4WYKA

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
344
Chain Sequence
ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Nuclear RNA export factor 1
total genus 87
structure length 344
sequence length 347
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4wykA01
3OGKB 5LFNA 1Z7XW 4YEBB 3G04C 1O7PB 5CLKA 4R1KA 5BXQA 2WQXA 5CMPA 3RIZA 4R07A 1ZX2A 3CU3A 3E3ZA 2Z82A 2GXFA 3FF0A 3SOAA 3RGXA 1OHSA 4XDVA 4NKHA 2ASTB 4HZ9B 3C6OB 5HZLB 1EA2A 1QJGA 3STDA 3UN9A 2BMOB 2Z63A 5G2GA 2YFJB 3G3AA 4XBTA 1SQ0B 3UNLA 1G9UA 2ASSB 4FDWA 4XM4A 4L8PA 1FQVA 3TSRE 4M7EA 5AEUB 3EC9A 4L3AA 4HZBB 1NU3A 1QMAA 2Z65A 4R6GA 1K5GC 5GS0A 5CMNA 5KP3A 3FXIA 5EVHA 2RR6A 4L3FA 4CC4A 4Z64C 2XR8B 1A4YA 1JL5A 1O7WB 5FW5A 1AR0A 2GEYA 5D81A 1OH0A 2F86B 4FCJA 2JQDA 3UL9A 3W3LA 4RWTC 2F99A 3EJVA 5CXOA 4CILA 2Z7AA 4WYKB 5DRVA 4PERA 3EX9A 3OXAA 3DXOA 4XDWA 4GB5A 3BZ5A 3OGMB 4EZGA 1JN5A 4KXFB 1TUHA 2JQ5A 3B4PA 4R6AA 4RCAB 3WPHA 2HMJB 4HKVB 4N3VA 4QXEA 2ELLA 2W2CA 5A5CA 4HM8B 2QGUA 3LZAA 3F14A 2O6SA 4LSCA 3SEDA 4LMIA 1IO0A 1M9LA 4IM6A 3ROBA 3F40A 1Z1SA 1ULIB 1O7HB 1O7GB 2P1MB 2Z64A 4LI1A 1GY6A 3CNMA 3OJAA 2V70A 1Q42A 4FMZA 1Q40A 1D0BA 2Z62A 1DMQA 1W8AA 4HJLB 3KSPA 5AWAA 4HM7B 4LSXC 1JB2A 3OWUA 2UX0A 3I0YA 4WP5A 4PKIG 2RA8A 3W3MA 4R6JA 3BLZA 4Z94G 3E2JA 3MYTA 4K1UA 1FS2A 2HMLB 3ULAA 1O7MB 4KVHA 1M0ZA 2OWPA 4G8AA 1O6VA 3P72A 4H3UA 4OUQA 4R5CA 1K41A 2ID5A 1DMNA 3DZLA 2V9TB 2WQVA 2Q4GW 3ZYIA 5D3IA 4XOSA 2YFLB 5CK6A 4HVNA 3F8HA 4HM3B 5IG0A 6STDA 4K17A 2IFGA 2STDA 3T8NA 3NM2A 3ZYNA 3ULUA 1OTNA 3RFJA 1DFJI 3K7CA 3C6NB 1U0ND 2UZYA 4GLPA 5IENA 2WQWA 3FKAA 3M19A 3VQ1A 1E97A 4LEHA 3RJ0A 2HMOB 3JUPA 2BMQB 4PSJA 4BSRA 1DCEA 3NV0A 4PQ8A 4V2EA 5GQRK 3EN1B 4Q3IA 3MKIA 3JUQA 3HZPA 2BNHA 3WPIA 4K1VA 5AIGA 1ZO2A 1BUQA 4Z8GA 3EHCA 4FCMA 3GZYB 5IEOA 2WQUA 5IYXC 1P8VA 5GMHA 4STDA 3DUKA 1OUNA 3MG1A 4WYKA 2HMNB 2I9WA 3ZYOA 3W3KA 3A79B 4GT6A 4P8SA 4BSSA 3CIGA 3UJMA 4U09A 1P9AG 3BB9A 2PZVA 3VQ2A 4Z79A 2P1OB 3UL7A 5AWDA 2XSOB 5AIFA 3GWRA 3SOYA 1OZNA 1P8TA 3KKGA 4ECOA 1STDA 3WMDA 3O53A 3GZXB 3NHXA 3PMHG 5IG3A 3RFEA 3HX8A 3H51A 1A9NA 5IG5A 2R9UA 1JKGB 3NBRA 2GBWB 1E3RA 2V9SA 1OHPA 5GMGA 4B8CD 3WPDA 5AI1A 3OWSA 4HM2B 5KP4A 3JB9j 5KP1A 5HDHA 5FTTB 3M8CA 1O6SA 1O6TA 3G39A 1XEUA 2OMYA 4LSXA 3WPGA 5IF6A 2OMVA 4LI2A 1OCVA 3B7CA 4R08A 4Q53A 3VSYA 2Z7XB 4V2DA 4BV4R 2F98A 1KOOA 3W3JA 1UUWB 2Z77A 1ASKA 3W3GA 2OMWA 2CA6A 4MQWX 4I6JB 2OMUA 3H3HA 2XSHB 4WWUC 3SB4A 1OGZA 3Q90A 2K54A 3CVRA 3WPFA 1OTOA 3WPCA 1W6YA 2BNGA 1DS9A 3OGLB 2BMRB 1U5OA 2HMMB 3FSDA 4PEQB 5AWBA 3OX9A 4HM0B 3K0ZA 3WPEA 4ECNA 1FT8A 2CHCA 3FH1A 5GMFA 2WFHA 2GEXA 4QC0A 4H09A 1K5DC 1ISKA 3FGYA 5IG4A 3G8ZA 1KOHA 4AY9X 2A0ZA 3ZYJA 3A76A 1OOKG 4C2BB 2XRXB 1CQSA 4XGOA 2RFRA 5IJBA 1GS3A 4R5DA 3JUMA 4XBXA 3OJAB 3WN4A 1ZIWA 1Q40B 5D83A 4CP6A 2P1NB 3FLJA 3OV4A 3KE7A 5D82A 4CC4C 2HMKB 1YRGA 3E99A 5GS2B 2FT3A 4C2AB 8CHOA 2RCDA 3F9SA 5DREA 3VGNA 1XKUA 4Z61C 3CNXA 1IDPA 4J8TA 5STDA 1H6UA 4FS7A 4Y61B 4FHOA 4ARNA 1LTXA 2P1PB 4R58A 4HQ1A 4NKGA 4R0AA 4ARRA 5AIIA 5HGRA 3B4OA 1OPYA 2Y5QA 1OGQA 1A2KA 3EF8A 4XBYA 4RCWA 3NXJA 2R4IA 1S5AA 5IJDA 4OVMA 5IEPA 4MN8B 3ER7A 5TGNA 4X2HA 3G16A 4Q3GA 4U7LA 4BSUA 4L7KA 4R9KA 4CDLA 1XECA 1H6TA 5CF2A 4OQTA 1HKXA 3F7XA 1EG9B 1OGXA 1WQLB 4FCGA 4LXSA 4X2OA 1M9SA 1GY5A 3RGAA 5CF1A 3FF2A 3NUVA 3D9RA 1OF5B 2Z66A 4HM6B 3RGZA 1JB4A 3MHEA 3DM8A 3E6JA 5B4PA 2XWTC 3G0KA 4CNMA 4PEJA 3GZRA 3EBYA 4U06A 3F8XA 3ECFA 3MG2A 1M10B 4IIAA 5B0TA 4AW4A 3EQQB 1NWWA 3MG3A 2P1QB 3M18A 3WPBA 1W02A 1JKGA 3GRDA 4M7EC 1W00A 2O6RA 3O6NA 4TZHA 1DMMA 4R6FA 3FZWA 4L8OA 1JB5A 2JE1A 2OMZA 3CIYA 4J9AA 1XWDC 2CKFB 3ULVA 3RW6A 7STDA 3LYGA 4ORLA 3T8UA 1W01A 2A15A 5AIHA 4QBZA 5AWCA 4XB5A 4WP6A 2UZXA 3G3BA 1SJWA 2B1XB 4HM1B 2OMXA 4HM4B 5JPUA 2QIYA 1GWBA 5B0NA 4R9LA 4KNGA 3C6PB 4I4KA 1XCDA 2Z7XA 2INXA 3UL8A 3IPTA 2Z76A 3JUNA 4HM5B 5AEWB 4P91A 3RW7A 1VZZA 3CPOA 2GBXB 2BEXA 2IMJA 3OWYA 2Z81A 1NDOB 4LSAA 1ULJB 4J0MA 3W3NA 1GY7A 5BVBA 3DZEA 4KT1A 3GOZA 4U08A 3EN8A 1JN5B 4U13A 2RGQA 1E3VA 1PGVA 4UFRA 1O7NB 1TP6A 3KZTA 2XOTA 1OTMA 4R09A 5AZ5A 1C7HA 1FO1A 3GZBA 1QYYA 4LXRA 3NV0B 4MJDA 5IERA 1WWLA 1OHOA 4FD0A 2O6QA 3RGRA 2YFIB 4V2CA 3S5CA 1UUVB 3MSOA 4RZMA 2B24B 1GYBA 3E4GA 3REZA 4LGQA 3F7SA 3B8LA 4XSQA 3JUOA 4Q62A 2JE0A 3EBTA 3RFSA 2OMTA 3G06A 3KJ4A 5JPPA 4CNCA 1OF5A 3DMCA 3HK4A 4J4LA 5IJCA
chains in the Genus database with same CATH superfamily
3UL5A 1RNTA 1DVDA 1FA3A 2W0QA 3OGKB 5LFNA 1Z7XW 4BTWA 4YEBB 3G04C 1O7PB 2BT3A 2Y74A 5CLKA 6GSPA 1EQKA 4R1KA 5BXQA 2WQXA 4JF8A 2H0IA 4GHOA 5CMPA 3RIZA 4R07A 1IVVA 3BNBA 1ZX2A 3CU3A 1A67A 1RNBA 3CCS3 3E3ZA 2Z82A 2GXFA 3FF0A 2GU3A 3SOAA 3RGXA 1OHSA 4XDVA 3DGYA 4NKHA 1X1YA 3WDGB 2ASTB 2H0GA 4HZ9B 4NPBA 1BRIA 3HIIA 1BNSA 3C6OB 1B20A 5HZLB 1U8CB 1VQQA 4HAAA 1MOLA 1EA2A 1QJGA 3STDA 1IQYA 3UN9A 1BGSA 1I3IA 2BMOB 2Z63A 4FMBA 1YIT3 1IQ8A 4QWTA 3MWZA 2YFJB 1D6YA 1RGEA 5G2GA 2CFKA 2XEPA 2Z62A 3G3AA 1GD3A 2C10A 4LSOA 3NM7A 3NQZA 4XBTA 1SQ0B 3SVAA 1V74A 3UNLA 1G9UA 2ASSB 3BU4A 1SIIA 1B27A 1WNHA 4FDWA 1VQ73 1TFKA 4XM4A 4L8PA 4BL3A 1FQVA 4KT3B 1SQWA 3I553 1K8A4 1FW7A 2Z6BA 3CME3 1LXEA 3TSRE 4M7EA 5AEUB 1LNIA 2ZL8A 3EC9A 3X42A 1YIJ3 3CCQ3 4L3AA 4HZBB 1NU3A 1QMAA 1RCKA 2Z65A 4R6GA 1K5GC 5GS0A 3SXXA 5KP3A 5CMNA 4G1MB 3G4S3 2E2TA 3FXIA 5EVHA 2RR6A 4L3FA 2OQEA 4CC4A 4Z64C 4FMAA 2XR8B 1A4YA 1PU4A 4ILFA 5RNTA 1JL5A 1N9EA 1O7WB 1AR0A 1SARA 1WMPA 2P09A 3N9HA 5FW5A 2GEYA 1GMRA 5D81A 3X3ZA 1OH0A 2Y73A 2F86B 4FCJA 2JQDA 2KF4A 3KCHA 1NB3I 1RKYA 3UL9A 4RWTC 2F99A 3EJVA 3W3LA 1W2B2 5CXOA 4CILA 1AVLA 2Z7AA 4WYKB 2RSXA 5DRVA 4PERA 1UI8A 1HYFA 3PCSA 3EX9A 1AVKA 1BNJA 7RNTA 3OXAA 3DXOA 4XDWA 2BU4A 1ZGXA 4GB5A 3BZ5A 3OGMB 4EZGA 1G96A 5M1AA 1JN5A 2CWVA 1N9JA 1TUHA 4KXFB 2JQ5A 3B4PA 4R6AA 4RCAB 1EUIC 1I2GA 2HMJB 3WPHA 4HKVB 4N3VA 2GU1A 4QXEA 3S27A 3QRDA 2ELLA 2W2CA 1N5HA 1M1XB 1BOXA 5A5CA 2E2UA 4HM8B 1JBSA 1L5GB 2L4VA 1IQXA 2QGUA 2WGQA 1RHLA 3AMOA 3LZAA 4CCVA 4EW5A 3F14A 2O6SA 4LSCA 3SEDA 3CCU3 4GL6A 4LMIA 1STFI 3IMAB 1IO0A 1M9LA 1FZUA 4JRFA 3ROBA 4IM6A 3F40A 1Z1SA 1UW1A 1OACA 1ULIB 1O7HB 3DGOA 3GSPA 1O7GB 2P1MB 2Z64A 4LI1A 4R80A 1GY6A 3CNMA 3OJAA 1I3FA 1Q42A 2V70A 1Q40A 1X1UA 4FMZA 1RGAA 1YGWA 1D0BA 1IU7A 1DMQA 4HJLB 5G1LA 1VQM3 3WR2A 3KSPA 1W8AA 4BSSA 5AWAA 4HM7B 2W9QA 4LSXC 4LXSA 1JB2A 3OWUA 1QVG2 2UX0A 3I0YA 4WP5A 4PKIG 1B2ZA 2F4YA 1JNQA 1QALA 1R4YA 3AHSA 1LNHA 4RNTA 2RA8A 3W3MA 4P8SA 1PY3A 1BNEA 4R6JA 2IY2A 3NBJA 3BLZA 4Z94G 3E2JA 2UGIA 3NQYA 2CK3H 3MYTA 4K1UA 1UCIA 3KFQC 3X40A 2HMLB 1JV2B 3D5IA 3D4AA 3V98A 3ZG5A 1O7MB 4KVHA 3ULAA 1W6GA 2FNQA 1M0ZA 2F5MA 2QEX3 1BNFA 2OWPA 3FG4A 4G8AA 1KC84 1O6VA 1RDSA 3P72A 4H3UA 1BRNL 3DGLA 3FG3A 4OUQA 1VQ83 1K41A 4R5CA 1LRAA 1ZS7A 2ID5A 1DMNA 3T0UA 3DZLA 1Q9EA 3CMA3 2FGTA 4O2HA 2V9TB 2WQVA 6RNTA 5EQLA 2Q4GW 4WFOA 3ZYIA 5D3IA 2H0HA 4XOSA 2YFLB 3DH2A 5CK6A 4HVNA 3F8HA 4HM3B 5IG0A 1N8R4 6STDA 4K17A 2IFGA 2STDA 3T8NA 3NM2A 3CD63 3ZYNA 3DY5A 2WO0A 1G0TA 7GSPA 1HZ1A 1OTNA 3RFJA 3ULUA 1UUGB 3U1WA 1DFJI 3K7CA 2J8XB 3WODG 1W5ZA 2CC3A 1U0ND 2UZYA 1M9GA 5IENA 3C6NB 2WQWA 3G713 4GLPA 4O3VA 2AADA 3FKAA 3M19A 3VQ1A 1E97A 4LEHA 4BL2A 3RJ0A 2V1LA 4LZIA 2XH9A 1DYUA 2HMOB 2BMQB 3JUPA 3BNCA 3CCE3 1JRQA 1DCEA 3NV0A 4PQ8A 4PSJA 4V2EA 3EN1B 4EV5A 4Q3IA 5GQRK 3MKIA 4IT7A 3JUQA 4EBGA 3A5EA 2M7OA 3FCSB 1WTHA 3HZPA 3LTAA 2OTJ3 2BNHA 4K1VA 4N6UA 5AIGA 4EC6A 3WPIA 1ZO2A 3X3YA 2WOHA 3O8YA 5FGOA 1KD14 1BUQA 4Z8GA 3EHCA 1MNLA 3I563 2KF5A 4FCMA 3GZYB 4N6OB 1IVUA 1RN1A 5IEOA 2WQUA 5AYRB 4KFEA 1P8VA 5IYXC 5GMHA 1GOYA 4STDA 1RGHA 1OUNA 2OQEC 3DUKA 3MG1A 4WYKA 5HOHA 2HMNB 3HOHA 3SYUA 2MF7A 1BNIA 1BSAA 2I9WA 4FMDA 2IUJA 3ZYOA 3W3KA 1BSDA 3PCRA 1BRJA 2Q07A 4HYZA 3SLUA 1K5DC 1BANA 3UJMA 3A79B 4GT6A 1BSCA 1BRKA 3BB9A 4HOHA 1VQ93 1P9AG 4U09A 2PZVA 3VQ2A 4Z79A 3CXC2 1UGHI 2P1OB 2ZA4A 2HOHA 3UL7A 1JBRA 2XSOB 5AIFA 3J7Yd 5AWDA 3AGNA 3GWRA 3L0RA 3SOYA 1OZNA 1K9M4 3KKGA 3NBBA 1P8TA 4ECOA 1MWRA 1STDA 1M1K4 1FYSA 3WMDA 3GAXA 3O53A 2RNTA 3GZXB 2CX0A 3Q3FA 8RNTA 1LVNA 1WMOA 3NHXA 3PMHG 5IG3A 5A0OB 3CC73 3AMOB 3RFEA 3CCJ3 3HX8A 1W4NA 3H51A 1A9NA 5IG5A 3WA3A 2R9UA 1JKGB 3NBRA 2GBWB 1QAFA 1E3RA 2V9SA 1MWSA 1OHPA 2C11A 2L1SA 4AEQA 3HI7A 1VQN3 5GMGA 3Q2PA 1SPUA 1YI23 4B8CD 3WPDA 5AI1A 3OWSA 4HM2B 1AQZA 1GOVA 5KP4A 1DE3A 3JB9j 1A2VA 4I5QA 5KP1A 1TIJA 5HDHA 1DVCA 2W56A 5FTTB 1NB5I 3M8CA 1B2SA 1T5YA 1PYLA 1FUSA 4RNZA 1O6SA 2CFLA 4J5GA 1O6TA 3PYJA 3G39A 1XEUA 2OMYA 1BSBA 4LSXA 1RGLA 3WPGA 5IF6A 1RRHA 4BIRA 1B2XA 3KN4A 1S723 2OMVA 4LI2A 2K0MA 3K63A 2AAEA 3ZG0A 1OCVA 3WOFB 2ZDJA 3B7CA 3LH4A 4R08A 1LOWA 1FGMA 3AHWA 1B2UA 1V58A 1I0VA 4Q53A 3VSYA 1Q864 2Z7XB 4V2DA 4BV4R 2F98A 3SX1A 1VQO3 1KOOA 3BIRA 2F5WA 3W3JA 1BIRA 3LOYA 1G02A 1IVXA 3X3XA 1BAOA 1UUWB 4ZM8A 2XGLA 2Z77A 4EV2A 1ASKA 1RCLA 3CC23 2W04A 2OMWA 3W3GA 1FGQA 1BUJA 2CA6A 4MQWX 4H61A 4I6JB 2OMUA 1T2IA 2OTL3 1FUWA 3H3HA 2ML5A 2XFSA 2XSHB 4WWUC 4GSPA 1CH0A 4N6MA 4DKIA 2CFDA 3SB4A 1OGZA 3Q90A 2K54A 4QC0A 1VQ43 3CVRA 2RBIA 3K5TA 3WPFA 1OTOA 3WPCA 4CPKA 1JZOA 1W6YA 1HU9A 2BNGA 1Q7HA 4MMXB 2BMRB 1YHQ3 1U5OA 3OGLB 1DS9A 2HMMB 3FSDA 4PEQB 1K28A 1Q824 3OX9A 4HM0B 1YJ93 5AWBA 3K0ZA 3LTCA 4ECNA 3WPEA 1FT8A 4AKZA 2YX9A 1Q7Y4 2CHCA 2W6JH 1W6CA 3FH1A 4AKYA 2XGNA 4J5KA 5GMFA 1AY7A 3RNTA 2WFHA 2GEXA 1I8VA 4H09A 1A2PA 3LT9A 1GSPA 1DETA 3FGYA 1JBTA 1ISKA 1QAKA 3G8ZA 5IG4A 1ROVA 1KOHA 3PZWA 4AY9X 1QVF2 3KSED 1IK3A 2A0ZA 2CFWA 3X41A 3V92A 1GOUA 3QK9A 4NZRM 4BU4A 3ZYJA 1RTUA 3A76A 2CW9A 5GSPA 1OOKG 4C2BB 2XRXB 1CQSA 4XGOA 2RFRA 5IJBA 1UCKA 1GS3A 1TRQA 1EKMA 4R5DA 1I0XA 3JUMA 4MEIA 4XBXA 3OJAB 3WN4A 1ZIWA 1Q40B 5D83A 1RRLA 1RMSA 4CP6A 3G6E3 2ZHXB 4RNYA 2P1NB 4OK0A 3FLJA 1MWTA 1TTOA 2BO9B 1N5PA 1SIHA 2OCTA 2KF3A 2P05A 3KE7A 1RJOA 4R4KA 5D82A 2FXTA 4CC4C 2HMKB 1YRGA 1YVBI 3E99A 5GS2B 2FT3A 3WOEB 2D42A 4C2AB 2CH9A 2RCDA 2W9PA 3F9SA 8CHOA 5DREA 3VGNA 3PS8A 3CCM3 2JDIH 5BU4A 1Y4KA 4EXRA 3EB8A 1XKUA 3CNXA 4Z61C 1IDPA 2BHMA 3IJEB 4J8TA 4LYLB 5STDA 1TFOA 2IA7A 4FMCA 1BRGA 2ML6A 1H6UA 4FS7A 4Y61B 1KSIA 4FHOA 1IYYA 5LC6A 1IT7A 4ARNA 1LTXA 2P1PB 1D6ZA 5AYSC 4R58A 4HQ1A 4NKGA 2R41A 1FS2A 1NO3A 4ARRA 4R0AA 1KWIA 1RSNA 3DGNA 1VQK3 1C54A 3ULVA 1UDII 4MMYB 3CC43 3ZFZA 5AIIA 5HGRA 3B4OA 1OPYA 1GMPA 2Y5QA 2MC8A 1FUTA 1OGQA 4MMZB 1M9SA 1A2KA 2KAAA 1F8NA 3EF8A 3PXMA 4K61A 4XBYA 4RCWA 3NXJA 2R4IA 1S5AA 3CCR3 1LOYA 5IJDA 4OVMA 4N6V0 1CYVA 5IEPA 3TDGA 4NREA 3ER7A 1UCLA 5LC7A 4X2HA 3Q1CA 2P0MA 3G16A 5TGNA 4Q3GA 3WA2X 4U7LA 4BSUA 1MGRA 4L7KA 4R9KA 4CDLA 4HBRA 1XECA 3CCV3 1H6TA 5CF2A 4OQTA 3FG1A 1IV7A 1HKXA 4O02B 1YGEA 1US1A 5G1KA 1BU4A 3F7XA 1EG9B 1OGXA 1WQLB 4FCGA 2CG0A 2K3DA 4X2OA 1RGFA 2P38A 1B3SA 1T3BA 1BNGA 1GY5A 1I2EA 1EEJA 3AGOA 1YJN3 1R4CA 1KQS2 3RGAA 2WOFA 1LOXA 5CF1A 4N6TA 3FF2A 2F56A 3NUVA 3D9RA 1TJDA 3V99A 3DGMA 1OF5B 4KFDA 2D1WA 3OV4A 1T2HA 3U97A 1RGGA 2Z66A 4N6LA 2P0XA 4HM6B 3RGZA 1V57A 1JB4A 1BSEA 3MHEA 3DM8A 4KZ1A 4FR9A 5ELUA 5I97A 3E6JA 2XWTC 2CG1A 4NZTM 5B4PA 1BRHA 1MGWA 3G0KA 4CNMA 1N8QA 4PEJA 3S28A 1W7CA 3GZRA 3EBYA 1BVIA 4U06A 1GMQA 2IYJA 3F8XA 3N8BA 3KIIA 1PFPA 3ECFA 2IUKA 3JVCA 3UB1A 3RW6A 1B21A 3MG2A 2OOVA 1TU5A 4IIAA 1M10B 5B0TA 1YJW3 3CIGA 2BIRA 4AW4A 1I2FA 3EQQB 2CWTA 2OOVC 1NWWA 3LT8A 3MG3A 4KFFA 2P1QB 3M18A 3WPBA 2E2VA 1IV9A 2KXGA 1W02A 1ROAA 1JKGA 3GRDA 4M7EC 1W00A 2O6RA 3O6NA 4TZHA 1DMMA 3K9MC 4R6FA 4TX4A 4MN8B 3FZWA 1J2BA 4L8OA 1JB5A 4K90B 5IW9A 5JBSA 1VQ63 2JE1A 2OMZA 3CIYA 4J9AA 1W2ZA 1XWDC 1WMNA 2CKFB 3BNDA 3D79A 1NNVA 4NHFA 3HIGA 7STDA 3LYGA 1JZDA 2W56B 4ORLA 4BSRA 3T8UA 1W01A 2SARA 2A15A 5AIHA 1NJI4 3PGBA 2XF3A 1CEWI 4BTXA 2WGOA 2SBLA 4QBZA 4XB5A 4WP6A 5AWCA 2UZXA 3G3BA 3UL6A 1SJWA 2B1XB 4HM1B 1MWUA 1RN4A 2UUGC 4HM4B 2OMXA 5JPUA 2QIYA 1GWBA 1IVWA 2CIUA 3LXUX 4CJNA 2CX1A 4R9LA 1M904 5BIRA 4KNGA 3C6PB 5B0NA 4I4KA 1XCDA 2Z7XA 2INXA 1A90A 3UL8A 2GSPA 1YNVX 1YVSA 3BNEA 3IPTA 2Z76A 2W03A 3JUNA 4HM5B 5AEWB 4P91A 3CPW2 3RW7A 2PNCA 3S67A 2KF6A 1VZZA 3CPOA 2GBXB 2BEXA 3MPHA 1RN7A 1VQL3 1FGTA 2IMJA 5M18A 3OWYA 1K734 1NDOB 2Z81A 1VQ53 4LSAA 3VF1A 1UI7A 1ULJB 3ALAA 4J0MA 4FD0A 1B2MA 2XFTA 3W3NA 1JJ22 1GY7A 5BVBA 1BNRA 3DZEA 4KT1A 2LQVA 3GOZA 4U08A 3EN8A 1JN5B 1AV4A 2CWUA 5M19A 1RGKA 1UCJA 2RGQA 1E3VA 2C4BA 4U13A 1PGVA 4UFRA 1O7NB 9RNTA 1TRPA 1TP6A 1BRSA 3KZTA 1OTMA 2XOTA 4R09A 5AZ5A 4IPBA 1C7HA 1FO1A 3GZBA 4EYCA 1QYYA 1GD4A 1FGRA 2KRTA 4LXRA 1VQP3 3NV0B 3N54B 4MJDA 2O3OA 5IERA 1OHOA 3WHOA 3D5GA 3CCL3 1WWLA 1RGCA 3RGRA 2O6QA 3LTBA 1FGOA 1X1WA 2YFIB 3NX0A 2LYXA 4V2CA 4RBNA 1UUVB 3MSOA 4RZMA 2B24B 4O8SA 3S5CA 2CFGA 1GYBA 1RLSA 1LQGC 3RDEA 1D6UA 4BTYA 3E4GA 4LGQA 5EEOA 3F7SA 1LQMB 3B8LA 1CYUA 1Q814 4XSQA 3REZA 1LOVA 1X1XA 3JUOA 4Q62A 1UGIA 2O9UX 3EBTA 1IT8A 3EE1A 3LMLA 3LTDA 5ELJA 3URPA 2JE0A 3RFSA 2OMTA 3G06A 1I70A 3KJ4A 4N6NB 5JPPA 4CNCA 4FCZA 1OF5A 3D3LA 3DMCA 3S29A 2QA43 3HK4A 4J4LA 4WHAA 2KCDA 3OW22 5IJCA
chains in the Genus database with same CATH topology
3UL5A 1DVDA 1FA3A 2W0QA 3OGKB 5LFNA 1Z7XW 4BTWA 4YEBB 3G04C 1O7PB 2BT3A 2Y74A 5CLKA 1EQKA 4R1KA 5BXQA 2WQXA 4JF8A 5CMPA 3RIZA 4R07A 1IVVA 3BNBA 1ZX2A 3CU3A 1A67A 3CCS3 3E3ZA 2Z82A 2GXFA 3FF0A 2GU3A 3SOAA 3RGXA 1OHSA 4XDVA 4NKHA 3WDGB 2ASTB 4HZ9B 3HIIA 3C6OB 5HZLB 1U8CB 1MOLA 1EA2A 1QJGA 3STDA 1IQYA 3UN9A 2BMOB 2Z63A 4FMBA 1YIT3 1IQ8A 4QWTA 3MWZA 2YFJB 1D6YA 5G2GA 3G3AA 2CFKA 2XEPA 1GD3A 2C10A 4LSOA 3NM7A 3NQZA 4XBTA 1SQ0B 3SVAA 1V74A 3UNLA 1G9UA 2ASSB 1SIIA 1WNHA 4FDWA 1VQ73 1TFKA 4XM4A 4L8PA 1FQVA 1SQWA 3I553 1K8A4 3TSRE 2Z6BA 3CME3 1LXEA 4M7EA 5AEUB 2ZL8A 3EC9A 3X42A 1YIJ3 3CCQ3 4L3AA 4HZBB 1NU3A 1QMAA 2Z65A 4R6GA 1K5GC 5GS0A 3SXXA 5KP3A 5CMNA 4G1MB 3G4S3 2E2TA 3FXIA 5EVHA 2RR6A 4L3FA 2OQEA 4CC4A 4Z64C 4FMAA 2XR8B 1A4YA 1PU4A 1JL5A 1N9EA 1O7WB 1AR0A 5FW5A 1WMPA 2P09A 3N9HA 2GEYA 5D81A 3X3ZA 1OH0A 2Y73A 2F86B 4FCJA 2JQDA 1RKYA 1NB3I 3UL9A 3W3LA 4RWTC 2F99A 3EJVA 1W2B2 5CXOA 4CILA 1AVLA 2Z7AA 4WYKB 2RSXA 5DRVA 4PERA 1UI8A 3PCSA 3EX9A 1AVKA 3OXAA 3DXOA 4XDWA 4GB5A 3BZ5A 3OGMB 4EZGA 1G96A 1JN5A 2CWVA 1N9JA 1TUHA 4KXFB 2JQ5A 3B4PA 4R6AA 4RCAB 3WPHA 2HMJB 4HKVB 4N3VA 2GU1A 4QXEA 3S27A 3QRDA 2ELLA 2W2CA 1N5HA 1M1XB 5A5CA 2E2UA 4HM8B 1L5GB 2L4VA 1IQXA 2QGUA 2WGQA 3LZAA 3AMOA 4CCVA 3F14A 2O6SA 4LSCA 3SEDA 3CCU3 4GL6A 4LMIA 1STFI 3IMAB 1IO0A 1M9LA 4IM6A 4JRFA 3ROBA 3F40A 1Z1SA 1UW1A 1OACA 1ULIB 1O7HB 3DGOA 1O7GB 2P1MB 2Z64A 4LI1A 4R80A 1GY6A 3CNMA 3OJAA 2V70A 1Q42A 4FMZA 1Q40A 1D0BA 2Z62A 1IU7A 1DMQA 4HJLB 1VQM3 1W8AA 3KSPA 5AWAA 4HM7B 2W9QA 4LSXC 1JB2A 3OWUA 1QVG2 2UX0A 3I0YA 4WP5A 4PKIG 1JNQA 1QALA 2RA8A 3W3MA 1LNHA 4R6JA 3NBJA 3BLZA 4Z94G 3E2JA 3NQYA 2CK3H 3MYTA 4K1UA 3X40A 3KFQC 1FS2A 2HMLB 1JV2B 3ULAA 3V98A 1O7MB 4KVHA 1W6GA 2FNQA 1M0ZA 2QEX3 2OWPA 3FG4A 4G8AA 1KC84 1O6VA 3P72A 4H3UA 3DGLA 3FG3A 4OUQA 1VQ83 1K41A 4R5CA 2ID5A 1DMNA 3T0UA 3DZLA 3CMA3 2FGTA 4O2HA 2V9TB 2WQVA 5EQLA 2Q4GW 4WFOA 3ZYIA 5D3IA 4XOSA 2YFLB 5CK6A 4HVNA 3F8HA 4HM3B 5IG0A 1N8R4 6STDA 4K17A 2IFGA 2STDA 3T8NA 3NM2A 3CD63 3ZYNA 3DY5A 2WO0A 3ULUA 1OTNA 3RFJA 3U1WA 1DFJI 3K7CA 3WODG 1W5ZA 2CC3A 1U0ND 2UZYA 1M9GA 5IENA 3C6NB 2WQWA 3G713 4GLPA 4O3VA 3FKAA 3M19A 3VQ1A 1E97A 4LEHA 3RJ0A 2V1LA 4LZIA 2XH9A 1DYUA 2HMOB 2BMQB 3JUPA 3BNCA 3CCE3 1JRQA 1DCEA 3NV0A 4PQ8A 4PSJA 4V2EA 3EN1B 4EV5A 4Q3IA 5GQRK 3MKIA 4IT7A 3JUQA 4EBGA 2M7OA 3FCSB 1WTHA 3HZPA 3LTAA 2OTJ3 2BNHA 4K1VA 4N6UA 5AIGA 4EC6A 3WPIA 1ZO2A 3X3YA 2WOHA 3O8YA 5FGOA 1KD14 1BUQA 4Z8GA 3EHCA 1MNLA 3I563 4FCMA 3GZYB 4N6OB 1IVUA 5IEOA 2WQUA 5AYRB 4KFEA 1P8VA 5IYXC 5GMHA 4STDA 2OQEC 1OUNA 3DUKA 3MG1A 4WYKA 2HMNB 2MF7A 2I9WA 2IUJA 4FMDA 3ZYOA 3W3KA 3PCRA 3A79B 2Q07A 3SLUA 4GT6A 4P8SA 4BSSA 3UJMA 4U09A 3CIGA 1P9AG 3BB9A 1VQ93 2PZVA 3VQ2A 4Z79A 3CXC2 2P1OB 3UL7A 5AWDA 2XSOB 5AIFA 3J7Yd 3GWRA 3L0RA 3SOYA 1OZNA 1K9M4 3KKGA 3NBBA 1P8TA 4ECOA 1STDA 1M1K4 3WMDA 3GAXA 3O53A 3GZXB 1LVNA 1WMOA 3NHXA 3PMHG 5IG3A 5A0OB 3AMOB 3RFEA 3CCJ3 3HX8A 1W4NA 3H51A 1A9NA 5IG5A 3WA3A 2R9UA 1JKGB 3NBRA 2GBWB 1QAFA 1E3RA 2V9SA 1OHPA 5GMGA 2C11A 4AEQA 1VQN3 3HI7A 3Q2PA 1SPUA 1YI23 4B8CD 3WPDA 5AI1A 3OWSA 4HM2B 5KP4A 3JB9j 1A2VA 5KP1A 1TIJA 5HDHA 1DVCA 2W56A 5FTTB 1NB5I 3M8CA 1T5YA 1O6SA 1O6TA 4RNZA 2CFLA 3PYJA 3G39A 1XEUA 2OMYA 4LSXA 3WPGA 5IF6A 1RRHA 2OMVA 3KN4A 1S723 4LI2A 2K0MA 3K63A 1OCVA 3WOFB 2ZDJA 3B7CA 3LH4A 4R08A 1FGMA 1Q864 4Q53A 3VSYA 2Z7XB 4V2DA 4BV4R 2F98A 3SX1A 1VQO3 1KOOA 3W3JA 3LOYA 1IVXA 3X3XA 3CC23 1UUWB 4ZM8A 2XGLA 2Z77A 4EV2A 1ASKA 3W3GA 2OMWA 2W04A 1FGQA 2CA6A 4MQWX 4H61A 4I6JB 2OMUA 2OTL3 1FUWA 3H3HA 2ML5A 2XFSA 2XSHB 4WWUC 4N6MA 3SB4A 2CFDA 1OGZA 3Q90A 2K54A 1VQ43 3CVRA 3K5TA 3WPFA 1OTOA 3WPCA 1W6YA 2BNGA 1HU9A 1YHQ3 4MMXB 3OGLB 2BMRB 1DS9A 1U5OA 2HMMB 3FSDA 4PEQB 1K28A 1Q824 3OX9A 4HM0B 1YJ93 5AWBA 3K0ZA 3LTCA 4ECNA 3WPEA 1FT8A 4AKZA 2YX9A 1Q7Y4 2CHCA 2W6JH 1W6CA 3FH1A 4AKYA 2XGNA 5GMFA 2WFHA 2GEXA 4QC0A 4H09A 3LT9A 1ISKA 1K5DC 3FGYA 1QAKA 3G8ZA 5IG4A 1ROVA 1KOHA 3PZWA 4AY9X 1QVF2 3KSED 1IK3A 2A0ZA 2CFWA 3X41A 3V92A 3QK9A 3ZYJA 3A76A 2CW9A 1OOKG 4C2BB 2XRXB 1CQSA 4XGOA 2RFRA 5IJBA 1GS3A 1EKMA 4R5DA 3JUMA 4MEIA 4XBXA 3OJAB 3WN4A 1ZIWA 1Q40B 5D83A 1RRLA 4CP6A 3G6E3 4RNYA 2P1NB 4OK0A 3FLJA 1N5PA 1SIHA 2BO9B 2P05A 3KE7A 2OCTA 3OV4A 4HYZA 4R4KA 1RJOA 5D82A 3CC73 2FXTA 4CC4C 2HMKB 1YRGA 1YVBI 3E99A 5GS2B 2FT3A 3WOEB 2D42A 4C2AB 2CH9A 2RCDA 2W9PA 3F9SA 8CHOA 5DREA 3VGNA 3PS8A 3CCM3 2JDIH 1XKUA 1Y4KA 4EXRA 3EB8A 4Z61C 3CNXA 1IDPA 2BHMA 3IJEB 4J8TA 5STDA 1TFOA 2IA7A 4FMCA 1H6UA 2ML6A 4FS7A 4Y61B 1KSIA 4FHOA 5LC6A 1IT7A 4ARNA 1LTXA 2P1PB 1D6ZA 5AYSC 4R58A 4HQ1A 4NKGA 4R0AA 4ARRA 1NO3A 1KWIA 3DGNA 1VQK3 4MMYB 3CC43 5AIIA 5HGRA 3B4OA 1OPYA 2Y5QA 2MC8A 1OGQA 4MMZB 1A2KA 1F8NA 3EF8A 3PXMA 4K61A 4XBYA 4RCWA 3NXJA 2R4IA 1S5AA 3CCR3 5IJDA 4OVMA 4N6V0 1CYVA 5IEPA 3TDGA 4NREA 3ER7A 5LC7A 5TGNA 4X2HA 3Q1CA 2P0MA 3G16A 4Q3GA 4MN8B 3WA2X 4U7LA 4BSUA 4L7KA 4R9KA 4CDLA 4HBRA 1XECA 3CCV3 1H6TA 5CF2A 4OQTA 3FG1A 1IV7A 1HKXA 4O02B 1YGEA 1US1A 3F7XA 1EG9B 1OGXA 1WQLB 4FCGA 2CG0A 4LXSA 4X2OA 2P38A 1YJN3 1GY5A 1M9SA 1KQS2 1R4CA 3RGAA 2WOFA 1LOXA 5CF1A 4N6TA 3FF2A 3NUVA 3D9RA 3V99A 3DGMA 1OF5B 4KFDA 2D1WA 3U97A 2Z66A 4N6LA 2P0XA 4HM6B 3RGZA 1JB4A 3MHEA 3DM8A 4KZ1A 4FR9A 5ELUA 5I97A 3E6JA 2XWTC 2CG1A 5B4PA 3G0KA 4CNMA 1N8QA 4PEJA 3S28A 1W7CA 3GZRA 3EBYA 4U06A 3F8XA 3N8BA 3KIIA 1PFPA 3ECFA 2IUKA 3JVCA 3UB1A 3MG2A 2OOVA 1TU5A 1M10B 4IIAA 5B0TA 1YJW3 4AW4A 3EQQB 2CWTA 2OOVC 1NWWA 3LT8A 3MG3A 4KFFA 2P1QB 3M18A 3WPBA 2E2VA 1IV9A 2KXGA 1ROAA 1JKGA 1W02A 3GRDA 4M7EC 1W00A 2O6RA 3O6NA 4TZHA 1DMMA 3K9MC 4R6FA 4TX4A 3FZWA 1J2BA 4L8OA 1JB5A 4K90B 5IW9A 5JBSA 1VQ63 2JE1A 2OMZA 3CIYA 4J9AA 1W2ZA 1XWDC 1WMNA 2CKFB 3BNDA 4NHFA 4BSRA 3ULVA 3HIGA 7STDA 3LYGA 2W56B 3RW6A 4ORLA 3T8UA 1W01A 2A15A 5AIHA 1NJI4 3PGBA 2XF3A 1CEWI 4BTXA 2WGOA 2SBLA 4QBZA 4XB5A 4WP6A 5AWCA 2UZXA 3G3BA 3UL6A 1SJWA 2B1XB 4HM1B 2OMXA 4HM4B 5JPUA 2QIYA 1GWBA 1IVWA 2CIUA 3LXUX 1M904 4R9LA 4KNGA 5B0NA 3C6PB 4I4KA 1XCDA 2Z7XA 2INXA 1A90A 3UL8A 3BNEA 3IPTA 2Z76A 2W03A 3JUNA 4HM5B 5AEWB 4P91A 3CPW2 3RW7A 2PNCA 3S67A 1VZZA 3CPOA 2GBXB 2BEXA 3MPHA 1RN7A 1VQL3 1FGTA 2IMJA 1K734 3OWYA 2Z81A 1NDOB 4LSAA 1VQ53 3VF1A 1UI7A 1ULJB 3ALAA 4J0MA 2XFTA 3W3NA 1JJ22 1GY7A 5BVBA 3DZEA 4KT1A 2LQVA 3GOZA 4U08A 3EN8A 1JN5B 1AV4A 2CWUA 4U13A 2RGQA 1E3VA 1PGVA 4UFRA 1O7NB 1TP6A 3KZTA 2XOTA 1OTMA 4R09A 5AZ5A 4IPBA 1C7HA 1FO1A 3GZBA 4EYCA 1QYYA 1GD4A 1FGRA 2KRTA 4LXRA 1VQP3 3NV0B 3N54B 4MJDA 2O3OA 5IERA 1OHOA 3CCL3 1WWLA 4FD0A 2O6QA 3RGRA 3LTBA 1FGOA 2YFIB 3NX0A 4V2CA 2LYXA 4RBNA 1UUVB 3MSOA 4RZMA 2B24B 4O8SA 3S5CA 2CFGA 1GYBA 3RDEA 4BTYA 1D6UA 3E4GA 3REZA 4LGQA 5EEOA 3F7SA 3B8LA 1CYUA 4XSQA 1Q814 3JUOA 4Q62A 2O9UX 3EE1A 3EBTA 1IT8A 3LMLA 3LTDA 5ELJA 2JE0A 3RFSA 2OMTA 3G06A 3KJ4A 4N6NB 5JPPA 4CNCA 4FCZA 1OF5A 3D3LA 3DMCA 3S29A 2QA43 3HK4A 4J4LA 4WHAA 2KCDA 3OW22 5IJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGK B;  5LFN A;  1Z7X W;  4YEB B;  3G04 C;  1O7P B;  5CLK A;  4R1K A;  5BXQ A;  2WQX A;  5CMP A;  3RIZ A;  4R07 A;  1ZX2 A;  3CU3 A;  3E3Z A;  2Z82 A;  2GXF A;  3FF0 A;  3SOA A;  3RGX A;  1OHS A;  4XDV A;  4NKH A;  2AST B;  4HZ9 B;  3C6O B;  5HZL B;  1EA2 A;  1QJG A;  3STD A;  3UN9 A;  2BMO B;  2Z63 A;  5G2G A;  2YFJ B;  3G3A A;  4XBT A;  1SQ0 B;  3UNL A;  1G9U A;  2ASS B;  4FDW A;  4XM4 A;  4L8P A;  1FQV A;  3TSR E;  4M7E A;  5AEU B;  3EC9 A;  4L3A A;  4HZB B;  1NU3 A;  1QMA A;  2Z65 A;  4R6G A;  1K5G C;  5GS0 A;  5CMN A;  5KP3 A;  3FXI A;  5EVH A;  2RR6 A;  4L3F A;  4CC4 A;  4Z64 C;  2XR8 B;  1A4Y A;  1JL5 A;  1O7W B;  5FW5 A;  1AR0 A;  2GEY A;  5D81 A;  1OH0 A;  2F86 B;  4FCJ A;  2JQD A;  3UL9 A;  3W3L A;  4RWT C;  2F99 A;  3EJV A;  5CXO A;  4CIL A;  2Z7A A;  4WYK B;  5DRV A;  4PER A;  3EX9 A;  3OXA A;  3DXO A;  4XDW A;  4GB5 A;  3BZ5 A;  3OGM B;  4EZG A;  1JN5 A;  4KXF B;  1TUH A;  2JQ5 A;  3B4P A;  4R6A A;  4RCA B;  3WPH A;  2HMJ B;  4HKV B;  4N3V A;  4QXE A;  2ELL A;  2W2C A;  5A5C A;  4HM8 B;  2QGU A;  3LZA A;  3F14 A;  2O6S A;  4LSC A;  3SED A;  4LMI A;  1IO0 A;  1M9L A;  4IM6 A;  3ROB A;  3F40 A;  1Z1S A;  1ULI B;  1O7H B;  1O7G B;  2P1M B;  2Z64 A;  4LI1 A;  1GY6 A;  3CNM A;  3OJA A;  2V70 A;  1Q42 A;  4FMZ A;  1Q40 A;  1D0B A;  2Z62 A;  1DMQ A;  1W8A A;  4HJL B;  3KSP A;  5AWA A;  4HM7 B;  4LSX C;  1JB2 A;  3OWU A;  2UX0 A;  3I0Y A;  4WP5 A;  4PKI G;  2RA8 A;  3W3M A;  4R6J A;  3BLZ A;  4Z94 G;  3E2J A;  3MYT A;  4K1U A;  1FS2 A;  2HML B;  3ULA A;  1O7M B;  4KVH A;  1M0Z A;  2OWP A;  4G8A A;  1O6V A;  3P72 A;  4H3U A;  4OUQ A;  4R5C A;  1K41 A;  2ID5 A;  1DMN A;  3DZL A;  2V9T B;  2WQV A;  2Q4G W;  3ZYI A;  5D3I A;  4XOS A;  2YFL B;  5CK6 A;  4HVN A;  3F8H A;  4HM3 B;  5IG0 A;  6STD A;  4K17 A;  2IFG A;  2STD A;  3T8N A;  3NM2 A;  3ZYN A;  3ULU A;  1OTN A;  3RFJ A;  1DFJ I;  3K7C A;  3C6N B;  1U0N D;  2UZY A;  4GLP A;  5IEN A;  2WQW A;  3FKA A;  3M19 A;  3VQ1 A;  1E97 A;  4LEH A;  3RJ0 A;  2HMO B;  3JUP A;  2BMQ B;  4PSJ A;  4BSR A;  1DCE A;  3NV0 A;  4PQ8 A;  4V2E A;  5GQR K;  3EN1 B;  4Q3I A;  3MKI A;  3JUQ A;  3HZP A;  2BNH A;  3WPI A;  4K1V A;  5AIG A;  1ZO2 A;  1BUQ A;  4Z8G A;  3EHC A;  4FCM A;  3GZY B;  5IEO A;  2WQU A;  5IYX C;  1P8V A;  5GMH A;  4STD A;  3DUK A;  1OUN A;  3MG1 A;  4WYK A;  2HMN B;  2I9W A;  3ZYO A;  3W3K A;  3A79 B;  4GT6 A;  4P8S A;  4BSS A;  3CIG A;  3UJM A;  4U09 A;  1P9A G;  3BB9 A;  2PZV A;  3VQ2 A;  4Z79 A;  2P1O B;  3UL7 A;  5AWD A;  2XSO B;  5AIF A;  3GWR A;  3SOY A;  1OZN A;  1P8T A;  3KKG A;  4ECO A;  1STD A;  3WMD A;  3O53 A;  3GZX B;  3NHX A;  3PMH G;  5IG3 A;  3RFE A;  3HX8 A;  3H51 A;  1A9N A;  5IG5 A;  2R9U A;  1JKG B;  3NBR A;  2GBW B;  1E3R A;  2V9S A;  1OHP A;  5GMG A;  4B8C D;  3WPD A;  5AI1 A;  3OWS A;  4HM2 B;  5KP4 A;  3JB9 j;  5KP1 A;  5HDH A;  5FTT B;  3M8C A;  1O6S A;  1O6T A;  3G39 A;  1XEU A;  2OMY A;  4LSX A;  3WPG A;  5IF6 A;  2OMV A;  4LI2 A;  1OCV A;  3B7C A;  4R08 A;  4Q53 A;  3VSY A;  2Z7X B;  4V2D A;  4BV4 R;  2F98 A;  1KOO A;  3W3J A;  1UUW B;  2Z77 A;  1ASK A;  3W3G A;  2OMW A;  2CA6 A;  4MQW X;  4I6J B;  2OMU A;  3H3H A;  2XSH B;  4WWU C;  3SB4 A;  1OGZ A;  3Q90 A;  2K54 A;  3CVR A;  3WPF A;  1OTO A;  3WPC A;  1W6Y A;  2BNG A;  1DS9 A;  3OGL B;  2BMR B;  1U5O A;  2HMM B;  3FSD A;  4PEQ B;  5AWB A;  3OX9 A;  4HM0 B;  3K0Z A;  3WPE A;  4ECN A;  1FT8 A;  2CHC A;  3FH1 A;  5GMF A;  2WFH A;  2GEX A;  4QC0 A;  4H09 A;  1K5D C;  1ISK A;  3FGY A;  5IG4 A;  3G8Z A;  1KOH A;  4AY9 X;  2A0Z A;  3ZYJ A;  3A76 A;  1OOK G;  4C2B B;  2XRX B;  1CQS A;  4XGO A;  2RFR A;  5IJB A;  1GS3 A;  4R5D A;  3JUM A;  4XBX A;  3OJA B;  3WN4 A;  1ZIW A;  1Q40 B;  5D83 A;  4CP6 A;  2P1N B;  3FLJ A;  3OV4 A;  3KE7 A;  5D82 A;  4CC4 C;  2HMK B;  1YRG A;  3E99 A;  5GS2 B;  2FT3 A;  4C2A B;  8CHO A;  2RCD A;  3F9S A;  5DRE A;  3VGN A;  1XKU A;  4Z61 C;  3CNX A;  1IDP A;  4J8T A;  5STD A;  1H6U A;  4FS7 A;  4Y61 B;  4FHO A;  4ARN A;  1LTX A;  2P1P B;  4R58 A;  4HQ1 A;  4NKG A;  4R0A A;  4ARR A;  5AII A;  5HGR A;  3B4O A;  1OPY A;  2Y5Q A;  1OGQ A;  1A2K A;  3EF8 A;  4XBY A;  4RCW A;  3NXJ A;  2R4I A;  1S5A A;  5IJD A;  4OVM A;  5IEP A;  4MN8 B;  3ER7 A;  5TGN A;  4X2H A;  3G16 A;  4Q3G A;  4U7L A;  4BSU A;  4L7K A;  4R9K A;  4CDL A;  1XEC A;  1H6T A;  5CF2 A;  4OQT A;  1HKX A;  3F7X A;  1EG9 B;  1OGX A;  1WQL B;  4FCG A;  4LXS A;  4X2O A;  1M9S A;  1GY5 A;  3RGA A;  5CF1 A;  3FF2 A;  3NUV A;  3D9R A;  1OF5 B;  2Z66 A;  4HM6 B;  3RGZ A;  1JB4 A;  3MHE A;  3DM8 A;  3E6J A;  5B4P A;  2XWT C;  3G0K A;  4CNM A;  4PEJ A;  3GZR A;  3EBY A;  4U06 A;  3F8X A;  3ECF A;  3MG2 A;  1M10 B;  4IIA A;  5B0T A;  4AW4 A;  3EQQ B;  1NWW A;  3MG3 A;  2P1Q B;  3M18 A;  3WPB A;  1W02 A;  1JKG A;  3GRD A;  4M7E C;  1W00 A;  2O6R A;  3O6N A;  4TZH A;  1DMM A;  4R6F A;  3FZW A;  4L8O A;  1JB5 A;  2JE1 A;  2OMZ A;  3CIY A;  4J9A A;  1XWD C;  2CKF B;  3ULV A;  3RW6 A;  7STD A;  3LYG A;  4ORL A;  3T8U A;  1W01 A;  2A15 A;  5AIH A;  4QBZ A;  5AWC A;  4XB5 A;  4WP6 A;  2UZX A;  3G3B A;  1SJW A;  2B1X B;  4HM1 B;  2OMX A;  4HM4 B;  5JPU A;  2QIY A;  1GWB A;  5B0N A;  4R9L A;  4KNG A;  3C6P B;  4I4K A;  1XCD A;  2Z7X A;  2INX A;  3UL8 A;  3IPT A;  2Z76 A;  3JUN A;  4HM5 B;  5AEW B;  4P91 A;  3RW7 A;  1VZZ A;  3CPO A;  2GBX B;  2BEX A;  2IMJ A;  3OWY A;  2Z81 A;  1NDO B;  4LSA A;  1ULJ B;  4J0M A;  3W3N A;  1GY7 A;  5BVB A;  3DZE A;  4KT1 A;  3GOZ A;  4U08 A;  3EN8 A;  1JN5 B;  4U13 A;  2RGQ A;  1E3V A;  1PGV A;  4UFR A;  1O7N B;  1TP6 A;  3KZT A;  2XOT A;  1OTM A;  4R09 A;  5AZ5 A;  1C7H A;  1FO1 A;  3GZB A;  1QYY A;  4LXR A;  3NV0 B;  4MJD A;  5IER A;  1WWL A;  1OHO A;  4FD0 A;  2O6Q A;  3RGR A;  2YFI B;  4V2C A;  3S5C A;  1UUV B;  3MSO A;  4RZM A;  2B24 B;  1GYB A;  3E4G A;  3REZ A;  4LGQ A;  3F7S A;  3B8L A;  4XSQ A;  3JUO A;  4Q62 A;  2JE0 A;  3EBT A;  3RFS A;  2OMT A;  3G06 A;  3KJ4 A;  5JPP A;  4CNC A;  1OF5 A;  3DMC A;  3HK4 A;  4J4L A;  5IJC A; 
#chains in the Genus database with same CATH topology
 3UL5 A;  1RNT A;  1DVD A;  1FA3 A;  2W0Q A;  3OGK B;  5LFN A;  1Z7X W;  4BTW A;  4YEB B;  3G04 C;  1O7P B;  2BT3 A;  2Y74 A;  5CLK A;  6GSP A;  1EQK A;  4R1K A;  5BXQ A;  2WQX A;  4JF8 A;  2H0I A;  4GHO A;  5CMP A;  3RIZ A;  4R07 A;  1IVV A;  3BNB A;  1ZX2 A;  3CU3 A;  1A67 A;  1RNB A;  3CCS 3;  3E3Z A;  2Z82 A;  2GXF A;  3FF0 A;  2GU3 A;  3SOA A;  3RGX A;  1OHS A;  4XDV A;  3DGY A;  4NKH A;  1X1Y A;  3WDG B;  2AST B;  2H0G A;  4HZ9 B;  4NPB A;  1BRI A;  3HII A;  1BNS A;  3C6O B;  1B20 A;  5HZL B;  1U8C B;  1VQQ A;  4HAA A;  1MOL A;  1EA2 A;  1QJG A;  3STD A;  1IQY A;  3UN9 A;  1BGS A;  1I3I A;  2BMO B;  2Z63 A;  4FMB A;  1YIT 3;  1IQ8 A;  4QWT A;  3MWZ A;  2YFJ B;  1D6Y A;  1RGE A;  5G2G A;  2CFK A;  2XEP A;  2Z62 A;  3G3A A;  1GD3 A;  2C10 A;  4LSO A;  3NM7 A;  3NQZ A;  4XBT A;  1SQ0 B;  3SVA A;  1V74 A;  3UNL A;  1G9U A;  2ASS B;  3BU4 A;  1SII A;  1B27 A;  1WNH A;  4FDW A;  1VQ7 3;  1TFK A;  4XM4 A;  4L8P A;  4BL3 A;  1FQV A;  4KT3 B;  1SQW A;  3I55 3;  1K8A 4;  1FW7 A;  2Z6B A;  3CME 3;  1LXE A;  3TSR E;  4M7E A;  5AEU B;  1LNI A;  2ZL8 A;  3EC9 A;  3X42 A;  1YIJ 3;  3CCQ 3;  4L3A A;  4HZB B;  1NU3 A;  1QMA A;  1RCK A;  2Z65 A;  4R6G A;  1K5G C;  5GS0 A;  3SXX A;  5KP3 A;  5CMN A;  4G1M B;  3G4S 3;  2E2T A;  3FXI A;  5EVH A;  2RR6 A;  4L3F A;  2OQE A;  4CC4 A;  4Z64 C;  4FMA A;  2XR8 B;  1A4Y A;  1PU4 A;  4ILF A;  5RNT A;  1JL5 A;  1N9E A;  1O7W B;  1AR0 A;  1SAR A;  1WMP A;  2P09 A;  3N9H A;  5FW5 A;  2GEY A;  1GMR A;  5D81 A;  3X3Z A;  1OH0 A;  2Y73 A;  2F86 B;  4FCJ A;  2JQD A;  2KF4 A;  3KCH A;  1NB3 I;  1RKY A;  3UL9 A;  4RWT C;  2F99 A;  3EJV A;  3W3L A;  1W2B 2;  5CXO A;  4CIL A;  1AVL A;  2Z7A A;  4WYK B;  2RSX A;  5DRV A;  4PER A;  1UI8 A;  1HYF A;  3PCS A;  3EX9 A;  1AVK A;  1BNJ A;  7RNT A;  3OXA A;  3DXO A;  4XDW A;  2BU4 A;  1ZGX A;  4GB5 A;  3BZ5 A;  3OGM B;  4EZG A;  1G96 A;  5M1A A;  1JN5 A;  2CWV A;  1N9J A;  1TUH A;  4KXF B;  2JQ5 A;  3B4P A;  4R6A A;  4RCA B;  1EUI C;  1I2G A;  2HMJ B;  3WPH A;  4HKV B;  4N3V A;  2GU1 A;  4QXE A;  3S27 A;  3QRD A;  2ELL A;  2W2C A;  1N5H A;  1M1X B;  1BOX A;  5A5C A;  2E2U A;  4HM8 B;  1JBS A;  1L5G B;  2L4V A;  1IQX A;  2QGU A;  2WGQ A;  1RHL A;  3AMO A;  3LZA A;  4CCV A;  4EW5 A;  3F14 A;  2O6S A;  4LSC A;  3SED A;  3CCU 3;  4GL6 A;  4LMI A;  1STF I;  3IMA B;  1IO0 A;  1M9L A;  1FZU A;  4JRF A;  3ROB A;  4IM6 A;  3F40 A;  1Z1S A;  1UW1 A;  1OAC A;  1ULI B;  1O7H B;  3DGO A;  3GSP A;  1O7G B;  2P1M B;  2Z64 A;  4LI1 A;  4R80 A;  1GY6 A;  3CNM A;  3OJA A;  1I3F A;  1Q42 A;  2V70 A;  1Q40 A;  1X1U A;  4FMZ A;  1RGA A;  1YGW A;  1D0B A;  1IU7 A;  1DMQ A;  4HJL B;  5G1L A;  1VQM 3;  3WR2 A;  3KSP A;  1W8A A;  4BSS A;  5AWA A;  4HM7 B;  2W9Q A;  4LSX C;  4LXS A;  1JB2 A;  3OWU A;  1QVG 2;  2UX0 A;  3I0Y A;  4WP5 A;  4PKI G;  1B2Z A;  2F4Y A;  1JNQ A;  1QAL A;  1R4Y A;  3AHS A;  1LNH A;  4RNT A;  2RA8 A;  3W3M A;  4P8S A;  1PY3 A;  1BNE A;  4R6J A;  2IY2 A;  3NBJ A;  3BLZ A;  4Z94 G;  3E2J A;  2UGI A;  3NQY A;  2CK3 H;  3MYT A;  4K1U A;  1UCI A;  3KFQ C;  3X40 A;  2HML B;  1JV2 B;  3D5I A;  3D4A A;  3V98 A;  3ZG5 A;  1O7M B;  4KVH A;  3ULA A;  1W6G A;  2FNQ A;  1M0Z A;  2F5M A;  2QEX 3;  1BNF A;  2OWP A;  3FG4 A;  4G8A A;  1KC8 4;  1O6V A;  1RDS A;  3P72 A;  4H3U A;  1BRN L;  3DGL A;  3FG3 A;  4OUQ A;  1VQ8 3;  1K41 A;  4R5C A;  1LRA A;  1ZS7 A;  2ID5 A;  1DMN A;  3T0U A;  3DZL A;  1Q9E A;  3CMA 3;  2FGT A;  4O2H A;  2V9T B;  2WQV A;  6RNT A;  5EQL A;  2Q4G W;  4WFO A;  3ZYI A;  5D3I A;  2H0H A;  4XOS A;  2YFL B;  3DH2 A;  5CK6 A;  4HVN A;  3F8H A;  4HM3 B;  5IG0 A;  1N8R 4;  6STD A;  4K17 A;  2IFG A;  2STD A;  3T8N A;  3NM2 A;  3CD6 3;  3ZYN A;  3DY5 A;  2WO0 A;  1G0T A;  7GSP A;  1HZ1 A;  1OTN A;  3RFJ A;  3ULU A;  1UUG B;  3U1W A;  1DFJ I;  3K7C A;  2J8X B;  3WOD G;  1W5Z A;  2CC3 A;  1U0N D;  2UZY A;  1M9G A;  5IEN A;  3C6N B;  2WQW A;  3G71 3;  4GLP A;  4O3V A;  2AAD A;  3FKA A;  3M19 A;  3VQ1 A;  1E97 A;  4LEH A;  4BL2 A;  3RJ0 A;  2V1L A;  4LZI A;  2XH9 A;  1DYU A;  2HMO B;  2BMQ B;  3JUP A;  3BNC A;  3CCE 3;  1JRQ A;  1DCE A;  3NV0 A;  4PQ8 A;  4PSJ A;  4V2E A;  3EN1 B;  4EV5 A;  4Q3I A;  5GQR K;  3MKI A;  4IT7 A;  3JUQ A;  4EBG A;  3A5E A;  2M7O A;  3FCS B;  1WTH A;  3HZP A;  3LTA A;  2OTJ 3;  2BNH A;  4K1V A;  4N6U A;  5AIG A;  4EC6 A;  3WPI A;  1ZO2 A;  3X3Y A;  2WOH A;  3O8Y A;  5FGO A;  1KD1 4;  1BUQ A;  4Z8G A;  3EHC A;  1MNL A;  3I56 3;  2KF5 A;  4FCM A;  3GZY B;  4N6O B;  1IVU A;  1RN1 A;  5IEO A;  2WQU A;  5AYR B;  4KFE A;  1P8V A;  5IYX C;  5GMH A;  1GOY A;  4STD A;  1RGH A;  1OUN A;  2OQE C;  3DUK A;  3MG1 A;  4WYK A;  5HOH A;  2HMN B;  3HOH A;  3SYU A;  2MF7 A;  1BNI A;  1BSA A;  2I9W A;  4FMD A;  2IUJ A;  3ZYO A;  3W3K A;  1BSD A;  3PCR A;  1BRJ A;  2Q07 A;  4HYZ A;  3SLU A;  1K5D C;  1BAN A;  3UJM A;  3A79 B;  4GT6 A;  1BSC A;  1BRK A;  3BB9 A;  4HOH A;  1VQ9 3;  1P9A G;  4U09 A;  2PZV A;  3VQ2 A;  4Z79 A;  3CXC 2;  1UGH I;  2P1O B;  2ZA4 A;  2HOH A;  3UL7 A;  1JBR A;  2XSO B;  5AIF A;  3J7Y d;  5AWD A;  3AGN A;  3GWR A;  3L0R A;  3SOY A;  1OZN A;  1K9M 4;  3KKG A;  3NBB A;  1P8T A;  4ECO A;  1MWR A;  1STD A;  1M1K 4;  1FYS A;  3WMD A;  3GAX A;  3O53 A;  2RNT A;  3GZX B;  2CX0 A;  3Q3F A;  8RNT A;  1LVN A;  1WMO A;  3NHX A;  3PMH G;  5IG3 A;  5A0O B;  3CC7 3;  3AMO B;  3RFE A;  3CCJ 3;  3HX8 A;  1W4N A;  3H51 A;  1A9N A;  5IG5 A;  3WA3 A;  2R9U A;  1JKG B;  3NBR A;  2GBW B;  1QAF A;  1E3R A;  2V9S A;  1MWS A;  1OHP A;  2C11 A;  2L1S A;  4AEQ A;  3HI7 A;  1VQN 3;  5GMG A;  3Q2P A;  1SPU A;  1YI2 3;  4B8C D;  3WPD A;  5AI1 A;  3OWS A;  4HM2 B;  1AQZ A;  1GOV A;  5KP4 A;  1DE3 A;  3JB9 j;  1A2V A;  4I5Q A;  5KP1 A;  1TIJ A;  5HDH A;  1DVC A;  2W56 A;  5FTT B;  1NB5 I;  3M8C A;  1B2S A;  1T5Y A;  1PYL A;  1FUS A;  4RNZ A;  1O6S A;  2CFL A;  4J5G A;  1O6T A;  3PYJ A;  3G39 A;  1XEU A;  2OMY A;  1BSB A;  4LSX A;  1RGL A;  3WPG A;  5IF6 A;  1RRH A;  4BIR A;  1B2X A;  3KN4 A;  1S72 3;  2OMV A;  4LI2 A;  2K0M A;  3K63 A;  2AAE A;  3ZG0 A;  1OCV A;  3WOF B;  2ZDJ A;  3B7C A;  3LH4 A;  4R08 A;  1LOW A;  1FGM A;  3AHW A;  1B2U A;  1V58 A;  1I0V A;  4Q53 A;  3VSY A;  1Q86 4;  2Z7X B;  4V2D A;  4BV4 R;  2F98 A;  3SX1 A;  1VQO 3;  1KOO A;  3BIR A;  2F5W A;  3W3J A;  1BIR A;  3LOY A;  1G02 A;  1IVX A;  3X3X A;  1BAO A;  1UUW B;  4ZM8 A;  2XGL A;  2Z77 A;  4EV2 A;  1ASK A;  1RCL A;  3CC2 3;  2W04 A;  2OMW A;  3W3G A;  1FGQ A;  1BUJ A;  2CA6 A;  4MQW X;  4H61 A;  4I6J B;  2OMU A;  1T2I A;  2OTL 3;  1FUW A;  3H3H A;  2ML5 A;  2XFS A;  2XSH B;  4WWU C;  4GSP A;  1CH0 A;  4N6M A;  4DKI A;  2CFD A;  3SB4 A;  1OGZ A;  3Q90 A;  2K54 A;  4QC0 A;  1VQ4 3;  3CVR A;  2RBI A;  3K5T A;  3WPF A;  1OTO A;  3WPC A;  4CPK A;  1JZO A;  1W6Y A;  1HU9 A;  2BNG A;  1Q7H A;  4MMX B;  2BMR B;  1YHQ 3;  1U5O A;  3OGL B;  1DS9 A;  2HMM B;  3FSD A;  4PEQ B;  1K28 A;  1Q82 4;  3OX9 A;  4HM0 B;  1YJ9 3;  5AWB A;  3K0Z A;  3LTC A;  4ECN A;  3WPE A;  1FT8 A;  4AKZ A;  2YX9 A;  1Q7Y 4;  2CHC A;  2W6J H;  1W6C A;  3FH1 A;  4AKY A;  2XGN A;  4J5K A;  5GMF A;  1AY7 A;  3RNT A;  2WFH A;  2GEX A;  1I8V A;  4H09 A;  1A2P A;  3LT9 A;  1GSP A;  1DET A;  3FGY A;  1JBT A;  1ISK A;  1QAK A;  3G8Z A;  5IG4 A;  1ROV A;  1KOH A;  3PZW A;  4AY9 X;  1QVF 2;  3KSE D;  1IK3 A;  2A0Z A;  2CFW A;  3X41 A;  3V92 A;  1GOU A;  3QK9 A;  4NZR M;  4BU4 A;  3ZYJ A;  1RTU A;  3A76 A;  2CW9 A;  5GSP A;  1OOK G;  4C2B B;  2XRX B;  1CQS A;  4XGO A;  2RFR A;  5IJB A;  1UCK A;  1GS3 A;  1TRQ A;  1EKM A;  4R5D A;  1I0X A;  3JUM A;  4MEI A;  4XBX A;  3OJA B;  3WN4 A;  1ZIW A;  1Q40 B;  5D83 A;  1RRL A;  1RMS A;  4CP6 A;  3G6E 3;  2ZHX B;  4RNY A;  2P1N B;  4OK0 A;  3FLJ A;  1MWT A;  1TTO A;  2BO9 B;  1N5P A;  1SIH A;  2OCT A;  2KF3 A;  2P05 A;  3KE7 A;  1RJO A;  4R4K A;  5D82 A;  2FXT A;  4CC4 C;  2HMK B;  1YRG A;  1YVB I;  3E99 A;  5GS2 B;  2FT3 A;  3WOE B;  2D42 A;  4C2A B;  2CH9 A;  2RCD A;  2W9P A;  3F9S A;  8CHO A;  5DRE A;  3VGN A;  3PS8 A;  3CCM 3;  2JDI H;  5BU4 A;  1Y4K A;  4EXR A;  3EB8 A;  1XKU A;  3CNX A;  4Z61 C;  1IDP A;  2BHM A;  3IJE B;  4J8T A;  4LYL B;  5STD A;  1TFO A;  2IA7 A;  4FMC A;  1BRG A;  2ML6 A;  1H6U A;  4FS7 A;  4Y61 B;  1KSI A;  4FHO A;  1IYY A;  5LC6 A;  1IT7 A;  4ARN A;  1LTX A;  2P1P B;  1D6Z A;  5AYS C;  4R58 A;  4HQ1 A;  4NKG A;  2R41 A;  1FS2 A;  1NO3 A;  4ARR A;  4R0A A;  1KWI A;  1RSN A;  3DGN A;  1VQK 3;  1C54 A;  3ULV A;  1UDI I;  4MMY B;  3CC4 3;  3ZFZ A;  5AII A;  5HGR A;  3B4O A;  1OPY A;  1GMP A;  2Y5Q A;  2MC8 A;  1FUT A;  1OGQ A;  4MMZ B;  1M9S A;  1A2K A;  2KAA A;  1F8N A;  3EF8 A;  3PXM A;  4K61 A;  4XBY A;  4RCW A;  3NXJ A;  2R4I A;  1S5A A;  3CCR 3;  1LOY A;  5IJD A;  4OVM A;  4N6V 0;  1CYV A;  5IEP A;  3TDG A;  4NRE A;  3ER7 A;  1UCL A;  5LC7 A;  4X2H A;  3Q1C A;  2P0M A;  3G16 A;  5TGN A;  4Q3G A;  3WA2 X;  4U7L A;  4BSU A;  1MGR A;  4L7K A;  4R9K A;  4CDL A;  4HBR A;  1XEC A;  3CCV 3;  1H6T A;  5CF2 A;  4OQT A;  3FG1 A;  1IV7 A;  1HKX A;  4O02 B;  1YGE A;  1US1 A;  5G1K A;  1BU4 A;  3F7X A;  1EG9 B;  1OGX A;  1WQL B;  4FCG A;  2CG0 A;  2K3D A;  4X2O A;  1RGF A;  2P38 A;  1B3S A;  1T3B A;  1BNG A;  1GY5 A;  1I2E A;  1EEJ A;  3AGO A;  1YJN 3;  1R4C A;  1KQS 2;  3RGA A;  2WOF A;  1LOX A;  5CF1 A;  4N6T A;  3FF2 A;  2F56 A;  3NUV A;  3D9R A;  1TJD A;  3V99 A;  3DGM A;  1OF5 B;  4KFD A;  2D1W A;  3OV4 A;  1T2H A;  3U97 A;  1RGG A;  2Z66 A;  4N6L A;  2P0X A;  4HM6 B;  3RGZ A;  1V57 A;  1JB4 A;  1BSE A;  3MHE A;  3DM8 A;  4KZ1 A;  4FR9 A;  5ELU A;  5I97 A;  3E6J A;  2XWT C;  2CG1 A;  4NZT M;  5B4P A;  1BRH A;  1MGW A;  3G0K A;  4CNM A;  1N8Q A;  4PEJ A;  3S28 A;  1W7C A;  3GZR A;  3EBY A;  1BVI A;  4U06 A;  1GMQ A;  2IYJ A;  3F8X A;  3N8B A;  3KII A;  1PFP A;  3ECF A;  2IUK A;  3JVC A;  3UB1 A;  3RW6 A;  1B21 A;  3MG2 A;  2OOV A;  1TU5 A;  4IIA A;  1M10 B;  5B0T A;  1YJW 3;  3CIG A;  2BIR A;  4AW4 A;  1I2F A;  3EQQ B;  2CWT A;  2OOV C;  1NWW A;  3LT8 A;  3MG3 A;  4KFF A;  2P1Q B;  3M18 A;  3WPB A;  2E2V A;  1IV9 A;  2KXG A;  1W02 A;  1ROA A;  1JKG A;  3GRD A;  4M7E C;  1W00 A;  2O6R A;  3O6N A;  4TZH A;  1DMM A;  3K9M C;  4R6F A;  4TX4 A;  4MN8 B;  3FZW A;  1J2B A;  4L8O A;  1JB5 A;  4K90 B;  5IW9 A;  5JBS A;  1VQ6 3;  2JE1 A;  2OMZ A;  3CIY A;  4J9A A;  1W2Z A;  1XWD C;  1WMN A;  2CKF B;  3BND A;  3D79 A;  1NNV A;  4NHF A;  3HIG A;  7STD A;  3LYG A;  1JZD A;  2W56 B;  4ORL A;  4BSR A;  3T8U A;  1W01 A;  2SAR A;  2A15 A;  5AIH A;  1NJI 4;  3PGB A;  2XF3 A;  1CEW I;  4BTX A;  2WGO A;  2SBL A;  4QBZ A;  4XB5 A;  4WP6 A;  5AWC A;  2UZX A;  3G3B A;  3UL6 A;  1SJW A;  2B1X B;  4HM1 B;  1MWU A;  1RN4 A;  2UUG C;  4HM4 B;  2OMX A;  5JPU A;  2QIY A;  1GWB A;  1IVW A;  2CIU A;  3LXU X;  4CJN A;  2CX1 A;  4R9L A;  1M90 4;  5BIR A;  4KNG A;  3C6P B;  5B0N A;  4I4K A;  1XCD A;  2Z7X A;  2INX A;  1A90 A;  3UL8 A;  2GSP A;  1YNV X;  1YVS A;  3BNE A;  3IPT A;  2Z76 A;  2W03 A;  3JUN A;  4HM5 B;  5AEW B;  4P91 A;  3CPW 2;  3RW7 A;  2PNC A;  3S67 A;  2KF6 A;  1VZZ A;  3CPO A;  2GBX B;  2BEX A;  3MPH A;  1RN7 A;  1VQL 3;  1FGT A;  2IMJ A;  5M18 A;  3OWY A;  1K73 4;  1NDO B;  2Z81 A;  1VQ5 3;  4LSA A;  3VF1 A;  1UI7 A;  1ULJ B;  3ALA A;  4J0M A;  4FD0 A;  1B2M A;  2XFT A;  3W3N A;  1JJ2 2;  1GY7 A;  5BVB A;  1BNR A;  3DZE A;  4KT1 A;  2LQV A;  3GOZ A;  4U08 A;  3EN8 A;  1JN5 B;  1AV4 A;  2CWU A;  5M19 A;  1RGK A;  1UCJ A;  2RGQ A;  1E3V A;  2C4B A;  4U13 A;  1PGV A;  4UFR A;  1O7N B;  9RNT A;  1TRP A;  1TP6 A;  1BRS A;  3KZT A;  1OTM A;  2XOT A;  4R09 A;  5AZ5 A;  4IPB A;  1C7H A;  1FO1 A;  3GZB A;  4EYC A;  1QYY A;  1GD4 A;  1FGR A;  2KRT A;  4LXR A;  1VQP 3;  3NV0 B;  3N54 B;  4MJD A;  2O3O A;  5IER A;  1OHO A;  3WHO A;  3D5G A;  3CCL 3;  1WWL A;  1RGC A;  3RGR A;  2O6Q A;  3LTB A;  1FGO A;  1X1W A;  2YFI B;  3NX0 A;  2LYX A;  4V2C A;  4RBN A;  1UUV B;  3MSO A;  4RZM A;  2B24 B;  4O8S A;  3S5C A;  2CFG A;  1GYB A;  1RLS A;  1LQG C;  3RDE A;  1D6U A;  4BTY A;  3E4G A;  4LGQ A;  5EEO A;  3F7S A;  1LQM B;  3B8L A;  1CYU A;  1Q81 4;  4XSQ A;  3REZ A;  1LOV A;  1X1X A;  3JUO A;  4Q62 A;  1UGI A;  2O9U X;  3EBT A;  1IT8 A;  3EE1 A;  3LML A;  3LTD A;  5ELJ A;  3URP A;  2JE0 A;  3RFS A;  2OMT A;  3G06 A;  1I70 A;  3KJ4 A;  4N6N B;  5JPP A;  4CNC A;  4FCZ A;  1OF5 A;  3D3L A;  3DMC A;  3S29 A;  2QA4 3;  3HK4 A;  4J4L A;  4WHA A;  2KCD A;  3OW2 2;  5IJC A; 
#chains in the Genus database with same CATH homology
 3UL5 A;  1DVD A;  1FA3 A;  2W0Q A;  3OGK B;  5LFN A;  1Z7X W;  4BTW A;  4YEB B;  3G04 C;  1O7P B;  2BT3 A;  2Y74 A;  5CLK A;  1EQK A;  4R1K A;  5BXQ A;  2WQX A;  4JF8 A;  5CMP A;  3RIZ A;  4R07 A;  1IVV A;  3BNB A;  1ZX2 A;  3CU3 A;  1A67 A;  3CCS 3;  3E3Z A;  2Z82 A;  2GXF A;  3FF0 A;  2GU3 A;  3SOA A;  3RGX A;  1OHS A;  4XDV A;  4NKH A;  3WDG B;  2AST B;  4HZ9 B;  3HII A;  3C6O B;  5HZL B;  1U8C B;  1MOL A;  1EA2 A;  1QJG A;  3STD A;  1IQY A;  3UN9 A;  2BMO B;  2Z63 A;  4FMB A;  1YIT 3;  1IQ8 A;  4QWT A;  3MWZ A;  2YFJ B;  1D6Y A;  5G2G A;  3G3A A;  2CFK A;  2XEP A;  1GD3 A;  2C10 A;  4LSO A;  3NM7 A;  3NQZ A;  4XBT A;  1SQ0 B;  3SVA A;  1V74 A;  3UNL A;  1G9U A;  2ASS B;  1SII A;  1WNH A;  4FDW A;  1VQ7 3;  1TFK A;  4XM4 A;  4L8P A;  1FQV A;  1SQW A;  3I55 3;  1K8A 4;  3TSR E;  2Z6B A;  3CME 3;  1LXE A;  4M7E A;  5AEU B;  2ZL8 A;  3EC9 A;  3X42 A;  1YIJ 3;  3CCQ 3;  4L3A A;  4HZB B;  1NU3 A;  1QMA A;  2Z65 A;  4R6G A;  1K5G C;  5GS0 A;  3SXX A;  5KP3 A;  5CMN A;  4G1M B;  3G4S 3;  2E2T A;  3FXI A;  5EVH A;  2RR6 A;  4L3F A;  2OQE A;  4CC4 A;  4Z64 C;  4FMA A;  2XR8 B;  1A4Y A;  1PU4 A;  1JL5 A;  1N9E A;  1O7W B;  1AR0 A;  5FW5 A;  1WMP A;  2P09 A;  3N9H A;  2GEY A;  5D81 A;  3X3Z A;  1OH0 A;  2Y73 A;  2F86 B;  4FCJ A;  2JQD A;  1RKY A;  1NB3 I;  3UL9 A;  3W3L A;  4RWT C;  2F99 A;  3EJV A;  1W2B 2;  5CXO A;  4CIL A;  1AVL A;  2Z7A A;  4WYK B;  2RSX A;  5DRV A;  4PER A;  1UI8 A;  3PCS A;  3EX9 A;  1AVK A;  3OXA A;  3DXO A;  4XDW A;  4GB5 A;  3BZ5 A;  3OGM B;  4EZG A;  1G96 A;  1JN5 A;  2CWV A;  1N9J A;  1TUH A;  4KXF B;  2JQ5 A;  3B4P A;  4R6A A;  4RCA B;  3WPH A;  2HMJ B;  4HKV B;  4N3V A;  2GU1 A;  4QXE A;  3S27 A;  3QRD A;  2ELL A;  2W2C A;  1N5H A;  1M1X B;  5A5C A;  2E2U A;  4HM8 B;  1L5G B;  2L4V A;  1IQX A;  2QGU A;  2WGQ A;  3LZA A;  3AMO A;  4CCV A;  3F14 A;  2O6S A;  4LSC A;  3SED A;  3CCU 3;  4GL6 A;  4LMI A;  1STF I;  3IMA B;  1IO0 A;  1M9L A;  4IM6 A;  4JRF A;  3ROB A;  3F40 A;  1Z1S A;  1UW1 A;  1OAC A;  1ULI B;  1O7H B;  3DGO A;  1O7G B;  2P1M B;  2Z64 A;  4LI1 A;  4R80 A;  1GY6 A;  3CNM A;  3OJA A;  2V70 A;  1Q42 A;  4FMZ A;  1Q40 A;  1D0B A;  2Z62 A;  1IU7 A;  1DMQ A;  4HJL B;  1VQM 3;  1W8A A;  3KSP A;  5AWA A;  4HM7 B;  2W9Q A;  4LSX C;  1JB2 A;  3OWU A;  1QVG 2;  2UX0 A;  3I0Y A;  4WP5 A;  4PKI G;  1JNQ A;  1QAL A;  2RA8 A;  3W3M A;  1LNH A;  4R6J A;  3NBJ A;  3BLZ A;  4Z94 G;  3E2J A;  3NQY A;  2CK3 H;  3MYT A;  4K1U A;  3X40 A;  3KFQ C;  1FS2 A;  2HML B;  1JV2 B;  3ULA A;  3V98 A;  1O7M B;  4KVH A;  1W6G A;  2FNQ A;  1M0Z A;  2QEX 3;  2OWP A;  3FG4 A;  4G8A A;  1KC8 4;  1O6V A;  3P72 A;  4H3U A;  3DGL A;  3FG3 A;  4OUQ A;  1VQ8 3;  1K41 A;  4R5C A;  2ID5 A;  1DMN A;  3T0U A;  3DZL A;  3CMA 3;  2FGT A;  4O2H A;  2V9T B;  2WQV A;  5EQL A;  2Q4G W;  4WFO A;  3ZYI A;  5D3I A;  4XOS A;  2YFL B;  5CK6 A;  4HVN A;  3F8H A;  4HM3 B;  5IG0 A;  1N8R 4;  6STD A;  4K17 A;  2IFG A;  2STD A;  3T8N A;  3NM2 A;  3CD6 3;  3ZYN A;  3DY5 A;  2WO0 A;  3ULU A;  1OTN A;  3RFJ A;  3U1W A;  1DFJ I;  3K7C A;  3WOD G;  1W5Z A;  2CC3 A;  1U0N D;  2UZY A;  1M9G A;  5IEN A;  3C6N B;  2WQW A;  3G71 3;  4GLP A;  4O3V A;  3FKA A;  3M19 A;  3VQ1 A;  1E97 A;  4LEH A;  3RJ0 A;  2V1L A;  4LZI A;  2XH9 A;  1DYU A;  2HMO B;  2BMQ B;  3JUP A;  3BNC A;  3CCE 3;  1JRQ A;  1DCE A;  3NV0 A;  4PQ8 A;  4PSJ A;  4V2E A;  3EN1 B;  4EV5 A;  4Q3I A;  5GQR K;  3MKI A;  4IT7 A;  3JUQ A;  4EBG A;  2M7O A;  3FCS B;  1WTH A;  3HZP A;  3LTA A;  2OTJ 3;  2BNH A;  4K1V A;  4N6U A;  5AIG A;  4EC6 A;  3WPI A;  1ZO2 A;  3X3Y A;  2WOH A;  3O8Y A;  5FGO A;  1KD1 4;  1BUQ A;  4Z8G A;  3EHC A;  1MNL A;  3I56 3;  4FCM A;  3GZY B;  4N6O B;  1IVU A;  5IEO A;  2WQU A;  5AYR B;  4KFE A;  1P8V A;  5IYX C;  5GMH A;  4STD A;  2OQE C;  1OUN A;  3DUK A;  3MG1 A;  4WYK A;  2HMN B;  2MF7 A;  2I9W A;  2IUJ A;  4FMD A;  3ZYO A;  3W3K A;  3PCR A;  3A79 B;  2Q07 A;  3SLU A;  4GT6 A;  4P8S A;  4BSS A;  3UJM A;  4U09 A;  3CIG A;  1P9A G;  3BB9 A;  1VQ9 3;  2PZV A;  3VQ2 A;  4Z79 A;  3CXC 2;  2P1O B;  3UL7 A;  5AWD A;  2XSO B;  5AIF A;  3J7Y d;  3GWR A;  3L0R A;  3SOY A;  1OZN A;  1K9M 4;  3KKG A;  3NBB A;  1P8T A;  4ECO A;  1STD A;  1M1K 4;  3WMD A;  3GAX A;  3O53 A;  3GZX B;  1LVN A;  1WMO A;  3NHX A;  3PMH G;  5IG3 A;  5A0O B;  3AMO B;  3RFE A;  3CCJ 3;  3HX8 A;  1W4N A;  3H51 A;  1A9N A;  5IG5 A;  3WA3 A;  2R9U A;  1JKG B;  3NBR A;  2GBW B;  1QAF A;  1E3R A;  2V9S A;  1OHP A;  5GMG A;  2C11 A;  4AEQ A;  1VQN 3;  3HI7 A;  3Q2P A;  1SPU A;  1YI2 3;  4B8C D;  3WPD A;  5AI1 A;  3OWS A;  4HM2 B;  5KP4 A;  3JB9 j;  1A2V A;  5KP1 A;  1TIJ A;  5HDH A;  1DVC A;  2W56 A;  5FTT B;  1NB5 I;  3M8C A;  1T5Y A;  1O6S A;  1O6T A;  4RNZ A;  2CFL A;  3PYJ A;  3G39 A;  1XEU A;  2OMY A;  4LSX A;  3WPG A;  5IF6 A;  1RRH A;  2OMV A;  3KN4 A;  1S72 3;  4LI2 A;  2K0M A;  3K63 A;  1OCV A;  3WOF B;  2ZDJ A;  3B7C A;  3LH4 A;  4R08 A;  1FGM A;  1Q86 4;  4Q53 A;  3VSY A;  2Z7X B;  4V2D A;  4BV4 R;  2F98 A;  3SX1 A;  1VQO 3;  1KOO A;  3W3J A;  3LOY A;  1IVX A;  3X3X A;  3CC2 3;  1UUW B;  4ZM8 A;  2XGL A;  2Z77 A;  4EV2 A;  1ASK A;  3W3G A;  2OMW A;  2W04 A;  1FGQ A;  2CA6 A;  4MQW X;  4H61 A;  4I6J B;  2OMU A;  2OTL 3;  1FUW A;  3H3H A;  2ML5 A;  2XFS A;  2XSH B;  4WWU C;  4N6M A;  3SB4 A;  2CFD A;  1OGZ A;  3Q90 A;  2K54 A;  1VQ4 3;  3CVR A;  3K5T A;  3WPF A;  1OTO A;  3WPC A;  1W6Y A;  2BNG A;  1HU9 A;  1YHQ 3;  4MMX B;  3OGL B;  2BMR B;  1DS9 A;  1U5O A;  2HMM B;  3FSD A;  4PEQ B;  1K28 A;  1Q82 4;  3OX9 A;  4HM0 B;  1YJ9 3;  5AWB A;  3K0Z A;  3LTC A;  4ECN A;  3WPE A;  1FT8 A;  4AKZ A;  2YX9 A;  1Q7Y 4;  2CHC A;  2W6J H;  1W6C A;  3FH1 A;  4AKY A;  2XGN A;  5GMF A;  2WFH A;  2GEX A;  4QC0 A;  4H09 A;  3LT9 A;  1ISK A;  1K5D C;  3FGY A;  1QAK A;  3G8Z A;  5IG4 A;  1ROV A;  1KOH A;  3PZW A;  4AY9 X;  1QVF 2;  3KSE D;  1IK3 A;  2A0Z A;  2CFW A;  3X41 A;  3V92 A;  3QK9 A;  3ZYJ A;  3A76 A;  2CW9 A;  1OOK G;  4C2B B;  2XRX B;  1CQS A;  4XGO A;  2RFR A;  5IJB A;  1GS3 A;  1EKM A;  4R5D A;  3JUM A;  4MEI A;  4XBX A;  3OJA B;  3WN4 A;  1ZIW A;  1Q40 B;  5D83 A;  1RRL A;  4CP6 A;  3G6E 3;  4RNY A;  2P1N B;  4OK0 A;  3FLJ A;  1N5P A;  1SIH A;  2BO9 B;  2P05 A;  3KE7 A;  2OCT A;  3OV4 A;  4HYZ A;  4R4K A;  1RJO A;  5D82 A;  3CC7 3;  2FXT A;  4CC4 C;  2HMK B;  1YRG A;  1YVB I;  3E99 A;  5GS2 B;  2FT3 A;  3WOE B;  2D42 A;  4C2A B;  2CH9 A;  2RCD A;  2W9P A;  3F9S A;  8CHO A;  5DRE A;  3VGN A;  3PS8 A;  3CCM 3;  2JDI H;  1XKU A;  1Y4K A;  4EXR A;  3EB8 A;  4Z61 C;  3CNX A;  1IDP A;  2BHM A;  3IJE B;  4J8T A;  5STD A;  1TFO A;  2IA7 A;  4FMC A;  1H6U A;  2ML6 A;  4FS7 A;  4Y61 B;  1KSI A;  4FHO A;  5LC6 A;  1IT7 A;  4ARN A;  1LTX A;  2P1P B;  1D6Z A;  5AYS C;  4R58 A;  4HQ1 A;  4NKG A;  4R0A A;  4ARR A;  1NO3 A;  1KWI A;  3DGN A;  1VQK 3;  4MMY B;  3CC4 3;  5AII A;  5HGR A;  3B4O A;  1OPY A;  2Y5Q A;  2MC8 A;  1OGQ A;  4MMZ B;  1A2K A;  1F8N A;  3EF8 A;  3PXM A;  4K61 A;  4XBY A;  4RCW A;  3NXJ A;  2R4I A;  1S5A A;  3CCR 3;  5IJD A;  4OVM A;  4N6V 0;  1CYV A;  5IEP A;  3TDG A;  4NRE A;  3ER7 A;  5LC7 A;  5TGN A;  4X2H A;  3Q1C A;  2P0M A;  3G16 A;  4Q3G A;  4MN8 B;  3WA2 X;  4U7L A;  4BSU A;  4L7K A;  4R9K A;  4CDL A;  4HBR A;  1XEC A;  3CCV 3;  1H6T A;  5CF2 A;  4OQT A;  3FG1 A;  1IV7 A;  1HKX A;  4O02 B;  1YGE A;  1US1 A;  3F7X A;  1EG9 B;  1OGX A;  1WQL B;  4FCG A;  2CG0 A;  4LXS A;  4X2O A;  2P38 A;  1YJN 3;  1GY5 A;  1M9S A;  1KQS 2;  1R4C A;  3RGA A;  2WOF A;  1LOX A;  5CF1 A;  4N6T A;  3FF2 A;  3NUV A;  3D9R A;  3V99 A;  3DGM A;  1OF5 B;  4KFD A;  2D1W A;  3U97 A;  2Z66 A;  4N6L A;  2P0X A;  4HM6 B;  3RGZ A;  1JB4 A;  3MHE A;  3DM8 A;  4KZ1 A;  4FR9 A;  5ELU A;  5I97 A;  3E6J A;  2XWT C;  2CG1 A;  5B4P A;  3G0K A;  4CNM A;  1N8Q A;  4PEJ A;  3S28 A;  1W7C A;  3GZR A;  3EBY A;  4U06 A;  3F8X A;  3N8B A;  3KII A;  1PFP A;  3ECF A;  2IUK A;  3JVC A;  3UB1 A;  3MG2 A;  2OOV A;  1TU5 A;  1M10 B;  4IIA A;  5B0T A;  1YJW 3;  4AW4 A;  3EQQ B;  2CWT A;  2OOV C;  1NWW A;  3LT8 A;  3MG3 A;  4KFF A;  2P1Q B;  3M18 A;  3WPB A;  2E2V A;  1IV9 A;  2KXG A;  1ROA A;  1JKG A;  1W02 A;  3GRD A;  4M7E C;  1W00 A;  2O6R A;  3O6N A;  4TZH A;  1DMM A;  3K9M C;  4R6F A;  4TX4 A;  3FZW A;  1J2B A;  4L8O A;  1JB5 A;  4K90 B;  5IW9 A;  5JBS A;  1VQ6 3;  2JE1 A;  2OMZ A;  3CIY A;  4J9A A;  1W2Z A;  1XWD C;  1WMN A;  2CKF B;  3BND A;  4NHF A;  4BSR A;  3ULV A;  3HIG A;  7STD A;  3LYG A;  2W56 B;  3RW6 A;  4ORL A;  3T8U A;  1W01 A;  2A15 A;  5AIH A;  1NJI 4;  3PGB A;  2XF3 A;  1CEW I;  4BTX A;  2WGO A;  2SBL A;  4QBZ A;  4XB5 A;  4WP6 A;  5AWC A;  2UZX A;  3G3B A;  3UL6 A;  1SJW A;  2B1X B;  4HM1 B;  2OMX A;  4HM4 B;  5JPU A;  2QIY A;  1GWB A;  1IVW A;  2CIU A;  3LXU X;  1M90 4;  4R9L A;  4KNG A;  5B0N A;  3C6P B;  4I4K A;  1XCD A;  2Z7X A;  2INX A;  1A90 A;  3UL8 A;  3BNE A;  3IPT A;  2Z76 A;  2W03 A;  3JUN A;  4HM5 B;  5AEW B;  4P91 A;  3CPW 2;  3RW7 A;  2PNC A;  3S67 A;  1VZZ A;  3CPO A;  2GBX B;  2BEX A;  3MPH A;  1RN7 A;  1VQL 3;  1FGT A;  2IMJ A;  1K73 4;  3OWY A;  2Z81 A;  1NDO B;  4LSA A;  1VQ5 3;  3VF1 A;  1UI7 A;  1ULJ B;  3ALA A;  4J0M A;  2XFT A;  3W3N A;  1JJ2 2;  1GY7 A;  5BVB A;  3DZE A;  4KT1 A;  2LQV A;  3GOZ A;  4U08 A;  3EN8 A;  1JN5 B;  1AV4 A;  2CWU A;  4U13 A;  2RGQ A;  1E3V A;  1PGV A;  4UFR A;  1O7N B;  1TP6 A;  3KZT A;  2XOT A;  1OTM A;  4R09 A;  5AZ5 A;  4IPB A;  1C7H A;  1FO1 A;  3GZB A;  4EYC A;  1QYY A;  1GD4 A;  1FGR A;  2KRT A;  4LXR A;  1VQP 3;  3NV0 B;  3N54 B;  4MJD A;  2O3O A;  5IER A;  1OHO A;  3CCL 3;  1WWL A;  4FD0 A;  2O6Q A;  3RGR A;  3LTB A;  1FGO A;  2YFI B;  3NX0 A;  4V2C A;  2LYX A;  4RBN A;  1UUV B;  3MSO A;  4RZM A;  2B24 B;  4O8S A;  3S5C A;  2CFG A;  1GYB A;  3RDE A;  4BTY A;  1D6U A;  3E4G A;  3REZ A;  4LGQ A;  5EEO A;  3F7S A;  3B8L A;  1CYU A;  4XSQ A;  1Q81 4;  3JUO A;  4Q62 A;  2O9U X;  3EE1 A;  3EBT A;  1IT8 A;  3LML A;  3LTD A;  5ELJ A;  2JE0 A;  3RFS A;  2OMT A;  3G06 A;  3KJ4 A;  4N6N B;  5JPP A;  4CNC A;  4FCZ A;  1OF5 A;  3D3L A;  3DMC A;  3S29 A;  2QA4 3;  3HK4 A;  4J4L A;  4WHA A;  2KCD A;  3OW2 2;  5IJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...