2JE0A

Crystal structure of pp32
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC LEUCINE-RICH NUCLEAR PHOSPHOPROTEIN 32 FAMILY MEMBER
publication title The Crystal Structure of the Tumor Suppressor Protein Pp32 (Anp32A): Structural Insights Into Anp32 Family of Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 47
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2je0A00
3E3ZA 3WPHA 4LXRA 4PERA 4QXEA 3W3MA 4RCAB 3WN4A 1G9UA 4ECNA 4R5DA 1DS9A 3WPCA 4GT6A 4CC4C 1K5GC 5AWCA 3P72A 2OMYA 1XWDC 2WFHA 4R6GA 3OGLB 4AW4A 1O6SA 3G39A 4Y61B 1FT8A 3C6NB 3UN9A 4Z8GA 4EZGA 5FTTB 4BSUA 3REZA 3RGZA 5A5CA 2O6RA 4NKGA 1XCDA 4BV4R 2ID5A 4LXSA 1KOHA 2XWTC 4Q3GA 4XOSA 4R6JA 2A0ZA 1IO0A 2V9SA 4LSCA 4V2DA 3E4GA 3RFEA 4V2CA 1LTXA 4R58A 4FS7A 2P1NB 2ASSB 3UL8A 4LSXC 4CP6A 1W8AA 4IM6A 3OGKB 3WPDA 3M19A 4FMZA 4PEQB 4MQWX 4H09A 4KNGA 4L3AA 4NKHA 2P1QB 1U0ND 3RIZA 1A4YA 1KOOA 2Q4GW 3RW6A 3M18A 3WPEA 3ZYNA 4ARRA 2OMXA 4CNMA 3ZYOA 2Z82A 2BEXA 4P8SA 2IFGA 1H6UA 3VQ1A 5IJDA 4G8AA 5IJBA 3WPFA 2Z62A 5B0NA 4B8CD 1FO1A 5AWBA 3RW7A 4C2AB 4CC4A 3A79B 3KJ4A 4MN8B 5GQRK 2FT3A 2UZYA 4U09A 1DCEA 4LI2A 4QBZA 3W3GA 2Z64A 1OTOA 1P8VA 4Z94G 2Z7XB 3OJAA 3UL9A 1M9SA 4GLPA 4KT1A 4I6JB 3CIYA 3PMHG 3W3KA 3W3LA 5D3IA 3SB4A 1WWLA 4FDWA 4Q3IA 2V9TB 1H6TA 2OMWA 2Z65A 4ARNA 1O6VA 2O6QA 3O53A 4M7EC 4Q62A 1FS2A 2WQUA 4R6AA 2RR6A 4ECOA 5AWDA 2WQWA 4LSXA 4U06A 4FHOA 1JL5A 5GMGA 2BNHA 3TSRE 4FCGA 4KXFB 3RFSA 1OTMA 3DZEA 4R07A 4J0MA 1A9NA 4HQ1A 2Z66A 3CVRA 3JB9j 3WPBA 4CNCA 4C2BB 4OQTA 1Z7XW 5GMHA 2CA6A 3OJAB 4AY9X 1M9LA 5IYXC 5B4PA 4FD0A 4L3FA 1K5DC 2OMVA 4YEBB 3W3JA 2P1MB 4U08A 1P9AG 2JE0A 3GOZA 4TZHA 2ELLA 1QYYA 2OMTA 5HDHA 3RFJA 2UZXA 5AWAA 1YRGA 1D0BA 4LI1A 4RWTC 2R9UA 1GWBA 4RCWA 1XEUA 2JQDA 4XSQA 4J4LA 3CIGA 3WPGA 1OOKG 2XOTA 1P8TA 2V70A 4WP6A 4XGOA 1OZNA 3ZYJA 2JE1A 3E2JA 1XECA 3BZ5A 4UFRA 5LFNA 2OMZA 4R09A 4CILA 3RGXA 1OGQA 1M0ZA 1PGVA 4R6FA 4LSAA 5GS2B 4V2EA 3FXIA 3VQ2A 1OTNA 5CMNA 3E6JA 3W3NA 4PSJA 3G04C 4M7EA 4P91A 2P1PB 4QC0A 2P1OB 3G3BA 1DFJI 5HZLB 4R5CA 5IJCA 4U7LA 2Y5QA 1O6TA 4PQ8A 1XKUA 5GMFA 4PKIG 5CMPA 1FQVA 2OMUA 3ZYIA 2O6SA 4R0AA 2WQXA 3G06A 4R08A 2WQVA 4Z79A 3C6OB 3ULVA 3C6PB 2ASTB 5B0TA 2Z7XA 3ULAA 4WYKA 1SQ0B 1ZIWA 2RA8A 4K17A 1M10B 3WPIA 5AZ5A 2Z81A 4Z64C 3UL7A 4Z61C 4BSSA 3G3AA 3RJ0A 3O6NA 5GS0A 4BSRA 2Z63A 3OGMB 3ULUA
chains in the Genus database with same CATH superfamily
3E3ZA 3WPHA 4LXRA 4PERA 4QXEA 3W3MA 4RCAB 3WN4A 1G9UA 4ECNA 4R5DA 1DS9A 3WPCA 4GT6A 4CC4C 1K5GC 5AWCA 3P72A 2OMYA 1XWDC 2WFHA 4R6GA 3OGLB 4AW4A 1O6SA 3G39A 4Y61B 1FT8A 3C6NB 3UN9A 4Z8GA 4EZGA 5FTTB 4BSUA 3REZA 3RGZA 5A5CA 2O6RA 4NKGA 1XCDA 4BV4R 2ID5A 4LXSA 1KOHA 2XWTC 4Q3GA 4XOSA 4R6JA 2A0ZA 1IO0A 2V9SA 4LSCA 4V2DA 3E4GA 3RFEA 4V2CA 1LTXA 4R58A 4FS7A 2P1NB 2ASSB 3UL8A 4LSXC 4CP6A 1W8AA 4IM6A 3OGKB 3WPDA 3M19A 4FMZA 4PEQB 4MQWX 4H09A 4KNGA 4L3AA 4NKHA 2P1QB 1U0ND 3RIZA 1A4YA 1KOOA 2Q4GW 3RW6A 3M18A 3WPEA 3ZYNA 4ARRA 2OMXA 4CNMA 3ZYOA 2Z82A 2BEXA 4P8SA 2IFGA 1H6UA 3VQ1A 5IJDA 4G8AA 5IJBA 3WPFA 2Z62A 5B0NA 4B8CD 1FO1A 5AWBA 3RW7A 4C2AB 4CC4A 3A79B 3KJ4A 4MN8B 5GQRK 2FT3A 2UZYA 4U09A 1DCEA 4LI2A 4QBZA 3W3GA 2Z64A 1OTOA 1P8VA 4Z94G 2Z7XB 3OJAA 3UL9A 1M9SA 4GLPA 4KT1A 4I6JB 3CIYA 3PMHG 3W3KA 3W3LA 5D3IA 3SB4A 1WWLA 4FDWA 4Q3IA 2V9TB 1H6TA 2OMWA 2Z65A 4ARNA 1O6VA 2O6QA 4NZRM 3O53A 4M7EC 4Q62A 1FS2A 2WQUA 4R6AA 2RR6A 4ECOA 5AWDA 2WQWA 4LSXA 4U06A 4FHOA 1JL5A 5GMGA 2BNHA 3TSRE 4FCGA 4KXFB 3RFSA 1OTMA 3DZEA 4R07A 4J0MA 1A9NA 4HQ1A 2Z66A 3CVRA 3JB9j 3WPBA 4CNCA 4C2BB 4OQTA 1Z7XW 5GMHA 2CA6A 3OJAB 4AY9X 1M9LA 5IYXC 5B4PA 4FD0A 4L3FA 1K5DC 2OMVA 4YEBB 3W3JA 2P1MB 4U08A 1P9AG 2JE0A 3GOZA 4TZHA 2ELLA 1QYYA 2OMTA 5HDHA 3RFJA 2UZXA 5AWAA 1YRGA 1D0BA 4LI1A 4RWTC 2R9UA 1GWBA 4RCWA 1XEUA 2JQDA 4XSQA 4J4LA 3CIGA 3WPGA 1OOKG 2XOTA 1P8TA 2V70A 4WP6A 4XGOA 1OZNA 3ZYJA 2JE1A 3E2JA 1XECA 3BZ5A 4UFRA 5LFNA 2OMZA 4R09A 4CILA 3RGXA 1OGQA 1M0ZA 1PGVA 4R6FA 4LSAA 5GS2B 4V2EA 3FXIA 3VQ2A 1OTNA 5CMNA 3E6JA 3W3NA 4PSJA 3G04C 4M7EA 4P91A 2P1PB 4QC0A 2P1OB 3G3BA 1DFJI 5HZLB 4R5CA 5IJCA 4U7LA 2Y5QA 1O6TA 4PQ8A 1XKUA 5GMFA 4PKIG 5CMPA 1FQVA 2OMUA 3ZYIA 2O6SA 4R0AA 2WQXA 3G06A 4R08A 2WQVA 4Z79A 3C6OB 3ULVA 3C6PB 2ASTB 5B0TA 2Z7XA 3ULAA 4NZTM 4WYKA 1SQ0B 1ZIWA 2RA8A 4K17A 1M10B 3WPIA 5AZ5A 2Z81A 4Z64C 3UL7A 4Z61C 4BSSA 3G3AA 3RJ0A 3O6NA 5GS0A 4BSRA 2Z63A 3OGMB 3ULUA
chains in the Genus database with same CATH topology
3E3ZA 3WPHA 4LXRA 4PERA 4QXEA 3W3MA 4RCAB 3WN4A 1G9UA 4ECNA 4R5DA 1DS9A 3WPCA 4GT6A 4CC4C 1K5GC 5AWCA 3P72A 2OMYA 1XWDC 2WFHA 4R6GA 3OGLB 4AW4A 1O6SA 3G39A 4Y61B 1FT8A 3C6NB 3UN9A 4Z8GA 4EZGA 5FTTB 4BSUA 3REZA 3RGZA 5A5CA 2O6RA 4NKGA 1XCDA 4BV4R 2ID5A 4LXSA 1KOHA 2XWTC 4Q3GA 4XOSA 4R6JA 2A0ZA 1IO0A 2V9SA 4LSCA 4V2DA 3E4GA 3RFEA 4V2CA 1LTXA 4R58A 4FS7A 2P1NB 2ASSB 3UL8A 4LSXC 4CP6A 1W8AA 4IM6A 3OGKB 3WPDA 3M19A 4FMZA 4PEQB 4MQWX 4H09A 4KNGA 4L3AA 4NKHA 2P1QB 1U0ND 3RIZA 1A4YA 1KOOA 2Q4GW 3RW6A 3M18A 3WPEA 3ZYNA 4ARRA 2OMXA 4CNMA 3ZYOA 2Z82A 2BEXA 4P8SA 2IFGA 1H6UA 3VQ1A 5IJDA 4G8AA 5IJBA 3WPFA 2Z62A 5B0NA 4B8CD 1FO1A 5AWBA 3RW7A 4C2AB 4CC4A 3A79B 3KJ4A 4MN8B 5GQRK 2FT3A 2UZYA 4U09A 1DCEA 4LI2A 4QBZA 3W3GA 2Z64A 1OTOA 1P8VA 4Z94G 2Z7XB 3OJAA 3UL9A 1M9SA 4GLPA 4KT1A 4I6JB 3CIYA 3PMHG 3W3KA 3W3LA 5D3IA 3SB4A 1WWLA 4FDWA 4Q3IA 2V9TB 1H6TA 2OMWA 2Z65A 4ARNA 1O6VA 2O6QA 3O53A 4M7EC 4Q62A 1FS2A 2WQUA 4R6AA 2RR6A 4ECOA 5AWDA 2WQWA 4LSXA 4U06A 4FHOA 1JL5A 5GMGA 2BNHA 3TSRE 4FCGA 4KXFB 3RFSA 1OTMA 3DZEA 4R07A 4J0MA 1A9NA 4HQ1A 2Z66A 3CVRA 3JB9j 3WPBA 4CNCA 4C2BB 4OQTA 1Z7XW 5GMHA 2CA6A 3OJAB 4AY9X 1M9LA 5IYXC 5B4PA 4FD0A 4L3FA 1K5DC 2OMVA 4YEBB 3W3JA 2P1MB 4U08A 1P9AG 2JE0A 3GOZA 4TZHA 2ELLA 1QYYA 2OMTA 5HDHA 3RFJA 2UZXA 5AWAA 1YRGA 1D0BA 4LI1A 4RWTC 2R9UA 1GWBA 4RCWA 1XEUA 2JQDA 4XSQA 4J4LA 3CIGA 3WPGA 1OOKG 2XOTA 1P8TA 2V70A 4WP6A 4XGOA 1OZNA 3ZYJA 2JE1A 3E2JA 1XECA 3BZ5A 4UFRA 5LFNA 2OMZA 4R09A 4CILA 3RGXA 1OGQA 1M0ZA 1PGVA 4R6FA 4LSAA 5GS2B 4V2EA 3FXIA 3VQ2A 1OTNA 5CMNA 3E6JA 3W3NA 4PSJA 3G04C 4M7EA 4P91A 2P1PB 4QC0A 2P1OB 3G3BA 1DFJI 5HZLB 4R5CA 5IJCA 4U7LA 2Y5QA 1O6TA 4PQ8A 1XKUA 5GMFA 4PKIG 5CMPA 1FQVA 2OMUA 3ZYIA 2O6SA 4R0AA 2WQXA 3G06A 4R08A 2WQVA 4Z79A 3C6OB 3ULVA 3C6PB 2ASTB 5B0TA 2Z7XA 3ULAA 4WYKA 1SQ0B 1ZIWA 2RA8A 4K17A 1M10B 3WPIA 5AZ5A 2Z81A 4Z64C 3UL7A 4Z61C 4BSSA 3G3AA 3RJ0A 3O6NA 5GS0A 4BSRA 2Z63A 3OGMB 3ULUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3Z A;  3WPH A;  4LXR A;  4PER A;  4QXE A;  3W3M A;  4RCA B;  3WN4 A;  1G9U A;  4ECN A;  4R5D A;  1DS9 A;  3WPC A;  4GT6 A;  4CC4 C;  1K5G C;  5AWC A;  3P72 A;  2OMY A;  1XWD C;  2WFH A;  4R6G A;  3OGL B;  4AW4 A;  1O6S A;  3G39 A;  4Y61 B;  1FT8 A;  3C6N B;  3UN9 A;  4Z8G A;  4EZG A;  5FTT B;  4BSU A;  3REZ A;  3RGZ A;  5A5C A;  2O6R A;  4NKG A;  1XCD A;  4BV4 R;  2ID5 A;  4LXS A;  1KOH A;  2XWT C;  4Q3G A;  4XOS A;  4R6J A;  2A0Z A;  1IO0 A;  2V9S A;  4LSC A;  4V2D A;  3E4G A;  3RFE A;  4V2C A;  1LTX A;  4R58 A;  4FS7 A;  2P1N B;  2ASS B;  3UL8 A;  4LSX C;  4CP6 A;  1W8A A;  4IM6 A;  3OGK B;  3WPD A;  3M19 A;  4FMZ A;  4PEQ B;  4MQW X;  4H09 A;  4KNG A;  4L3A A;  4NKH A;  2P1Q B;  1U0N D;  3RIZ A;  1A4Y A;  1KOO A;  2Q4G W;  3RW6 A;  3M18 A;  3WPE A;  3ZYN A;  4ARR A;  2OMX A;  4CNM A;  3ZYO A;  2Z82 A;  2BEX A;  4P8S A;  2IFG A;  1H6U A;  3VQ1 A;  5IJD A;  4G8A A;  5IJB A;  3WPF A;  2Z62 A;  5B0N A;  4B8C D;  1FO1 A;  5AWB A;  3RW7 A;  4C2A B;  4CC4 A;  3A79 B;  3KJ4 A;  4MN8 B;  5GQR K;  2FT3 A;  2UZY A;  4U09 A;  1DCE A;  4LI2 A;  4QBZ A;  3W3G A;  2Z64 A;  1OTO A;  1P8V A;  4Z94 G;  2Z7X B;  3OJA A;  3UL9 A;  1M9S A;  4GLP A;  4KT1 A;  4I6J B;  3CIY A;  3PMH G;  3W3K A;  3W3L A;  5D3I A;  3SB4 A;  1WWL A;  4FDW A;  4Q3I A;  2V9T B;  1H6T A;  2OMW A;  2Z65 A;  4ARN A;  1O6V A;  2O6Q A;  3O53 A;  4M7E C;  4Q62 A;  1FS2 A;  2WQU A;  4R6A A;  2RR6 A;  4ECO A;  5AWD A;  2WQW A;  4LSX A;  4U06 A;  4FHO A;  1JL5 A;  5GMG A;  2BNH A;  3TSR E;  4FCG A;  4KXF B;  3RFS A;  1OTM A;  3DZE A;  4R07 A;  4J0M A;  1A9N A;  4HQ1 A;  2Z66 A;  3CVR A;  3JB9 j;  3WPB A;  4CNC A;  4C2B B;  4OQT A;  1Z7X W;  5GMH A;  2CA6 A;  3OJA B;  4AY9 X;  1M9L A;  5IYX C;  5B4P A;  4FD0 A;  4L3F A;  1K5D C;  2OMV A;  4YEB B;  3W3J A;  2P1M B;  4U08 A;  1P9A G;  2JE0 A;  3GOZ A;  4TZH A;  2ELL A;  1QYY A;  2OMT A;  5HDH A;  3RFJ A;  2UZX A;  5AWA A;  1YRG A;  1D0B A;  4LI1 A;  4RWT C;  2R9U A;  1GWB A;  4RCW A;  1XEU A;  2JQD A;  4XSQ A;  4J4L A;  3CIG A;  3WPG A;  1OOK G;  2XOT A;  1P8T A;  2V70 A;  4WP6 A;  4XGO A;  1OZN A;  3ZYJ A;  2JE1 A;  3E2J A;  1XEC A;  3BZ5 A;  4UFR A;  5LFN A;  2OMZ A;  4R09 A;  4CIL A;  3RGX A;  1OGQ A;  1M0Z A;  1PGV A;  4R6F A;  4LSA A;  5GS2 B;  4V2E A;  3FXI A;  3VQ2 A;  1OTN A;  5CMN A;  3E6J A;  3W3N A;  4PSJ A;  3G04 C;  4M7E A;  4P91 A;  2P1P B;  4QC0 A;  2P1O B;  3G3B A;  1DFJ I;  5HZL B;  4R5C A;  5IJC A;  4U7L A;  2Y5Q A;  1O6T A;  4PQ8 A;  1XKU A;  5GMF A;  4PKI G;  5CMP A;  1FQV A;  2OMU A;  3ZYI A;  2O6S A;  4R0A A;  2WQX A;  3G06 A;  4R08 A;  2WQV A;  4Z79 A;  3C6O B;  3ULV A;  3C6P B;  2AST B;  5B0T A;  2Z7X A;  3ULA A;  4WYK A;  1SQ0 B;  1ZIW A;  2RA8 A;  4K17 A;  1M10 B;  3WPI A;  5AZ5 A;  2Z81 A;  4Z64 C;  3UL7 A;  4Z61 C;  4BSS A;  3G3A A;  3RJ0 A;  3O6N A;  5GS0 A;  4BSR A;  2Z63 A;  3OGM B;  3ULU A; 
#chains in the Genus database with same CATH topology
 3E3Z A;  3WPH A;  4LXR A;  4PER A;  4QXE A;  3W3M A;  4RCA B;  3WN4 A;  1G9U A;  4ECN A;  4R5D A;  1DS9 A;  3WPC A;  4GT6 A;  4CC4 C;  1K5G C;  5AWC A;  3P72 A;  2OMY A;  1XWD C;  2WFH A;  4R6G A;  3OGL B;  4AW4 A;  1O6S A;  3G39 A;  4Y61 B;  1FT8 A;  3C6N B;  3UN9 A;  4Z8G A;  4EZG A;  5FTT B;  4BSU A;  3REZ A;  3RGZ A;  5A5C A;  2O6R A;  4NKG A;  1XCD A;  4BV4 R;  2ID5 A;  4LXS A;  1KOH A;  2XWT C;  4Q3G A;  4XOS A;  4R6J A;  2A0Z A;  1IO0 A;  2V9S A;  4LSC A;  4V2D A;  3E4G A;  3RFE A;  4V2C A;  1LTX A;  4R58 A;  4FS7 A;  2P1N B;  2ASS B;  3UL8 A;  4LSX C;  4CP6 A;  1W8A A;  4IM6 A;  3OGK B;  3WPD A;  3M19 A;  4FMZ A;  4PEQ B;  4MQW X;  4H09 A;  4KNG A;  4L3A A;  4NKH A;  2P1Q B;  1U0N D;  3RIZ A;  1A4Y A;  1KOO A;  2Q4G W;  3RW6 A;  3M18 A;  3WPE A;  3ZYN A;  4ARR A;  2OMX A;  4CNM A;  3ZYO A;  2Z82 A;  2BEX A;  4P8S A;  2IFG A;  1H6U A;  3VQ1 A;  5IJD A;  4G8A A;  5IJB A;  3WPF A;  2Z62 A;  5B0N A;  4B8C D;  1FO1 A;  5AWB A;  3RW7 A;  4C2A B;  4CC4 A;  3A79 B;  3KJ4 A;  4MN8 B;  5GQR K;  2FT3 A;  2UZY A;  4U09 A;  1DCE A;  4LI2 A;  4QBZ A;  3W3G A;  2Z64 A;  1OTO A;  1P8V A;  4Z94 G;  2Z7X B;  3OJA A;  3UL9 A;  1M9S A;  4GLP A;  4KT1 A;  4I6J B;  3CIY A;  3PMH G;  3W3K A;  3W3L A;  5D3I A;  3SB4 A;  1WWL A;  4FDW A;  4Q3I A;  2V9T B;  1H6T A;  2OMW A;  2Z65 A;  4ARN A;  1O6V A;  2O6Q A;  4NZR M;  3O53 A;  4M7E C;  4Q62 A;  1FS2 A;  2WQU A;  4R6A A;  2RR6 A;  4ECO A;  5AWD A;  2WQW A;  4LSX A;  4U06 A;  4FHO A;  1JL5 A;  5GMG A;  2BNH A;  3TSR E;  4FCG A;  4KXF B;  3RFS A;  1OTM A;  3DZE A;  4R07 A;  4J0M A;  1A9N A;  4HQ1 A;  2Z66 A;  3CVR A;  3JB9 j;  3WPB A;  4CNC A;  4C2B B;  4OQT A;  1Z7X W;  5GMH A;  2CA6 A;  3OJA B;  4AY9 X;  1M9L A;  5IYX C;  5B4P A;  4FD0 A;  4L3F A;  1K5D C;  2OMV A;  4YEB B;  3W3J A;  2P1M B;  4U08 A;  1P9A G;  2JE0 A;  3GOZ A;  4TZH A;  2ELL A;  1QYY A;  2OMT A;  5HDH A;  3RFJ A;  2UZX A;  5AWA A;  1YRG A;  1D0B A;  4LI1 A;  4RWT C;  2R9U A;  1GWB A;  4RCW A;  1XEU A;  2JQD A;  4XSQ A;  4J4L A;  3CIG A;  3WPG A;  1OOK G;  2XOT A;  1P8T A;  2V70 A;  4WP6 A;  4XGO A;  1OZN A;  3ZYJ A;  2JE1 A;  3E2J A;  1XEC A;  3BZ5 A;  4UFR A;  5LFN A;  2OMZ A;  4R09 A;  4CIL A;  3RGX A;  1OGQ A;  1M0Z A;  1PGV A;  4R6F A;  4LSA A;  5GS2 B;  4V2E A;  3FXI A;  3VQ2 A;  1OTN A;  5CMN A;  3E6J A;  3W3N A;  4PSJ A;  3G04 C;  4M7E A;  4P91 A;  2P1P B;  4QC0 A;  2P1O B;  3G3B A;  1DFJ I;  5HZL B;  4R5C A;  5IJC A;  4U7L A;  2Y5Q A;  1O6T A;  4PQ8 A;  1XKU A;  5GMF A;  4PKI G;  5CMP A;  1FQV A;  2OMU A;  3ZYI A;  2O6S A;  4R0A A;  2WQX A;  3G06 A;  4R08 A;  2WQV A;  4Z79 A;  3C6O B;  3ULV A;  3C6P B;  2AST B;  5B0T A;  2Z7X A;  3ULA A;  4NZT M;  4WYK A;  1SQ0 B;  1ZIW A;  2RA8 A;  4K17 A;  1M10 B;  3WPI A;  5AZ5 A;  2Z81 A;  4Z64 C;  3UL7 A;  4Z61 C;  4BSS A;  3G3A A;  3RJ0 A;  3O6N A;  5GS0 A;  4BSR A;  2Z63 A;  3OGM B;  3ULU A; 
#chains in the Genus database with same CATH homology
 3E3Z A;  3WPH A;  4LXR A;  4PER A;  4QXE A;  3W3M A;  4RCA B;  3WN4 A;  1G9U A;  4ECN A;  4R5D A;  1DS9 A;  3WPC A;  4GT6 A;  4CC4 C;  1K5G C;  5AWC A;  3P72 A;  2OMY A;  1XWD C;  2WFH A;  4R6G A;  3OGL B;  4AW4 A;  1O6S A;  3G39 A;  4Y61 B;  1FT8 A;  3C6N B;  3UN9 A;  4Z8G A;  4EZG A;  5FTT B;  4BSU A;  3REZ A;  3RGZ A;  5A5C A;  2O6R A;  4NKG A;  1XCD A;  4BV4 R;  2ID5 A;  4LXS A;  1KOH A;  2XWT C;  4Q3G A;  4XOS A;  4R6J A;  2A0Z A;  1IO0 A;  2V9S A;  4LSC A;  4V2D A;  3E4G A;  3RFE A;  4V2C A;  1LTX A;  4R58 A;  4FS7 A;  2P1N B;  2ASS B;  3UL8 A;  4LSX C;  4CP6 A;  1W8A A;  4IM6 A;  3OGK B;  3WPD A;  3M19 A;  4FMZ A;  4PEQ B;  4MQW X;  4H09 A;  4KNG A;  4L3A A;  4NKH A;  2P1Q B;  1U0N D;  3RIZ A;  1A4Y A;  1KOO A;  2Q4G W;  3RW6 A;  3M18 A;  3WPE A;  3ZYN A;  4ARR A;  2OMX A;  4CNM A;  3ZYO A;  2Z82 A;  2BEX A;  4P8S A;  2IFG A;  1H6U A;  3VQ1 A;  5IJD A;  4G8A A;  5IJB A;  3WPF A;  2Z62 A;  5B0N A;  4B8C D;  1FO1 A;  5AWB A;  3RW7 A;  4C2A B;  4CC4 A;  3A79 B;  3KJ4 A;  4MN8 B;  5GQR K;  2FT3 A;  2UZY A;  4U09 A;  1DCE A;  4LI2 A;  4QBZ A;  3W3G A;  2Z64 A;  1OTO A;  1P8V A;  4Z94 G;  2Z7X B;  3OJA A;  3UL9 A;  1M9S A;  4GLP A;  4KT1 A;  4I6J B;  3CIY A;  3PMH G;  3W3K A;  3W3L A;  5D3I A;  3SB4 A;  1WWL A;  4FDW A;  4Q3I A;  2V9T B;  1H6T A;  2OMW A;  2Z65 A;  4ARN A;  1O6V A;  2O6Q A;  3O53 A;  4M7E C;  4Q62 A;  1FS2 A;  2WQU A;  4R6A A;  2RR6 A;  4ECO A;  5AWD A;  2WQW A;  4LSX A;  4U06 A;  4FHO A;  1JL5 A;  5GMG A;  2BNH A;  3TSR E;  4FCG A;  4KXF B;  3RFS A;  1OTM A;  3DZE A;  4R07 A;  4J0M A;  1A9N A;  4HQ1 A;  2Z66 A;  3CVR A;  3JB9 j;  3WPB A;  4CNC A;  4C2B B;  4OQT A;  1Z7X W;  5GMH A;  2CA6 A;  3OJA B;  4AY9 X;  1M9L A;  5IYX C;  5B4P A;  4FD0 A;  4L3F A;  1K5D C;  2OMV A;  4YEB B;  3W3J A;  2P1M B;  4U08 A;  1P9A G;  2JE0 A;  3GOZ A;  4TZH A;  2ELL A;  1QYY A;  2OMT A;  5HDH A;  3RFJ A;  2UZX A;  5AWA A;  1YRG A;  1D0B A;  4LI1 A;  4RWT C;  2R9U A;  1GWB A;  4RCW A;  1XEU A;  2JQD A;  4XSQ A;  4J4L A;  3CIG A;  3WPG A;  1OOK G;  2XOT A;  1P8T A;  2V70 A;  4WP6 A;  4XGO A;  1OZN A;  3ZYJ A;  2JE1 A;  3E2J A;  1XEC A;  3BZ5 A;  4UFR A;  5LFN A;  2OMZ A;  4R09 A;  4CIL A;  3RGX A;  1OGQ A;  1M0Z A;  1PGV A;  4R6F A;  4LSA A;  5GS2 B;  4V2E A;  3FXI A;  3VQ2 A;  1OTN A;  5CMN A;  3E6J A;  3W3N A;  4PSJ A;  3G04 C;  4M7E A;  4P91 A;  2P1P B;  4QC0 A;  2P1O B;  3G3B A;  1DFJ I;  5HZL B;  4R5C A;  5IJC A;  4U7L A;  2Y5Q A;  1O6T A;  4PQ8 A;  1XKU A;  5GMF A;  4PKI G;  5CMP A;  1FQV A;  2OMU A;  3ZYI A;  2O6S A;  4R0A A;  2WQX A;  3G06 A;  4R08 A;  2WQV A;  4Z79 A;  3C6O B;  3ULV A;  3C6P B;  2AST B;  5B0T A;  2Z7X A;  3ULA A;  4WYK A;  1SQ0 B;  1ZIW A;  2RA8 A;  4K17 A;  1M10 B;  3WPI A;  5AZ5 A;  2Z81 A;  4Z64 C;  3UL7 A;  4Z61 C;  4BSS A;  3G3A A;  3RJ0 A;  3O6N A;  5GS0 A;  4BSR A;  2Z63 A;  3OGM B;  3ULU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...