2JE0A

Crystal structure of pp32
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
b'MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC LEUCINE-RICH NUCLEAR PHOSPHOPROTEIN 32 FAMILY MEMBER
publication title The Crystal Structure of the Tumor Suppressor Protein Pp32 (Anp32A): Structural Insights Into Anp32 Family of Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 47
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2je0A00
4IM6A 5FTTB 3ZYIA 4QBZA 4U09A 4J0MA 3WPCA 1PGVA 4FDWA 5LFNA 3RFJA 5IJDA 4MN8B 3C6PB 3O6NA 3WPIA 3OJAB 1M10B 5AWCA 4ARRA 4ECNA 1U0ND 4LSAA 3M19A 4LXRA 1DCEA 2WQWA 4WYKA 5GMHA 3KJ4A 3ULVA 4LSXC 4Q62A 3UL9A 4Z61C 4PSJA 2P1QB 2OMYA 4FS7A 4R0AA 3RGXA 4NKHA 3RGZA 1A4YA 1OTNA 4FD0A 2Z81A 1SQ0B 3OJAA 4WP6A 3GOZA 3WN4A 3E4GA 2ASTB 2JE0A 4PERA 4BSSA 5AWDA 3JB9j 4Q3IA 1DFJI 3UL8A 3CIGA 3WPEA 4NKGA 4AY9X 4B8CD 5IJBA 4V2EA 1ZIWA 4BSUA 3A79B 1GWBA 3ULAA 3W3LA 2OMUA 2P1NB 4V2DA 2O6SA 2Z64A 4XOSA 4U06A 5CMNA 1Z7XW 4QXEA 5AZ5A 1H6UA 3E3ZA 2V9TB 4PQ8A 1OZNA 4J4LA 3CIYA 2WQUA 2OMZA 4RCWA 2Z7XA 4R6FA 5IJCA 3G04C 3RW7A 5HZLB 3TSRE 3FXIA 1P8VA 1XCDA 5GS0A 1XWDC 4Z94G 4CC4A 4C2AB 1KOHA 3E2JA 1KOOA 5HDHA 4FHOA 3OGKB 3VQ1A 2XWTC 1XEUA 4M7EA 1QYYA 3RFSA 1D0BA 3ZYJA 4R5CA 4G8AA 4U08A 3CVRA 4R08A 2ASSB 2OMXA 2OMTA 1P9AG 2FT3A 3RIZA 2UZYA 1IO0A 3OGMB 4HQ1A 3ULUA 5AWAA 1H6TA 1OTMA 4KNGA 3G06A 3RJ0A 3G3BA 1M9LA 4CILA 4MQWX 2UZXA 4LSCA 3C6NB 3RFEA 4R09A 2P1OB 4EZGA 2P1PB 4R5DA 3REZA 2V9SA 1FT8A 4XSQA 4P91A 4K17A 3W3MA 2XOTA 3WPFA 1W8AA 4PEQB 3ZYNA 2O6RA 4AW4A 3UL7A 5IYXC 5A5CA 2IFGA 3OGLB 4BSRA 1OTOA 4R58A 4U7LA 1O6TA 3C6OB 1XKUA 1P8TA 2Q4GW 4RCAB 2R9UA 4LI1A 3ZYOA 4RWTC 2Z62A 1A9NA 2Y5QA 3P72A 5AWBA 3G39A 5B0NA 1K5DC 1G9UA 3SB4A 2JE1A 2ELLA 1M9SA 3M18A 3UN9A 1LTXA 4L3FA 1DS9A 2OMWA 4Z64C 4L3AA 4V2CA 2P1MB 3WPDA 3W3KA 4UFRA 4ECOA 4R07A 3E6JA 4CNCA 2WQVA 1M0ZA 3DZEA 1OGQA 1OOKG 5GMFA 4C2BB 4XGOA 2WFHA 2RA8A 1XECA 2Z65A 1WWLA 1O6SA 4CC4C 3WPHA 2O6QA 3O53A 4FMZA 4R6GA 4M7EC 2RR6A 4LXSA 4LI2A 4Z8GA 4YEBB 4QC0A 5GMGA 1JL5A 2ID5A 5B4PA 4KT1A 1FS2A 4R6JA 4CP6A 1YRGA 2JQDA 4OQTA 2A0ZA 4P8SA 1O6VA 2CA6A 2Z7XB 4GT6A 4TZHA 1K5GC 4KXFB 4BV4R 5D3IA 4LSXA 3W3JA 4H09A 2WQXA 2V70A 1FO1A 2BEXA 4Q3GA 4FCGA 5CMPA 4I6JB 3PMHG 3W3GA 4Y61B 2OMVA 2BNHA 2Z66A 4ARNA 3WPGA 1FQVA 2Z63A 4R6AA 2Z82A 3WPBA 5B0TA 4Z79A 3RW6A 5GQRK 4GLPA 3VQ2A 3BZ5A 5GS2B 3G3AA 4CNMA 4PKIG 3W3NA
chains in the Genus database with same CATH superfamily
4IM6A 5FTTB 3ZYIA 4QBZA 4U09A 4J0MA 3WPCA 1PGVA 4FDWA 5LFNA 3RFJA 5IJDA 4MN8B 3C6PB 3O6NA 3WPIA 3OJAB 1M10B 5AWCA 4ARRA 4ECNA 1U0ND 4LSAA 3M19A 4LXRA 1DCEA 2WQWA 4WYKA 5GMHA 3KJ4A 3ULVA 4LSXC 4Q62A 3UL9A 4Z61C 4PSJA 2P1QB 2OMYA 4FS7A 4R0AA 3RGXA 4NKHA 3RGZA 1A4YA 1OTNA 4FD0A 2Z81A 1SQ0B 3OJAA 4WP6A 3GOZA 3WN4A 3E4GA 2ASTB 2JE0A 4PERA 4BSSA 5AWDA 3JB9j 4Q3IA 1DFJI 3UL8A 3CIGA 3WPEA 4NKGA 4AY9X 4B8CD 5IJBA 4NZRM 4V2EA 1ZIWA 4BSUA 3A79B 1GWBA 3ULAA 3W3LA 2OMUA 2P1NB 4V2DA 2O6SA 2Z64A 4XOSA 4U06A 5CMNA 1Z7XW 4QXEA 5AZ5A 1H6UA 3E3ZA 2V9TB 4PQ8A 1OZNA 4J4LA 3CIYA 2WQUA 2OMZA 4RCWA 2Z7XA 4R6FA 5IJCA 3G04C 3RW7A 5HZLB 3TSRE 3FXIA 1P8VA 1XCDA 5GS0A 1XWDC 4Z94G 4CC4A 4C2AB 1KOHA 3E2JA 1KOOA 5HDHA 4FHOA 3OGKB 3VQ1A 2XWTC 1XEUA 4M7EA 1QYYA 3RFSA 1D0BA 3ZYJA 4NZTM 4R5CA 4G8AA 4U08A 3CVRA 4R08A 2ASSB 2OMXA 2OMTA 1P9AG 2FT3A 3RIZA 2UZYA 1IO0A 3OGMB 4HQ1A 3ULUA 5AWAA 1H6TA 1OTMA 4KNGA 3G06A 3RJ0A 3G3BA 1M9LA 4CILA 4MQWX 2UZXA 4LSCA 3C6NB 3RFEA 4R09A 2P1OB 4EZGA 2P1PB 4R5DA 3REZA 2V9SA 1FT8A 4XSQA 4P91A 4K17A 3W3MA 2XOTA 3WPFA 1W8AA 4PEQB 3ZYNA 2O6RA 4AW4A 3UL7A 5IYXC 5A5CA 2IFGA 3OGLB 4BSRA 1OTOA 4R58A 4U7LA 1O6TA 3C6OB 1XKUA 1P8TA 2Q4GW 4RCAB 2R9UA 4LI1A 3ZYOA 4RWTC 2Z62A 1A9NA 2Y5QA 3P72A 5AWBA 3G39A 5B0NA 1K5DC 1G9UA 3SB4A 2JE1A 2ELLA 1M9SA 3M18A 3UN9A 1LTXA 4L3FA 1DS9A 2OMWA 4Z64C 4L3AA 4V2CA 2P1MB 3WPDA 3W3KA 4UFRA 4ECOA 4R07A 3E6JA 4CNCA 2WQVA 1M0ZA 3DZEA 1OGQA 1OOKG 5GMFA 4C2BB 4XGOA 2WFHA 2RA8A 1XECA 2Z65A 1WWLA 1O6SA 4CC4C 3WPHA 2O6QA 3O53A 4FMZA 4R6GA 4M7EC 2RR6A 4LXSA 4LI2A 4Z8GA 4YEBB 4QC0A 5GMGA 1JL5A 2ID5A 5B4PA 4KT1A 1FS2A 4R6JA 4CP6A 1YRGA 2JQDA 4OQTA 2A0ZA 4P8SA 1O6VA 2CA6A 2Z7XB 4GT6A 4TZHA 1K5GC 4KXFB 4BV4R 5D3IA 4LSXA 3W3JA 4H09A 2WQXA 2V70A 1FO1A 2BEXA 4Q3GA 4FCGA 5CMPA 4I6JB 3PMHG 3W3GA 4Y61B 2OMVA 2BNHA 2Z66A 4ARNA 3WPGA 1FQVA 2Z63A 4R6AA 2Z82A 3WPBA 5B0TA 4Z79A 3RW6A 5GQRK 4GLPA 3VQ2A 3BZ5A 5GS2B 3G3AA 4CNMA 4PKIG 3W3NA
chains in the Genus database with same CATH topology
4IM6A 5FTTB 3ZYIA 4QBZA 4U09A 4J0MA 3WPCA 1PGVA 4FDWA 5LFNA 3RFJA 5IJDA 4MN8B 3C6PB 3O6NA 3WPIA 3OJAB 1M10B 5AWCA 4ARRA 4ECNA 1U0ND 4LSAA 3M19A 4LXRA 1DCEA 2WQWA 4WYKA 5GMHA 3KJ4A 3ULVA 4LSXC 4Q62A 3UL9A 4Z61C 4PSJA 2P1QB 2OMYA 4FS7A 4R0AA 3RGXA 4NKHA 3RGZA 1A4YA 1OTNA 4FD0A 2Z81A 1SQ0B 3OJAA 4WP6A 3GOZA 3WN4A 3E4GA 2ASTB 2JE0A 4PERA 4BSSA 5AWDA 3JB9j 4Q3IA 1DFJI 3UL8A 3CIGA 3WPEA 4NKGA 4AY9X 4B8CD 5IJBA 4V2EA 1ZIWA 4BSUA 3A79B 1GWBA 3ULAA 3W3LA 2OMUA 2P1NB 4V2DA 2O6SA 2Z64A 4XOSA 4U06A 5CMNA 1Z7XW 4QXEA 5AZ5A 1H6UA 3E3ZA 2V9TB 4PQ8A 1OZNA 4J4LA 3CIYA 2WQUA 2OMZA 4RCWA 2Z7XA 4R6FA 5IJCA 3G04C 3RW7A 5HZLB 3TSRE 3FXIA 1P8VA 1XCDA 5GS0A 1XWDC 4Z94G 4CC4A 4C2AB 1KOHA 3E2JA 1KOOA 5HDHA 4FHOA 3OGKB 3VQ1A 2XWTC 1XEUA 4M7EA 1QYYA 3RFSA 1D0BA 3ZYJA 4R5CA 4G8AA 4U08A 3CVRA 4R08A 2ASSB 2OMXA 2OMTA 1P9AG 2FT3A 3RIZA 2UZYA 1IO0A 3OGMB 4HQ1A 3ULUA 5AWAA 1H6TA 1OTMA 4KNGA 3G06A 3RJ0A 3G3BA 1M9LA 4CILA 4MQWX 2UZXA 4LSCA 3C6NB 3RFEA 4R09A 2P1OB 4EZGA 2P1PB 4R5DA 3REZA 2V9SA 1FT8A 4XSQA 4P91A 4K17A 3W3MA 2XOTA 3WPFA 1W8AA 4PEQB 3ZYNA 2O6RA 4AW4A 3UL7A 5IYXC 5A5CA 2IFGA 3OGLB 4BSRA 1OTOA 4R58A 4U7LA 1O6TA 3C6OB 1XKUA 1P8TA 2Q4GW 4RCAB 2R9UA 4LI1A 3ZYOA 4RWTC 2Z62A 1A9NA 2Y5QA 3P72A 5AWBA 3G39A 5B0NA 1K5DC 1G9UA 3SB4A 2JE1A 2ELLA 1M9SA 3M18A 3UN9A 1LTXA 4L3FA 1DS9A 2OMWA 4Z64C 4L3AA 4V2CA 2P1MB 3WPDA 3W3KA 4UFRA 4ECOA 4R07A 3E6JA 4CNCA 2WQVA 1M0ZA 3DZEA 1OGQA 1OOKG 5GMFA 4C2BB 4XGOA 2WFHA 2RA8A 1XECA 2Z65A 1WWLA 1O6SA 4CC4C 3WPHA 2O6QA 3O53A 4FMZA 4R6GA 4M7EC 2RR6A 4LXSA 4LI2A 4Z8GA 4YEBB 4QC0A 5GMGA 1JL5A 2ID5A 5B4PA 4KT1A 1FS2A 4R6JA 4CP6A 1YRGA 2JQDA 4OQTA 2A0ZA 4P8SA 1O6VA 2CA6A 2Z7XB 4GT6A 4TZHA 1K5GC 4KXFB 4BV4R 5D3IA 4LSXA 3W3JA 4H09A 2WQXA 2V70A 1FO1A 2BEXA 4Q3GA 4FCGA 5CMPA 4I6JB 3PMHG 3W3GA 4Y61B 2OMVA 2BNHA 2Z66A 4ARNA 3WPGA 1FQVA 2Z63A 4R6AA 2Z82A 3WPBA 5B0TA 4Z79A 3RW6A 5GQRK 4GLPA 3VQ2A 3BZ5A 5GS2B 3G3AA 4CNMA 4PKIG 3W3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IM6 A;  5FTT B;  3ZYI A;  4QBZ A;  4U09 A;  4J0M A;  3WPC A;  1PGV A;  4FDW A;  5LFN A;  3RFJ A;  5IJD A;  4MN8 B;  3C6P B;  3O6N A;  3WPI A;  3OJA B;  1M10 B;  5AWC A;  4ARR A;  4ECN A;  1U0N D;  4LSA A;  3M19 A;  4LXR A;  1DCE A;  2WQW A;  4WYK A;  5GMH A;  3KJ4 A;  3ULV A;  4LSX C;  4Q62 A;  3UL9 A;  4Z61 C;  4PSJ A;  2P1Q B;  2OMY A;  4FS7 A;  4R0A A;  3RGX A;  4NKH A;  3RGZ A;  1A4Y A;  1OTN A;  4FD0 A;  2Z81 A;  1SQ0 B;  3OJA A;  4WP6 A;  3GOZ A;  3WN4 A;  3E4G A;  2AST B;  2JE0 A;  4PER A;  4BSS A;  5AWD A;  3JB9 j;  4Q3I A;  1DFJ I;  3UL8 A;  3CIG A;  3WPE A;  4NKG A;  4AY9 X;  4B8C D;  5IJB A;  4V2E A;  1ZIW A;  4BSU A;  3A79 B;  1GWB A;  3ULA A;  3W3L A;  2OMU A;  2P1N B;  4V2D A;  2O6S A;  2Z64 A;  4XOS A;  4U06 A;  5CMN A;  1Z7X W;  4QXE A;  5AZ5 A;  1H6U A;  3E3Z A;  2V9T B;  4PQ8 A;  1OZN A;  4J4L A;  3CIY A;  2WQU A;  2OMZ A;  4RCW A;  2Z7X A;  4R6F A;  5IJC A;  3G04 C;  3RW7 A;  5HZL B;  3TSR E;  3FXI A;  1P8V A;  1XCD A;  5GS0 A;  1XWD C;  4Z94 G;  4CC4 A;  4C2A B;  1KOH A;  3E2J A;  1KOO A;  5HDH A;  4FHO A;  3OGK B;  3VQ1 A;  2XWT C;  1XEU A;  4M7E A;  1QYY A;  3RFS A;  1D0B A;  3ZYJ A;  4R5C A;  4G8A A;  4U08 A;  3CVR A;  4R08 A;  2ASS B;  2OMX A;  2OMT A;  1P9A G;  2FT3 A;  3RIZ A;  2UZY A;  1IO0 A;  3OGM B;  4HQ1 A;  3ULU A;  5AWA A;  1H6T A;  1OTM A;  4KNG A;  3G06 A;  3RJ0 A;  3G3B A;  1M9L A;  4CIL A;  4MQW X;  2UZX A;  4LSC A;  3C6N B;  3RFE A;  4R09 A;  2P1O B;  4EZG A;  2P1P B;  4R5D A;  3REZ A;  2V9S A;  1FT8 A;  4XSQ A;  4P91 A;  4K17 A;  3W3M A;  2XOT A;  3WPF A;  1W8A A;  4PEQ B;  3ZYN A;  2O6R A;  4AW4 A;  3UL7 A;  5IYX C;  5A5C A;  2IFG A;  3OGL B;  4BSR A;  1OTO A;  4R58 A;  4U7L A;  1O6T A;  3C6O B;  1XKU A;  1P8T A;  2Q4G W;  4RCA B;  2R9U A;  4LI1 A;  3ZYO A;  4RWT C;  2Z62 A;  1A9N A;  2Y5Q A;  3P72 A;  5AWB A;  3G39 A;  5B0N A;  1K5D C;  1G9U A;  3SB4 A;  2JE1 A;  2ELL A;  1M9S A;  3M18 A;  3UN9 A;  1LTX A;  4L3F A;  1DS9 A;  2OMW A;  4Z64 C;  4L3A A;  4V2C A;  2P1M B;  3WPD A;  3W3K A;  4UFR A;  4ECO A;  4R07 A;  3E6J A;  4CNC A;  2WQV A;  1M0Z A;  3DZE A;  1OGQ A;  1OOK G;  5GMF A;  4C2B B;  4XGO A;  2WFH A;  2RA8 A;  1XEC A;  2Z65 A;  1WWL A;  1O6S A;  4CC4 C;  3WPH A;  2O6Q A;  3O53 A;  4FMZ A;  4R6G A;  4M7E C;  2RR6 A;  4LXS A;  4LI2 A;  4Z8G A;  4YEB B;  4QC0 A;  5GMG A;  1JL5 A;  2ID5 A;  5B4P A;  4KT1 A;  1FS2 A;  4R6J A;  4CP6 A;  1YRG A;  2JQD A;  4OQT A;  2A0Z A;  4P8S A;  1O6V A;  2CA6 A;  2Z7X B;  4GT6 A;  4TZH A;  1K5G C;  4KXF B;  4BV4 R;  5D3I A;  4LSX A;  3W3J A;  4H09 A;  2WQX A;  2V70 A;  1FO1 A;  2BEX A;  4Q3G A;  4FCG A;  5CMP A;  4I6J B;  3PMH G;  3W3G A;  4Y61 B;  2OMV A;  2BNH A;  2Z66 A;  4ARN A;  3WPG A;  1FQV A;  2Z63 A;  4R6A A;  2Z82 A;  3WPB A;  5B0T A;  4Z79 A;  3RW6 A;  5GQR K;  4GLP A;  3VQ2 A;  3BZ5 A;  5GS2 B;  3G3A A;  4CNM A;  4PKI G;  3W3N A; 
#chains in the Genus database with same CATH topology
 4IM6 A;  5FTT B;  3ZYI A;  4QBZ A;  4U09 A;  4J0M A;  3WPC A;  1PGV A;  4FDW A;  5LFN A;  3RFJ A;  5IJD A;  4MN8 B;  3C6P B;  3O6N A;  3WPI A;  3OJA B;  1M10 B;  5AWC A;  4ARR A;  4ECN A;  1U0N D;  4LSA A;  3M19 A;  4LXR A;  1DCE A;  2WQW A;  4WYK A;  5GMH A;  3KJ4 A;  3ULV A;  4LSX C;  4Q62 A;  3UL9 A;  4Z61 C;  4PSJ A;  2P1Q B;  2OMY A;  4FS7 A;  4R0A A;  3RGX A;  4NKH A;  3RGZ A;  1A4Y A;  1OTN A;  4FD0 A;  2Z81 A;  1SQ0 B;  3OJA A;  4WP6 A;  3GOZ A;  3WN4 A;  3E4G A;  2AST B;  2JE0 A;  4PER A;  4BSS A;  5AWD A;  3JB9 j;  4Q3I A;  1DFJ I;  3UL8 A;  3CIG A;  3WPE A;  4NKG A;  4AY9 X;  4B8C D;  5IJB A;  4NZR M;  4V2E A;  1ZIW A;  4BSU A;  3A79 B;  1GWB A;  3ULA A;  3W3L A;  2OMU A;  2P1N B;  4V2D A;  2O6S A;  2Z64 A;  4XOS A;  4U06 A;  5CMN A;  1Z7X W;  4QXE A;  5AZ5 A;  1H6U A;  3E3Z A;  2V9T B;  4PQ8 A;  1OZN A;  4J4L A;  3CIY A;  2WQU A;  2OMZ A;  4RCW A;  2Z7X A;  4R6F A;  5IJC A;  3G04 C;  3RW7 A;  5HZL B;  3TSR E;  3FXI A;  1P8V A;  1XCD A;  5GS0 A;  1XWD C;  4Z94 G;  4CC4 A;  4C2A B;  1KOH A;  3E2J A;  1KOO A;  5HDH A;  4FHO A;  3OGK B;  3VQ1 A;  2XWT C;  1XEU A;  4M7E A;  1QYY A;  3RFS A;  1D0B A;  3ZYJ A;  4NZT M;  4R5C A;  4G8A A;  4U08 A;  3CVR A;  4R08 A;  2ASS B;  2OMX A;  2OMT A;  1P9A G;  2FT3 A;  3RIZ A;  2UZY A;  1IO0 A;  3OGM B;  4HQ1 A;  3ULU A;  5AWA A;  1H6T A;  1OTM A;  4KNG A;  3G06 A;  3RJ0 A;  3G3B A;  1M9L A;  4CIL A;  4MQW X;  2UZX A;  4LSC A;  3C6N B;  3RFE A;  4R09 A;  2P1O B;  4EZG A;  2P1P B;  4R5D A;  3REZ A;  2V9S A;  1FT8 A;  4XSQ A;  4P91 A;  4K17 A;  3W3M A;  2XOT A;  3WPF A;  1W8A A;  4PEQ B;  3ZYN A;  2O6R A;  4AW4 A;  3UL7 A;  5IYX C;  5A5C A;  2IFG A;  3OGL B;  4BSR A;  1OTO A;  4R58 A;  4U7L A;  1O6T A;  3C6O B;  1XKU A;  1P8T A;  2Q4G W;  4RCA B;  2R9U A;  4LI1 A;  3ZYO A;  4RWT C;  2Z62 A;  1A9N A;  2Y5Q A;  3P72 A;  5AWB A;  3G39 A;  5B0N A;  1K5D C;  1G9U A;  3SB4 A;  2JE1 A;  2ELL A;  1M9S A;  3M18 A;  3UN9 A;  1LTX A;  4L3F A;  1DS9 A;  2OMW A;  4Z64 C;  4L3A A;  4V2C A;  2P1M B;  3WPD A;  3W3K A;  4UFR A;  4ECO A;  4R07 A;  3E6J A;  4CNC A;  2WQV A;  1M0Z A;  3DZE A;  1OGQ A;  1OOK G;  5GMF A;  4C2B B;  4XGO A;  2WFH A;  2RA8 A;  1XEC A;  2Z65 A;  1WWL A;  1O6S A;  4CC4 C;  3WPH A;  2O6Q A;  3O53 A;  4FMZ A;  4R6G A;  4M7E C;  2RR6 A;  4LXS A;  4LI2 A;  4Z8G A;  4YEB B;  4QC0 A;  5GMG A;  1JL5 A;  2ID5 A;  5B4P A;  4KT1 A;  1FS2 A;  4R6J A;  4CP6 A;  1YRG A;  2JQD A;  4OQT A;  2A0Z A;  4P8S A;  1O6V A;  2CA6 A;  2Z7X B;  4GT6 A;  4TZH A;  1K5G C;  4KXF B;  4BV4 R;  5D3I A;  4LSX A;  3W3J A;  4H09 A;  2WQX A;  2V70 A;  1FO1 A;  2BEX A;  4Q3G A;  4FCG A;  5CMP A;  4I6J B;  3PMH G;  3W3G A;  4Y61 B;  2OMV A;  2BNH A;  2Z66 A;  4ARN A;  3WPG A;  1FQV A;  2Z63 A;  4R6A A;  2Z82 A;  3WPB A;  5B0T A;  4Z79 A;  3RW6 A;  5GQR K;  4GLP A;  3VQ2 A;  3BZ5 A;  5GS2 B;  3G3A A;  4CNM A;  4PKI G;  3W3N A; 
#chains in the Genus database with same CATH homology
 4IM6 A;  5FTT B;  3ZYI A;  4QBZ A;  4U09 A;  4J0M A;  3WPC A;  1PGV A;  4FDW A;  5LFN A;  3RFJ A;  5IJD A;  4MN8 B;  3C6P B;  3O6N A;  3WPI A;  3OJA B;  1M10 B;  5AWC A;  4ARR A;  4ECN A;  1U0N D;  4LSA A;  3M19 A;  4LXR A;  1DCE A;  2WQW A;  4WYK A;  5GMH A;  3KJ4 A;  3ULV A;  4LSX C;  4Q62 A;  3UL9 A;  4Z61 C;  4PSJ A;  2P1Q B;  2OMY A;  4FS7 A;  4R0A A;  3RGX A;  4NKH A;  3RGZ A;  1A4Y A;  1OTN A;  4FD0 A;  2Z81 A;  1SQ0 B;  3OJA A;  4WP6 A;  3GOZ A;  3WN4 A;  3E4G A;  2AST B;  2JE0 A;  4PER A;  4BSS A;  5AWD A;  3JB9 j;  4Q3I A;  1DFJ I;  3UL8 A;  3CIG A;  3WPE A;  4NKG A;  4AY9 X;  4B8C D;  5IJB A;  4V2E A;  1ZIW A;  4BSU A;  3A79 B;  1GWB A;  3ULA A;  3W3L A;  2OMU A;  2P1N B;  4V2D A;  2O6S A;  2Z64 A;  4XOS A;  4U06 A;  5CMN A;  1Z7X W;  4QXE A;  5AZ5 A;  1H6U A;  3E3Z A;  2V9T B;  4PQ8 A;  1OZN A;  4J4L A;  3CIY A;  2WQU A;  2OMZ A;  4RCW A;  2Z7X A;  4R6F A;  5IJC A;  3G04 C;  3RW7 A;  5HZL B;  3TSR E;  3FXI A;  1P8V A;  1XCD A;  5GS0 A;  1XWD C;  4Z94 G;  4CC4 A;  4C2A B;  1KOH A;  3E2J A;  1KOO A;  5HDH A;  4FHO A;  3OGK B;  3VQ1 A;  2XWT C;  1XEU A;  4M7E A;  1QYY A;  3RFS A;  1D0B A;  3ZYJ A;  4R5C A;  4G8A A;  4U08 A;  3CVR A;  4R08 A;  2ASS B;  2OMX A;  2OMT A;  1P9A G;  2FT3 A;  3RIZ A;  2UZY A;  1IO0 A;  3OGM B;  4HQ1 A;  3ULU A;  5AWA A;  1H6T A;  1OTM A;  4KNG A;  3G06 A;  3RJ0 A;  3G3B A;  1M9L A;  4CIL A;  4MQW X;  2UZX A;  4LSC A;  3C6N B;  3RFE A;  4R09 A;  2P1O B;  4EZG A;  2P1P B;  4R5D A;  3REZ A;  2V9S A;  1FT8 A;  4XSQ A;  4P91 A;  4K17 A;  3W3M A;  2XOT A;  3WPF A;  1W8A A;  4PEQ B;  3ZYN A;  2O6R A;  4AW4 A;  3UL7 A;  5IYX C;  5A5C A;  2IFG A;  3OGL B;  4BSR A;  1OTO A;  4R58 A;  4U7L A;  1O6T A;  3C6O B;  1XKU A;  1P8T A;  2Q4G W;  4RCA B;  2R9U A;  4LI1 A;  3ZYO A;  4RWT C;  2Z62 A;  1A9N A;  2Y5Q A;  3P72 A;  5AWB A;  3G39 A;  5B0N A;  1K5D C;  1G9U A;  3SB4 A;  2JE1 A;  2ELL A;  1M9S A;  3M18 A;  3UN9 A;  1LTX A;  4L3F A;  1DS9 A;  2OMW A;  4Z64 C;  4L3A A;  4V2C A;  2P1M B;  3WPD A;  3W3K A;  4UFR A;  4ECO A;  4R07 A;  3E6J A;  4CNC A;  2WQV A;  1M0Z A;  3DZE A;  1OGQ A;  1OOK G;  5GMF A;  4C2B B;  4XGO A;  2WFH A;  2RA8 A;  1XEC A;  2Z65 A;  1WWL A;  1O6S A;  4CC4 C;  3WPH A;  2O6Q A;  3O53 A;  4FMZ A;  4R6G A;  4M7E C;  2RR6 A;  4LXS A;  4LI2 A;  4Z8G A;  4YEB B;  4QC0 A;  5GMG A;  1JL5 A;  2ID5 A;  5B4P A;  4KT1 A;  1FS2 A;  4R6J A;  4CP6 A;  1YRG A;  2JQD A;  4OQT A;  2A0Z A;  4P8S A;  1O6V A;  2CA6 A;  2Z7X B;  4GT6 A;  4TZH A;  1K5G C;  4KXF B;  4BV4 R;  5D3I A;  4LSX A;  3W3J A;  4H09 A;  2WQX A;  2V70 A;  1FO1 A;  2BEX A;  4Q3G A;  4FCG A;  5CMP A;  4I6J B;  3PMH G;  3W3G A;  4Y61 B;  2OMV A;  2BNH A;  2Z66 A;  4ARN A;  3WPG A;  1FQV A;  2Z63 A;  4R6A A;  2Z82 A;  3WPB A;  5B0T A;  4Z79 A;  3RW6 A;  5GQR K;  4GLP A;  3VQ2 A;  3BZ5 A;  5GS2 B;  3G3A A;  4CNM A;  4PKI G;  3W3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...