2JE0A

Crystal structure of pp32
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords ACIDIC LEUCINE-RICH NUCLEAR PHOSPHOPROTEIN 32 FAMILY MEMBER
publication title The Crystal Structure of the Tumor Suppressor Protein Pp32 (Anp32A): Structural Insights Into Anp32 Family of Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2je0A00
4C2AB 3SB4A 4R6FA 3UN9A 4CNCA 2IFGA 4EZGA 1P8VA 4J4LA 4NKHA 3KJ4A 4L3FA 2CA6A 4PQ8A 1K5GC 4P8SA 2V9SA 1DS9A 2Z7XA 3WPEA 3ZYJA 3ULAA 2Z64A 5B4PA 4PEQB 1OTNA 4R09A 4LSAA 4WP6A 4UFRA 5CMPA 3PMHG 1OTOA 2WQUA 3WPHA 4CNMA 4QXEA 2RA8A 4R07A 4R08A 3M19A 4J0MA 4ARNA 4ECOA 1IO0A 5HDHA 2UZYA 1GWBA 3E4GA 1O6SA 2WFHA 4Z64C 3RFEA 4LXRA 3WPDA 3RW6A 1SQ0B 4BSRA 4XOSA 2Q4GW 3G04C 4M7EA 3OGKB 4R58A 4AY9X 4Z61C 3A79B 3WPIA 2P1MB 4LSXC 3ZYNA 2Z63A 4BV4R 3CVRA 2XWTC 4BSUA 3G39A 4HQ1A 2OMTA 2O6QA 5A5CA 3TSRE 1K5DC 5IYXC 1QYYA 4V2DA 3RGZA 3BZ5A 5LFNA 2P1QB 1OTMA 4QBZA 1P9AG 2OMUA 2XOTA 1M0ZA 4FDWA 2A0ZA 4G8AA 4ECNA 2Z7XB 4RWTC 2Z81A 2ELLA 1OOKG 4R0AA 2BNHA 2Z66A 3OGMB 4PERA 4FHOA 1G9UA 5B0NA 5IJCA 4RCWA 4MN8B 1DCEA 3OJAA 4Q3IA 3UL9A 4B8CD 4FD0A 2Z65A 4FS7A 4KNGA 3W3JA 1M9SA 1P8TA 4V2CA 4BSSA 4LI1A 3CIGA 1FS2A 3RFJA 4OQTA 3W3GA 3WN4A 5GQRK 4C2BB 1W8AA 4Z79A 2OMVA 2O6SA 4KXFB 4M7EC 5CMNA 4LXSA 5GMGA 1Z7XW 4WYKA 1XKUA 3REZA 4CC4C 2JE0A 4GT6A 1XWDC 5IJBA 4CC4A 1JL5A 4Y61B 3GOZA 4TZHA 1KOHA 2Z62A 4Q3GA 3O53A 2JQDA 5GMFA 2ASTB 1LTXA 5GS2B 2V70A 4QC0A 3WPCA 2OMWA 4R6GA 4U08A 4ARRA 2P1NB 3G3AA 4CP6A 1FO1A 3ZYIA 5B0TA 3O6NA 1OGQA 5GS0A 3RW7A 1OZNA 3VQ1A 2OMYA 3ULVA 2OMXA 4Z8GA 2ASSB 1XEUA 3VQ2A 2V9TB 4PSJA 4RCAB 3RJ0A 1DFJI 4LI2A 3G06A 3DZEA 1O6TA 3P72A 1D0BA 3UL8A 3E3ZA 5D3IA 4P91A 1XECA 5AZ5A 1M9LA 4FMZA 3W3KA 4GLPA 3JB9j 3OJAB 3RFSA 1FQVA 3C6NB 4R6JA 3OGLB 1ZIWA 3C6PB 3E2JA 1A4YA 5AWAA 2WQXA 4U06A 4YEBB 3WPFA 1KOOA 3W3MA 5HZLB 3RGXA 4Z94G 3WPBA 4IM6A 2JE1A 4R5DA 3E6JA 2WQWA 4KT1A 2WQVA 1WWLA 4FCGA 5AWCA 4K17A 1YRGA 1PGVA 3ZYOA 4R6AA 1H6UA 4XGOA 2UZXA 1XCDA 1H6TA 5AWDA 4U09A 3W3NA 4R5CA 2FT3A 4I6JB 2Z82A 3M18A 4NKGA 4PKIG 2BEXA 4CILA 4MQWX 1M10B 3C6OB 3WPGA 3RIZA 5FTTB 2ID5A 3ULUA 2OMZA 4LSCA 4AW4A 4L3AA 4XSQA 1A9NA 2O6RA 3W3LA 4Q62A 2P1OB 3UL7A 2Y5QA 2P1PB 2RR6A 1O6VA 3G3BA 4LSXA 4V2EA 3CIYA 5IJDA 5GMHA 5AWBA 1FT8A 1U0ND 4H09A 3FXIA 4U7LA 2R9UA
chains in the Genus database with same CATH superfamily
4C2AB 3SB4A 4R6FA 3UN9A 4CNCA 2IFGA 4EZGA 1P8VA 4J4LA 4NKHA 3KJ4A 4L3FA 2CA6A 4PQ8A 1K5GC 4P8SA 2V9SA 1DS9A 2Z7XA 3WPEA 3ZYJA 3ULAA 2Z64A 5B4PA 4PEQB 1OTNA 4R09A 4LSAA 4WP6A 4UFRA 5CMPA 3PMHG 1OTOA 2WQUA 3WPHA 4CNMA 4QXEA 2RA8A 4R07A 4R08A 3M19A 4J0MA 4ARNA 4ECOA 1IO0A 5HDHA 2UZYA 1GWBA 3E4GA 1O6SA 2WFHA 4Z64C 3RFEA 4LXRA 3WPDA 3RW6A 1SQ0B 4BSRA 4XOSA 2Q4GW 3G04C 4M7EA 3OGKB 4R58A 4AY9X 4Z61C 3A79B 3WPIA 2P1MB 4LSXC 3ZYNA 2Z63A 4BV4R 3CVRA 2XWTC 4BSUA 3G39A 4HQ1A 2OMTA 2O6QA 5A5CA 3TSRE 1K5DC 5IYXC 1QYYA 4V2DA 3RGZA 3BZ5A 5LFNA 2P1QB 1OTMA 4QBZA 1P9AG 2OMUA 2XOTA 1M0ZA 4FDWA 2A0ZA 4G8AA 4ECNA 2Z7XB 4RWTC 2Z81A 2ELLA 1OOKG 4R0AA 4NZTM 2BNHA 2Z66A 3OGMB 4PERA 4FHOA 1G9UA 5B0NA 5IJCA 4RCWA 4MN8B 1DCEA 3OJAA 4Q3IA 3UL9A 4B8CD 4FD0A 2Z65A 4FS7A 4KNGA 3W3JA 1M9SA 1P8TA 4V2CA 4BSSA 4LI1A 3CIGA 1FS2A 3RFJA 4OQTA 3W3GA 3WN4A 5GQRK 4C2BB 1W8AA 4Z79A 2OMVA 2O6SA 4KXFB 4M7EC 5CMNA 4LXSA 5GMGA 1Z7XW 4WYKA 1XKUA 3REZA 4CC4C 2JE0A 4GT6A 1XWDC 5IJBA 4CC4A 1JL5A 4Y61B 3GOZA 4TZHA 1KOHA 2Z62A 4Q3GA 3O53A 2JQDA 5GMFA 2ASTB 1LTXA 5GS2B 2V70A 4QC0A 3WPCA 2OMWA 4R6GA 4U08A 4ARRA 2P1NB 3G3AA 4CP6A 1FO1A 3ZYIA 5B0TA 3O6NA 1OGQA 5GS0A 3RW7A 1OZNA 3VQ1A 2OMYA 3ULVA 2OMXA 4Z8GA 2ASSB 1XEUA 3VQ2A 2V9TB 4PSJA 4RCAB 3RJ0A 1DFJI 4LI2A 3G06A 3DZEA 1O6TA 3P72A 1D0BA 3UL8A 3E3ZA 5D3IA 4P91A 1XECA 5AZ5A 1M9LA 4FMZA 3W3KA 4GLPA 3JB9j 3OJAB 3RFSA 1FQVA 3C6NB 4R6JA 3OGLB 1ZIWA 3C6PB 3E2JA 1A4YA 5AWAA 2WQXA 4U06A 4YEBB 3WPFA 1KOOA 3W3MA 5HZLB 3RGXA 4Z94G 3WPBA 4IM6A 2JE1A 4R5DA 3E6JA 2WQWA 4KT1A 2WQVA 1WWLA 4FCGA 5AWCA 4K17A 1YRGA 1PGVA 3ZYOA 4R6AA 1H6UA 4XGOA 2UZXA 1XCDA 1H6TA 5AWDA 4U09A 3W3NA 4R5CA 2FT3A 4I6JB 2Z82A 3M18A 4NKGA 4PKIG 2BEXA 4NZRM 4CILA 4MQWX 1M10B 3C6OB 3WPGA 3RIZA 5FTTB 2ID5A 3ULUA 2OMZA 4LSCA 4AW4A 4L3AA 4XSQA 1A9NA 2O6RA 3W3LA 4Q62A 2P1OB 3UL7A 2Y5QA 2P1PB 2RR6A 1O6VA 3G3BA 4LSXA 4V2EA 3CIYA 5IJDA 5GMHA 5AWBA 1FT8A 1U0ND 4H09A 3FXIA 4U7LA 2R9UA
chains in the Genus database with same CATH topology
4C2AB 3SB4A 4R6FA 3UN9A 4CNCA 2IFGA 4EZGA 1P8VA 4J4LA 4NKHA 3KJ4A 4L3FA 2CA6A 4PQ8A 1K5GC 4P8SA 2V9SA 1DS9A 2Z7XA 3WPEA 3ZYJA 3ULAA 2Z64A 5B4PA 4PEQB 1OTNA 4R09A 4LSAA 4WP6A 4UFRA 5CMPA 3PMHG 1OTOA 2WQUA 3WPHA 4CNMA 4QXEA 2RA8A 4R07A 4R08A 3M19A 4J0MA 4ARNA 4ECOA 1IO0A 5HDHA 2UZYA 1GWBA 3E4GA 1O6SA 2WFHA 4Z64C 3RFEA 4LXRA 3WPDA 3RW6A 1SQ0B 4BSRA 4XOSA 2Q4GW 3G04C 4M7EA 3OGKB 4R58A 4AY9X 4Z61C 3A79B 3WPIA 2P1MB 4LSXC 3ZYNA 2Z63A 4BV4R 3CVRA 2XWTC 4BSUA 3G39A 4HQ1A 2OMTA 2O6QA 5A5CA 3TSRE 1K5DC 5IYXC 1QYYA 4V2DA 3RGZA 3BZ5A 5LFNA 2P1QB 1OTMA 4QBZA 1P9AG 2OMUA 2XOTA 1M0ZA 4FDWA 2A0ZA 4G8AA 4ECNA 2Z7XB 4RWTC 2Z81A 2ELLA 1OOKG 4R0AA 2BNHA 2Z66A 3OGMB 4PERA 4FHOA 1G9UA 5B0NA 5IJCA 4RCWA 4MN8B 1DCEA 3OJAA 4Q3IA 3UL9A 4B8CD 4FD0A 2Z65A 4FS7A 4KNGA 3W3JA 1M9SA 1P8TA 4V2CA 4BSSA 4LI1A 3CIGA 1FS2A 3RFJA 4OQTA 3W3GA 3WN4A 5GQRK 4C2BB 1W8AA 4Z79A 2OMVA 2O6SA 4KXFB 4M7EC 5CMNA 4LXSA 5GMGA 1Z7XW 4WYKA 1XKUA 3REZA 4CC4C 2JE0A 4GT6A 1XWDC 5IJBA 4CC4A 1JL5A 4Y61B 3GOZA 4TZHA 1KOHA 2Z62A 4Q3GA 3O53A 2JQDA 5GMFA 2ASTB 1LTXA 5GS2B 2V70A 4QC0A 3WPCA 2OMWA 4R6GA 4U08A 4ARRA 2P1NB 3G3AA 4CP6A 1FO1A 3ZYIA 5B0TA 3O6NA 1OGQA 5GS0A 3RW7A 1OZNA 3VQ1A 2OMYA 3ULVA 2OMXA 4Z8GA 2ASSB 1XEUA 3VQ2A 2V9TB 4PSJA 4RCAB 3RJ0A 1DFJI 4LI2A 3G06A 3DZEA 1O6TA 3P72A 1D0BA 3UL8A 3E3ZA 5D3IA 4P91A 1XECA 5AZ5A 1M9LA 4FMZA 3W3KA 4GLPA 3JB9j 3OJAB 3RFSA 1FQVA 3C6NB 4R6JA 3OGLB 1ZIWA 3C6PB 3E2JA 1A4YA 5AWAA 2WQXA 4U06A 4YEBB 3WPFA 1KOOA 3W3MA 5HZLB 3RGXA 4Z94G 3WPBA 4IM6A 2JE1A 4R5DA 3E6JA 2WQWA 4KT1A 2WQVA 1WWLA 4FCGA 5AWCA 4K17A 1YRGA 1PGVA 3ZYOA 4R6AA 1H6UA 4XGOA 2UZXA 1XCDA 1H6TA 5AWDA 4U09A 3W3NA 4R5CA 2FT3A 4I6JB 2Z82A 3M18A 4NKGA 4PKIG 2BEXA 4CILA 4MQWX 1M10B 3C6OB 3WPGA 3RIZA 5FTTB 2ID5A 3ULUA 2OMZA 4LSCA 4AW4A 4L3AA 4XSQA 1A9NA 2O6RA 3W3LA 4Q62A 2P1OB 3UL7A 2Y5QA 2P1PB 2RR6A 1O6VA 3G3BA 4LSXA 4V2EA 3CIYA 5IJDA 5GMHA 5AWBA 1FT8A 1U0ND 4H09A 3FXIA 4U7LA 2R9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2A B;  3SB4 A;  4R6F A;  3UN9 A;  4CNC A;  2IFG A;  4EZG A;  1P8V A;  4J4L A;  4NKH A;  3KJ4 A;  4L3F A;  2CA6 A;  4PQ8 A;  1K5G C;  4P8S A;  2V9S A;  1DS9 A;  2Z7X A;  3WPE A;  3ZYJ A;  3ULA A;  2Z64 A;  5B4P A;  4PEQ B;  1OTN A;  4R09 A;  4LSA A;  4WP6 A;  4UFR A;  5CMP A;  3PMH G;  1OTO A;  2WQU A;  3WPH A;  4CNM A;  4QXE A;  2RA8 A;  4R07 A;  4R08 A;  3M19 A;  4J0M A;  4ARN A;  4ECO A;  1IO0 A;  5HDH A;  2UZY A;  1GWB A;  3E4G A;  1O6S A;  2WFH A;  4Z64 C;  3RFE A;  4LXR A;  3WPD A;  3RW6 A;  1SQ0 B;  4BSR A;  4XOS A;  2Q4G W;  3G04 C;  4M7E A;  3OGK B;  4R58 A;  4AY9 X;  4Z61 C;  3A79 B;  3WPI A;  2P1M B;  4LSX C;  3ZYN A;  2Z63 A;  4BV4 R;  3CVR A;  2XWT C;  4BSU A;  3G39 A;  4HQ1 A;  2OMT A;  2O6Q A;  5A5C A;  3TSR E;  1K5D C;  5IYX C;  1QYY A;  4V2D A;  3RGZ A;  3BZ5 A;  5LFN A;  2P1Q B;  1OTM A;  4QBZ A;  1P9A G;  2OMU A;  2XOT A;  1M0Z A;  4FDW A;  2A0Z A;  4G8A A;  4ECN A;  2Z7X B;  4RWT C;  2Z81 A;  2ELL A;  1OOK G;  4R0A A;  2BNH A;  2Z66 A;  3OGM B;  4PER A;  4FHO A;  1G9U A;  5B0N A;  5IJC A;  4RCW A;  4MN8 B;  1DCE A;  3OJA A;  4Q3I A;  3UL9 A;  4B8C D;  4FD0 A;  2Z65 A;  4FS7 A;  4KNG A;  3W3J A;  1M9S A;  1P8T A;  4V2C A;  4BSS A;  4LI1 A;  3CIG A;  1FS2 A;  3RFJ A;  4OQT A;  3W3G A;  3WN4 A;  5GQR K;  4C2B B;  1W8A A;  4Z79 A;  2OMV A;  2O6S A;  4KXF B;  4M7E C;  5CMN A;  4LXS A;  5GMG A;  1Z7X W;  4WYK A;  1XKU A;  3REZ A;  4CC4 C;  2JE0 A;  4GT6 A;  1XWD C;  5IJB A;  4CC4 A;  1JL5 A;  4Y61 B;  3GOZ A;  4TZH A;  1KOH A;  2Z62 A;  4Q3G A;  3O53 A;  2JQD A;  5GMF A;  2AST B;  1LTX A;  5GS2 B;  2V70 A;  4QC0 A;  3WPC A;  2OMW A;  4R6G A;  4U08 A;  4ARR A;  2P1N B;  3G3A A;  4CP6 A;  1FO1 A;  3ZYI A;  5B0T A;  3O6N A;  1OGQ A;  5GS0 A;  3RW7 A;  1OZN A;  3VQ1 A;  2OMY A;  3ULV A;  2OMX A;  4Z8G A;  2ASS B;  1XEU A;  3VQ2 A;  2V9T B;  4PSJ A;  4RCA B;  3RJ0 A;  1DFJ I;  4LI2 A;  3G06 A;  3DZE A;  1O6T A;  3P72 A;  1D0B A;  3UL8 A;  3E3Z A;  5D3I A;  4P91 A;  1XEC A;  5AZ5 A;  1M9L A;  4FMZ A;  3W3K A;  4GLP A;  3JB9 j;  3OJA B;  3RFS A;  1FQV A;  3C6N B;  4R6J A;  3OGL B;  1ZIW A;  3C6P B;  3E2J A;  1A4Y A;  5AWA A;  2WQX A;  4U06 A;  4YEB B;  3WPF A;  1KOO A;  3W3M A;  5HZL B;  3RGX A;  4Z94 G;  3WPB A;  4IM6 A;  2JE1 A;  4R5D A;  3E6J A;  2WQW A;  4KT1 A;  2WQV A;  1WWL A;  4FCG A;  5AWC A;  4K17 A;  1YRG A;  1PGV A;  3ZYO A;  4R6A A;  1H6U A;  4XGO A;  2UZX A;  1XCD A;  1H6T A;  5AWD A;  4U09 A;  3W3N A;  4R5C A;  2FT3 A;  4I6J B;  2Z82 A;  3M18 A;  4NKG A;  4PKI G;  2BEX A;  4CIL A;  4MQW X;  1M10 B;  3C6O B;  3WPG A;  3RIZ A;  5FTT B;  2ID5 A;  3ULU A;  2OMZ A;  4LSC A;  4AW4 A;  4L3A A;  4XSQ A;  1A9N A;  2O6R A;  3W3L A;  4Q62 A;  2P1O B;  3UL7 A;  2Y5Q A;  2P1P B;  2RR6 A;  1O6V A;  3G3B A;  4LSX A;  4V2E A;  3CIY A;  5IJD A;  5GMH A;  5AWB A;  1FT8 A;  1U0N D;  4H09 A;  3FXI A;  4U7L A;  2R9U A; 
#chains in the Genus database with same CATH topology
 4C2A B;  3SB4 A;  4R6F A;  3UN9 A;  4CNC A;  2IFG A;  4EZG A;  1P8V A;  4J4L A;  4NKH A;  3KJ4 A;  4L3F A;  2CA6 A;  4PQ8 A;  1K5G C;  4P8S A;  2V9S A;  1DS9 A;  2Z7X A;  3WPE A;  3ZYJ A;  3ULA A;  2Z64 A;  5B4P A;  4PEQ B;  1OTN A;  4R09 A;  4LSA A;  4WP6 A;  4UFR A;  5CMP A;  3PMH G;  1OTO A;  2WQU A;  3WPH A;  4CNM A;  4QXE A;  2RA8 A;  4R07 A;  4R08 A;  3M19 A;  4J0M A;  4ARN A;  4ECO A;  1IO0 A;  5HDH A;  2UZY A;  1GWB A;  3E4G A;  1O6S A;  2WFH A;  4Z64 C;  3RFE A;  4LXR A;  3WPD A;  3RW6 A;  1SQ0 B;  4BSR A;  4XOS A;  2Q4G W;  3G04 C;  4M7E A;  3OGK B;  4R58 A;  4AY9 X;  4Z61 C;  3A79 B;  3WPI A;  2P1M B;  4LSX C;  3ZYN A;  2Z63 A;  4BV4 R;  3CVR A;  2XWT C;  4BSU A;  3G39 A;  4HQ1 A;  2OMT A;  2O6Q A;  5A5C A;  3TSR E;  1K5D C;  5IYX C;  1QYY A;  4V2D A;  3RGZ A;  3BZ5 A;  5LFN A;  2P1Q B;  1OTM A;  4QBZ A;  1P9A G;  2OMU A;  2XOT A;  1M0Z A;  4FDW A;  2A0Z A;  4G8A A;  4ECN A;  2Z7X B;  4RWT C;  2Z81 A;  2ELL A;  1OOK G;  4R0A A;  4NZT M;  2BNH A;  2Z66 A;  3OGM B;  4PER A;  4FHO A;  1G9U A;  5B0N A;  5IJC A;  4RCW A;  4MN8 B;  1DCE A;  3OJA A;  4Q3I A;  3UL9 A;  4B8C D;  4FD0 A;  2Z65 A;  4FS7 A;  4KNG A;  3W3J A;  1M9S A;  1P8T A;  4V2C A;  4BSS A;  4LI1 A;  3CIG A;  1FS2 A;  3RFJ A;  4OQT A;  3W3G A;  3WN4 A;  5GQR K;  4C2B B;  1W8A A;  4Z79 A;  2OMV A;  2O6S A;  4KXF B;  4M7E C;  5CMN A;  4LXS A;  5GMG A;  1Z7X W;  4WYK A;  1XKU A;  3REZ A;  4CC4 C;  2JE0 A;  4GT6 A;  1XWD C;  5IJB A;  4CC4 A;  1JL5 A;  4Y61 B;  3GOZ A;  4TZH A;  1KOH A;  2Z62 A;  4Q3G A;  3O53 A;  2JQD A;  5GMF A;  2AST B;  1LTX A;  5GS2 B;  2V70 A;  4QC0 A;  3WPC A;  2OMW A;  4R6G A;  4U08 A;  4ARR A;  2P1N B;  3G3A A;  4CP6 A;  1FO1 A;  3ZYI A;  5B0T A;  3O6N A;  1OGQ A;  5GS0 A;  3RW7 A;  1OZN A;  3VQ1 A;  2OMY A;  3ULV A;  2OMX A;  4Z8G A;  2ASS B;  1XEU A;  3VQ2 A;  2V9T B;  4PSJ A;  4RCA B;  3RJ0 A;  1DFJ I;  4LI2 A;  3G06 A;  3DZE A;  1O6T A;  3P72 A;  1D0B A;  3UL8 A;  3E3Z A;  5D3I A;  4P91 A;  1XEC A;  5AZ5 A;  1M9L A;  4FMZ A;  3W3K A;  4GLP A;  3JB9 j;  3OJA B;  3RFS A;  1FQV A;  3C6N B;  4R6J A;  3OGL B;  1ZIW A;  3C6P B;  3E2J A;  1A4Y A;  5AWA A;  2WQX A;  4U06 A;  4YEB B;  3WPF A;  1KOO A;  3W3M A;  5HZL B;  3RGX A;  4Z94 G;  3WPB A;  4IM6 A;  2JE1 A;  4R5D A;  3E6J A;  2WQW A;  4KT1 A;  2WQV A;  1WWL A;  4FCG A;  5AWC A;  4K17 A;  1YRG A;  1PGV A;  3ZYO A;  4R6A A;  1H6U A;  4XGO A;  2UZX A;  1XCD A;  1H6T A;  5AWD A;  4U09 A;  3W3N A;  4R5C A;  2FT3 A;  4I6J B;  2Z82 A;  3M18 A;  4NKG A;  4PKI G;  2BEX A;  4NZR M;  4CIL A;  4MQW X;  1M10 B;  3C6O B;  3WPG A;  3RIZ A;  5FTT B;  2ID5 A;  3ULU A;  2OMZ A;  4LSC A;  4AW4 A;  4L3A A;  4XSQ A;  1A9N A;  2O6R A;  3W3L A;  4Q62 A;  2P1O B;  3UL7 A;  2Y5Q A;  2P1P B;  2RR6 A;  1O6V A;  3G3B A;  4LSX A;  4V2E A;  3CIY A;  5IJD A;  5GMH A;  5AWB A;  1FT8 A;  1U0N D;  4H09 A;  3FXI A;  4U7L A;  2R9U A; 
#chains in the Genus database with same CATH homology
 4C2A B;  3SB4 A;  4R6F A;  3UN9 A;  4CNC A;  2IFG A;  4EZG A;  1P8V A;  4J4L A;  4NKH A;  3KJ4 A;  4L3F A;  2CA6 A;  4PQ8 A;  1K5G C;  4P8S A;  2V9S A;  1DS9 A;  2Z7X A;  3WPE A;  3ZYJ A;  3ULA A;  2Z64 A;  5B4P A;  4PEQ B;  1OTN A;  4R09 A;  4LSA A;  4WP6 A;  4UFR A;  5CMP A;  3PMH G;  1OTO A;  2WQU A;  3WPH A;  4CNM A;  4QXE A;  2RA8 A;  4R07 A;  4R08 A;  3M19 A;  4J0M A;  4ARN A;  4ECO A;  1IO0 A;  5HDH A;  2UZY A;  1GWB A;  3E4G A;  1O6S A;  2WFH A;  4Z64 C;  3RFE A;  4LXR A;  3WPD A;  3RW6 A;  1SQ0 B;  4BSR A;  4XOS A;  2Q4G W;  3G04 C;  4M7E A;  3OGK B;  4R58 A;  4AY9 X;  4Z61 C;  3A79 B;  3WPI A;  2P1M B;  4LSX C;  3ZYN A;  2Z63 A;  4BV4 R;  3CVR A;  2XWT C;  4BSU A;  3G39 A;  4HQ1 A;  2OMT A;  2O6Q A;  5A5C A;  3TSR E;  1K5D C;  5IYX C;  1QYY A;  4V2D A;  3RGZ A;  3BZ5 A;  5LFN A;  2P1Q B;  1OTM A;  4QBZ A;  1P9A G;  2OMU A;  2XOT A;  1M0Z A;  4FDW A;  2A0Z A;  4G8A A;  4ECN A;  2Z7X B;  4RWT C;  2Z81 A;  2ELL A;  1OOK G;  4R0A A;  2BNH A;  2Z66 A;  3OGM B;  4PER A;  4FHO A;  1G9U A;  5B0N A;  5IJC A;  4RCW A;  4MN8 B;  1DCE A;  3OJA A;  4Q3I A;  3UL9 A;  4B8C D;  4FD0 A;  2Z65 A;  4FS7 A;  4KNG A;  3W3J A;  1M9S A;  1P8T A;  4V2C A;  4BSS A;  4LI1 A;  3CIG A;  1FS2 A;  3RFJ A;  4OQT A;  3W3G A;  3WN4 A;  5GQR K;  4C2B B;  1W8A A;  4Z79 A;  2OMV A;  2O6S A;  4KXF B;  4M7E C;  5CMN A;  4LXS A;  5GMG A;  1Z7X W;  4WYK A;  1XKU A;  3REZ A;  4CC4 C;  2JE0 A;  4GT6 A;  1XWD C;  5IJB A;  4CC4 A;  1JL5 A;  4Y61 B;  3GOZ A;  4TZH A;  1KOH A;  2Z62 A;  4Q3G A;  3O53 A;  2JQD A;  5GMF A;  2AST B;  1LTX A;  5GS2 B;  2V70 A;  4QC0 A;  3WPC A;  2OMW A;  4R6G A;  4U08 A;  4ARR A;  2P1N B;  3G3A A;  4CP6 A;  1FO1 A;  3ZYI A;  5B0T A;  3O6N A;  1OGQ A;  5GS0 A;  3RW7 A;  1OZN A;  3VQ1 A;  2OMY A;  3ULV A;  2OMX A;  4Z8G A;  2ASS B;  1XEU A;  3VQ2 A;  2V9T B;  4PSJ A;  4RCA B;  3RJ0 A;  1DFJ I;  4LI2 A;  3G06 A;  3DZE A;  1O6T A;  3P72 A;  1D0B A;  3UL8 A;  3E3Z A;  5D3I A;  4P91 A;  1XEC A;  5AZ5 A;  1M9L A;  4FMZ A;  3W3K A;  4GLP A;  3JB9 j;  3OJA B;  3RFS A;  1FQV A;  3C6N B;  4R6J A;  3OGL B;  1ZIW A;  3C6P B;  3E2J A;  1A4Y A;  5AWA A;  2WQX A;  4U06 A;  4YEB B;  3WPF A;  1KOO A;  3W3M A;  5HZL B;  3RGX A;  4Z94 G;  3WPB A;  4IM6 A;  2JE1 A;  4R5D A;  3E6J A;  2WQW A;  4KT1 A;  2WQV A;  1WWL A;  4FCG A;  5AWC A;  4K17 A;  1YRG A;  1PGV A;  3ZYO A;  4R6A A;  1H6U A;  4XGO A;  2UZX A;  1XCD A;  1H6T A;  5AWD A;  4U09 A;  3W3N A;  4R5C A;  2FT3 A;  4I6J B;  2Z82 A;  3M18 A;  4NKG A;  4PKI G;  2BEX A;  4CIL A;  4MQW X;  1M10 B;  3C6O B;  3WPG A;  3RIZ A;  5FTT B;  2ID5 A;  3ULU A;  2OMZ A;  4LSC A;  4AW4 A;  4L3A A;  4XSQ A;  1A9N A;  2O6R A;  3W3L A;  4Q62 A;  2P1O B;  3UL7 A;  2Y5Q A;  2P1P B;  2RR6 A;  1O6V A;  3G3B A;  4LSX A;  4V2E A;  3CIY A;  5IJD A;  5GMH A;  5AWB A;  1FT8 A;  1U0N D;  4H09 A;  3FXI A;  4U7L A;  2R9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...