A;  4R6F A;  2OMV A;  2OMW A;  4LI1 A;  4U08 A;  4TZH A;  1W8A A;  1O6T A;  5B0N A;  4XGO A;  3RIZ A;  1D0B A;  4R08 A;  3C6O B;  1PGV A;  4PEQ B;  5CMP A;  5GS2 B;  4K17 A;  4GLP A;  3OGM B;  4L3F A;  4R09 A;  4PSJ A;  3WPI A;  2Z65 A;  2P1M B;  1OGQ A;  3GOZ A;  3RFS A;  4YEB B;  5A5C A;  3RW6 A;  4CNC A;  4FDW A;  3G06 A;  3BZ5 A;  2ASS B;  4LXR A;  1A9N A;  3WPD A;  4GT6 A;  4CC4 C;  3P72 A;  4QC0 A;  4PER A;  3ULU A;  2RA8 A;  2O6Q A;  4J0M A;  3PMH G;  2ID5 A;  4FS7 A;  4PKI G;  4MN8 B;  2Z62 A;  1DCE A;  3G3B A;  2Z66 A;  4Z61 C;  5GMG A;  2AST B;  3E6J A;  4Q3G A;  4R5C A;  2BEX A;  3OGL B;  4CNM A;  1K5D C;  4FMZ A;  1ZIW A;  1K5G C;  4Q62 A;  1QYY A;  4J4L A;  4B8C D;  5HDH A;  3A79 B;  3JB9 j;  3W3J A;  4C2A B;  1YRG A;  2UZY A;  3RFE A;  4UFR A;  3WPF A;  2OMX A;  2R9U A;  3SB4 A;  1O6S A;  4Z8G A;  4QBZ A;  1A4Y A;  5AZ5 A;  4V2D A;  2XWT C;  1WWL A;  5GMH A;  4KT1 A;  3ZYJ A;  4R6J A;  5AWC A;  1O6V A;  4U7L A;  4BV4 R;  2Q4G W;  3C6N B;  3C6P B;  3M19 A;  4XOS A;  3E2J A;  1M10 B;  1FT8 A;  1M0Z A;  4PQ8 A;  3KJ4 A;  4FD0 A;  2XOT A;  1OZN A;  2OMZ A;  1OTM A;  2BNH A;  5FTT B;  3O6N A;  4V2E A;  5B4P A;  4CC4 A;  2OMU A;  1XWD C;  4EZG A;  2CA6 A;  2JE1 A;  1XEU A;  2IFG A;  3RW7 A;  3G3A A;  4WP6 A;  2OMY A;  2FT3 A;  2Z7X B;  1OTN A;  3RGX A;  2ELL A;  4BSR A;  1XEC A;  3FXI A;  2A0Z A;  2P1O B;  3OJA A;  4QXE A;  4AY9 X;  2Z63 A;  3ULV A;  4CP6 A;  4HQ1 A;  3WPE A;  4G8A A;  3G04 C;  3REZ A;  3VQ2 A;  4R07 A;  1Z7X W;  3W3L A;  3WPH A;  4RCA B;  4Y61 B;  5GQR K;  2JE0 A;  1XKU A;  5D3I A;  4AW4 A;  4OQT A;  4U06 A;  4Z64 C;  4NKG A;  4R58 A;  3W3K A;  4ARN A;  4L3A A; 
#chains in the Genus database with same CATH homology
 4Q3I A;  4R5D A;  1GWB A;  4ECN A;  1H6U A;  4R6A A;  2Z64 A;  2WQX A;  4KNG A;  2OMT A;  4BSS A;  1IO0 A;  3RJ0 A;  5AWA A;  3CIG A;  3OGK B;  1M9S A;  4V2C A;  2Z81 A;  2Z82 A;  3ZYI A;  4WYK A;  4XSQ A;  4Z94 G;  4I6J B;  4LSC A;  5IJD A;  3UL7 A;  1DFJ I;  5GMF A;  2P1Q B;  1KOH A;  3M18 A;  3RFJ A;  4RWT C;  1OTO A;  2O6R A;  5B0T A;  2V70 A;  2Y5Q A;  1P8T A;  1OOK G;  4ECO A;  3UL9 A;  1XCD A;  1G9U A;  3VQ1 A;  4P8S A;  3CVR A;  3O53 A;  1FQV A;  4IM6 A;  3WPB A;  4KXF B;  5IJB A;  4MQW X;  4LSX A;  4BSU A;  5CMN A;  3W3G A;  1H6T A;  3TSR E;  1P8V A;  4M7E A;  2WQW A;  4RCW A;  1JL5 A;  3ZYN A;  4ARR A;  3W3N A;  2P1P B;  3WPC A;  1M9L A;  3E4G A;  2O6S A;  4H09 A;  4LSX C;  5IJC A;  3WPG A;  4FHO A;  3UN9 A;  5LFN A;  2P1N B;  3RGZ A;  4M7E C;  3CIY A;  4C2B B;  3DZE A;  3E3Z A;  4LXS A;  2WQV A;  4R0A A;  3G39 A;  1U0N D;  1FO1 A;  4LSA A;  5AWB A;  5HZL B;  1DS9 A;  3ULA A;  3ZYO A;  3OJA B;  4NKH A;  4R6G A;  3UL8 A;  5GS0 A;  1LTX A;  4P91 A;  1FS2 A;  1KOO A;  2JQD A;  5IYX C;  2UZX A;  2V9T B;  2WFH A;  4U09 A;  1SQ0 B;  1P9A G;  4LI2 A;  4Z79 A;  2V9S A;  2WQU A;  3W3M A;  4CIL A;  2RR6 A;  4FCG A;  3WN4 A;  5AWD A;  2Z7X A;  4R6F A;  2OMV A;  2OMW A;  4LI1 A;  4U08 A;  4TZH A;  1W8A A;  1O6T A;  5B0N A;  4XGO A;  3RIZ A;  1D0B A;  4R08 A;  3C6O B;  1PGV A;  4PEQ B;  5CMP A;  5GS2 B;  4K17 A;  4GLP A;  3OGM B;  4L3F A;  4R09 A;  4PSJ A;  3WPI A;  2Z65 A;  2P1M B;  1OGQ A;  3GOZ A;  3RFS A;  4YEB B;  5A5C A;  3RW6 A;  4CNC A;  4FDW A;  3G06 A;  3BZ5 A;  2ASS B;  4LXR A;  1A9N A;  3WPD A;  4GT6 A;  4CC4 C;  3P72 A;  4QC0 A;  4PER A;  3ULU A;  2RA8 A;  2O6Q A;  4J0M A;  3PMH G;  2ID5 A;  4FS7 A;  4PKI G;  4MN8 B;  2Z62 A;  1DCE A;  3G3B A;  2Z66 A;  4Z61 C;  5GMG A;  2AST B;  3E6J A;  4Q3G A;  4R5C A;  2BEX A;  3OGL B;  4CNM A;  1K5D C;  4FMZ A;  1ZIW A;  1K5G C;  4Q62 A;  1QYY A;  4J4L A;  4B8C D;  5HDH A;  3A79 B;  3JB9 j;  3W3J A;  4C2A B;  1YRG A;  2UZY A;  3RFE A;  4UFR A;  3WPF A;  2OMX A;  2R9U A;  3SB4 A;  1O6S A;  4Z8G A;  4QBZ A;  1A4Y A;  5AZ5 A;  4V2D A;  2XWT C;  1WWL A;  5GMH A;  4KT1 A;  3ZYJ A;  4R6J A;  5AWC A;  1O6V A;  4U7L A;  4BV4 R;  2Q4G W;  3C6N B;  3C6P B;  3M19 A;  4XOS A;  3E2J A;  1M10 B;  1FT8 A;  1M0Z A;  4PQ8 A;  3KJ4 A;  4FD0 A;  2XOT A;  1OZN A;  2OMZ A;  1OTM A;  2BNH A;  5FTT B;  3O6N A;  4V2E A;  5B4P A;  4CC4 A;  2OMU A;  1XWD C;  4EZG A;  2CA6 A;  2JE1 A;  1XEU A;  2IFG A;  3RW7 A;  3G3A A;  4WP6 A;  2OMY A;  2FT3 A;  2Z7X B;  1OTN A;  3RGX A;  2ELL A;  4BSR A;  1XEC A;  3FXI A;  2A0Z A;  2P1O B;  3OJA A;  4QXE A;  4AY9 X;  2Z63 A;  3ULV A;  4CP6 A;  4HQ1 A;  3WPE A;  4G8A A;  3G04 C;  3REZ A;  3VQ2 A;  4R07 A;  1Z7X W;  3W3L A;  3WPH A;  4RCA B;  4Y61 B;  5GQR K;  2JE0 A;  1XKU A;  5D3I A;  4AW4 A;  4OQT A;  4U06 A;  4Z64 C;  4NKG A;  4R58 A;  3W3K A;  4ARN A;  4L3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...