4WYKA

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
344
Chain Sequence
b'ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear RNA export factor 1
molecule tags Transport protein
source organism Homo sapiens
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
total genus 87
structure length 344
sequence length 347
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4wykA01
4LSXC 2HMKB 3NBRA 3RIZA 1XEUA 1OZNA 2QGUA 4NKGA 3W3GA 5AWAA 4YEBB 3KSPA 1OTOA 4FCGA 4Q3GA 4TZHA 1Q40B 4LXSA 1ASKA 3SEDA 1FT8A 2BMRB 5JPUA 2R4IA 4LSXA 2JQDA 4BSUA 3GWRA 1H6UA 1P8VA 2JE0A 5AEUB 2XSOB 1S5AA 4U13A 1XWDC 5IJBA 3OWSA 1P9AG 1UUWB 2WQVA 2B24B 4CNMA 3ZYOA 1DMQA 1W8AA 1DMNA 3EBYA 1GY5A 3ZYJA 4ARRA 1JN5A 4L8PA 4R5CA 4R58A 4R09A 2HMLB 5AIHA 3RW6A 5CK6A 2OWPA 3I0YA 2GEXA 5D83A 1W01A 3OGKB 2Z7XA 1O7MB 3M18A 3OXAA 1VZZA 5KP3A 1JL5A 4FCMA 4PEQB 3JUQA 1Q40A 4HM0B 1QYYA 5D82A 2GEYA 1JB2A 2Z64A 1XKUA 2I9WA 4EZGA 4WYKA 5AIIA 2HMNB 1H6TA 1O6VA 3EF8A 4QC0A 4K1UA 4CP6A 4FD0A 4XDWA 4L3FA 4Q62A 1QJGA 4H3UA 1KOHA 4PKIG 3F40A 3FXIA 1OTMA 3UN9A 3KKGA 1O6SA 2WQXA 1IDPA 3MSOA 3KJ4A 3OGMB 2XR8B 2UZYA 4PSJA 3WN4A 5IG0A 3JUOA 2P1QB 3E99A 3GZRA 4Z79A 4HKVB 1JN5B 1O7GB 2OMZA 1STDA 4H09A 2V70A 5AWCA 2F99A 3GOZA 1IO0A 4HM4B 5D3IA 2BNGA 2HMJB 4R08A 3F8HA 1ZX2A 3E4GA 1OF5B 4KXFB 5CXOA 4FS7A 4Y61B 2BNHA 5STDA 3RJ0A 4XBTA 4RCWA 4XBYA 3FSDA 3G8ZA 4U09A 3G3BA 3DM8A 3F7SA 4LSAA 2K54A 1Z7XW 2RA8A 3CPOA 1EG9B 5DREA 1W6YA 2P1NB 3GZXB 3CIYA 3REZA 1AR0A 4ARNA 3E2JA 1QMAA 5TGNA 4Q53A 3ZYIA 3JUMA 2W2CA 5AWBA 1JKGA 3HK4A 4MQWX 5IENA 3NHXA 3FF0A 4J0MA 2YFIB 2HMOB 3WMDA 3UL8A 3WPEA 5D81A 4XSQA 2WFHA 1O7PB 4IIAA 1K5DC 2OMXA 4HM5B 2B1XB 4X2OA 1E3VA 3B7CA 3OWYA 3VGNA 1FS2A 4IM6A 2OMWA 3O53A 1KOOA 4FMZA 3OWUA 4J9AA 5FTTB 4Z8GA 2XSHB 3E6JA 4FCJA 1DMMA 4GLPA 1U5OA 3ULVA 3OGLB 2A0ZA 4V2CA 4C2BB 5B0NA 1W00A 4KVHA 1W02A 3G16A 2P1MB 3RFEA 3NXJA 7STDA 3TSRE 5AEWB 4Z64C 3F7XA 4L8OA 3M19A 3OJAA 3WPFA 1GS3A 4HM8B 3CNXA 3EQQB 1O7NB 4HJLB 1OHOA 4GT6A 5EVHA 4HM2B 2ID5A 1D0BA 5IG5A 3T8UA 4LI1A 3OJAB 3CIGA 2UZXA 3OV4A 3EC9A 4U08A 1PGVA 3D9RA 1E97A 3ECFA 1XECA 2GXFA 4XOSA 3A79B 3CNMA 3SOAA 2OMYA 5B4PA 3MG3A 5AI1A 1ISKA 2R9UA 3RGZA 4GB5A 3RGRA 1SQ0B 5IJCA 4RCAB 3DZEA 2XWTC 4BV4R 4HM3B 4LXRA 2OMTA 4AY9X 3ULAA 4R07A 3LYGA 4X2HA 1K5GC 4CNCA 5BXQA 1GY6A 4WP6A 5GMHA 3ER7A 3C6NB 3EN1B 3ROBA 4R9LA 1A4YA 4RWTC 2WQWA 2Z62A 2RCDA 2XRXB 3NV0B 3Q90A 2RR6A 2Y5QA 5G2GA 2ASTB 3FLJA 1M0ZA 2P1PB 5IJDA 3CU3A 4R6JA 2Z81A 5AIGA 5GMFA 4PERA 4LMIA 3SB4A 1M9SA 3JUPA 4U06A 3EJVA 1K41A 4J4LA 3DMCA 4N3VA 2GBWB 4AW4A 3NV0A 1Z1SA 4HM7B 3VSYA 2BEXA 2A15A 1WQLB 3MG2A 2Z66A 3W3JA 3G3AA 3NUVA 1O7WB 3UJMA 3LZAA 4XBXA 1NWWA 1UUVB 3WPBA 1HKXA 1FO1A 1OGXA 1TP6A 2ASSB 4L3AA 3BB9A 3E3ZA 2F98A 2INXA 4FDWA 3MHEA 2OMUA 4K1VA 4RZMA 4HZBB 2F86B 1YRGA 3EBTA 2JQ5A 2FT3A 1A9NA 2BMOB 4HVNA 2CKFB 5BVBA 5IEPA 5GS0A 5GS2B 3DXOA 3WPGA 1JB5A 5HGRA 1A2KA 2RGQA 4R9KA 5CMPA 2IFGA 3EHCA 4OQTA 3W3LA 4WYKB 4WWUC 3DZLA 2IMJA 2CA6A 3KE7A 4G8AA 3WPCA 1GYBA 4I4KA 3STDA 1OF5A 5IYXC 3RFSA 5IF6A 3P72A 3S5CA 1OHPA 1DCEA 5A5CA 3WPIA 3WPDA 2UX0A 3MKIA 3K0ZA 5GMGA 2Z63A 1OOKG 3B4OA 4HQ1A 3SOYA 4P91A 3BLZA 3RW7A 2PZVA 3FF2A 1OH0A 3BZ5A 1EA2A 4FHOA 1O6TA 1ULJB 1M9LA 1JB4A 4XB5A 5FW5A 2V9TB 4QBZA 5HZLB 3HX8A 5AZ5A 4ECOA 3FH1A 2QIYA 1O7HB 5B0TA 2Z76A 4V2DA 5KP1A 4I6JB 4OUQA 4MJDA 4NKHA 3IPTA 5CF1A 4XGOA 3G04C 4B8CD 4XM4A 2XOTA 2RFRA 4WP5A 2O6SA 4R1KA 3C6PB 4QXEA 4P8SA 4LGQA 3G39A 5KP4A 5CMNA 5DRVA 2Q4GW 2V9SA 3OX9A 2CHCA 4BSSA 4R5DA 1C7HA 3WPHA 5JPPA 3F14A 1U0ND 3JB9j 1WWLA 4LEHA 3FZWA 1CQSA 3RGXA 5IERA 4HM1B 1FQVA 2GBXB 1P8TA 2ELLA 4HM6B 5HDHA 6STDA 3W3MA 3EN8A 1GWBA 1ULIB 4Z94G 2YFJB 1NDOB 4BSRA 2O6RA 1ZIWA 3A76A 3F8XA 5CLKA 3UL7A 3KZTA 2O6QA 2Z82A 1DFJI 1NU3A 3ZYNA 1OHSA 1ZO2A 2BMQB 3C6OB 4K17A 5GQRK 5AIFA 4R6GA 4PQ8A 1OGQA 3O6NA 4MN8B 2Z7XB 4OVMA 1JKGB 3W3KA 3ULUA 4CDLA 3T8NA 4PEJA 4M7EC 1LTXA 4R0AA 3UL9A 2YFLB 2Z7AA 1M10B 1GY7A 2STDA 3RGAA 5CF2A 3MYTA 8CHOA 3M8CA 4STDA 2P1OB 2OMVA 3DUKA 4U7LA 3GZBA 4C2AB 3EX9A 3GZYB 3CVRA 3UNLA 3FGYA 2HMMB 4LI2A 1OPYA 4ECNA 3G0KA 3B8LA 3W3NA 1OUNA 3JUNA 3B4PA 3H51A 1BUQA 4R6AA 5AWDA 4KNGA 4ORLA 2Z65A 5LFNA 3H3HA 1Q42A 1G9UA 1DS9A 4KT1A 4R6FA 1OCVA 3NM2A 3FKAA 1OGZA 5IEOA 4J8TA 4Z61C 4Q3IA 4XDVA 4M7EA 4UFRA 3VQ1A 2WQUA 1E3RA 1TUHA 1XCDA 3RFJA 2Z77A 3HZPA 3K7CA 3G06A 3PMHG 4LSCA 3VQ2A 4CC4C 5IG4A 4V2EA 3F9SA 5IG3A 4CC4A 3GRDA 4HZ9B 2JE1A 4CILA 1SJWA 3MG1A 4L7KA 1OTNA
chains in the Genus database with same CATH superfamily
1A2PA 4N6NB 4LSXC 2HMKB 3NBRA 2LQVA 4N6V0 1XEUA 1MGWA 3RIZA 1UI8A 5AYSC 1OZNA 4NZRM 1B21A 2QGUA 4NKGA 3W3GA 5AWAA 1BRJA 1LOXA 3BNCA 2CIUA 1Q7Y4 3D79A 1I2EA 4YEBB 3KSPA 1OTOA 4FCGA 4Q3GA 4BL3A 4FCZA 1Q40B 1RCLA 4TZHA 2O9UX 4LXSA 1ASKA 4LSOA 2OTJ3 5AYRB 3CCQ3 1K28A 1BGSA 1G0TA 4TX4A 3SEDA 1FT8A 2BMRB 4KZ1A 5JPUA 2R4IA 1IVXA 3LTCA 4LSXA 2JQDA 3O8YA 4DKIA 4BSUA 4EV2A 3GWRA 4KFFA 3WA3A 1H6UA 1P8VA 2JE0A 1UCLA 5AEUB 1B3SA 3A5EA 3CCS3 2XSOB 1S5AA 4U13A 5EEOA 1XWDC 3BNEA 5IJBA 2P38A 3OWSA 3HIIA 3IJEB 1P9AG 1FUTA 2H0HA 1V74A 2XFTA 5GSPA 1UUWB 1EQKA 3EE1A 5FGOA 2WQVA 3WOFB 1BANA 2B24B 4CNMA 2OOVA 2D42A 4O8SA 3ZYOA 1VQO3 1DMQA 1NO3A 3UB1A 1DMNA 1LOYA 1GY5A 3EBYA 1W8AA 3QRDA 3ZYJA 4ARRA 1JN5A 4L8PA 4R5CA 4R58A 4R09A 2HMLB 1N9EA 5AIHA 1B2XA 3DH2A 3NQYA 3RW6A 1IV7A 5CK6A 3CMA3 7RNTA 1VQM3 1DETA 1JV2B 1UCJA 4FR9A 4OQTA 1MWTA 2OWPA 1UDII 3I0YA 2GEXA 2PNCA 3RNTA 2CK3H 1PFPA 3ZFZA 5D83A 1W01A 1K8A4 3OGKB 1FGTA 1A90A 2JDIH 3FCSB 2Z7XA 1O7MB 2E2TA 4I5QA 4EV5A 1W7CA 4BL2A 1FGMA 3M18A 3OXAA 1NB3I 1VZZA 5KP3A 3X42A 1JL5A 2CC3A 1T2IA 4FCMA 4PEQB 3JUQA 4GHOA 1Q40A 4HM0B 1K734 4AKYA 1QYYA 1RN4A 5D82A 2GEYA 1JB2A 3K5TA 2Z64A 4K90B 2I9WA 2CFLA 3CME3 1XKUA 4EZGA 1TRQA 4WYKA 3S28A 5AIIA 1ZS7A 2UGIA 2V1LA 2HMNB 1H6TA 1O6VA 3EF8A 1AY7A 2KXGA 4QC0A 3IMAB 1Q9EA 4K1UA 2GSPA 2P0MA 4FMBA 4CP6A 1UI7A 2BHMA 4FD0A 4XDWA 1DVDA 4L3FA 4Q62A 1QJGA 3SLUA 2CWVA 2ML6A 4H3UA 4MMZB 1V57A 3WODG 1IVWA 3LT9A 1KOHA 3X3YA 3F40A 3FXIA 1OTMA 4PKIG 1YI23 3KKGA 1O6SA 3UN9A 1Q7HA 1BVIA 2WQXA 1IDPA 3MSOA 3KJ4A 3OGMB 2XR8B 3AGOA 3K63A 1N5HA 2UZYA 4PSJA 5IG0A 3JUOA 2J8XB 4FMCA 1BOXA 2KRTA 1N8QA 3E99A 3GZRA 3CCM3 1BRNL 1VQ83 4Z79A 1X1UA 1I8VA 2F4YA 1JN5B 1O7GB 2WOFA 4HKVB 5BU4A 1JBTA 2OMZA 1STDA 1SPUA 4H09A 5A0OB 1L5GB 1LOWA 3BNDA 3D5IA 4RNTA 2F99A 4WHAA 3RDEA 2V70A 5AWCA 1QAKA 2M7OA 3GOZA 2XF3A 1IO0A 3AHWA 4HM4B 7GSPA 5D3IA 2BNGA 2E2UA 1BRSA 3AMOA 2P1QB 2HMJB 1Q864 1I3IA 1R4YA 3DGMA 1M1K4 3F8HA 4R08A 1ZX2A 2W6JH 1OF5B 3E4GA 1SQ0B 1M1XB 5CXOA 4FS7A 4KXFB 1RGHA 2BNHA 5STDA 4Y61B 1YNVX 3RJ0A 4XBTA 1N5PA 3WDGB 4RCWA 1GD3A 4XBYA 3FSDA 3G8ZA 4U09A 4R80A 3S27A 2YX9A 3DM8A 2Q07A 3F7SA 3G3BA 4LSAA 2K54A 1Z7XW 2RA8A 3SYUA 3CPOA 4IT7A 3HOHA 1EG9B 1YGEA 4LYLB 5DREA 1W6YA 2E2VA 2P1NB 3GZXB 3PCRA 1DVCA 3PCSA 3CIYA 3REZA 1AR0A 3LH4A 3FG3A 3E2JA 2SBLA 4ARNA 1QMAA 1SIHA 4IPBA 2CFWA 3JUMA 4K61A 2W2CA 4Q53A 1SQWA 5TGNA 3ZYIA 1JKGA 3HK4A 4MQWX 1BNJA 3I563 3CCE3 2IA7A 5IENA 5AWBA 3NHXA 2ZHXB 3FF0A 3QK9A 3U1WA 4BTXA 3MPHA 1I0XA 6GSPA 4J0MA 2YFIB 2HMOB 5EQLA 1MWRA 2R41A 3WMDA 3UL8A 5D81A 3OW22 4XSQA 3WPEA 2WFHA 1O7PB 2C11A 5RNTA 3LT8A 1KD14 1WMPA 4IIAA 5M1AA 2BT3A 2P09A 3X40A 1K5DC 2OMXA 1JRQA 4HM5B 5HOHA 2B1XB 3L0RA 4X2OA 3V99A 3NM7A 3SXXA 1FGQA 1VQK3 2CG1A 1JBSA 2KAAA 3X3ZA 1W4NA 1E3VA 1FUSA 2CX1A 3B7CA 3OWYA 3VGNA 1FS2A 4IM6A 2OMWA 3O53A 1JZDA 5IW9A 1IYYA 2BIRA 1KOOA 4FMZA 3OWUA 1D6ZA 3BNBA 3PXMA 4J9AA 5FTTB 4Z8GA 2W9QA 1RGLA 2XSHB 4FCJA 3X3XA 3E6JA 1DMMA 1WMOA 4EXRA 2ML5A 4GLPA 1U5OA 1VQ63 3ULVA 3OGLB 5ELJA 3N54B 1BRGA 1RGAA 2A0ZA 4V2CA 4C2BB 5B0NA 3HIGA 1W00A 4KVHA 2CFDA 1W02A 2FGTA 3G16A 1RSNA 2P1MB 3D4AA 4O02B 1YJN3 3RFEA 4KFDA 3NXJA 2CWUA 7STDA 1BUJA 3TSRE 5AEWB 4HBRA 1Q824 3WN4A 4Z64C 3F7XA 4L8OA 3M19A 4NREA 3OJAA 1SARA 3WPFA 1YJ93 2W04A 2IY2A 2K3DA 1GS3A 3PS8A 4HM8B 5G1KA 1QALA 1RNTA 1UW1A 2SARA 1O7NB 2W03A 3CNXA 3EQQB 4HJLB 4N6MA 1HYFA 1OHOA 3WR2A 1M904 5IJCA 1I2FA 1IVVA 1RDSA 4GT6A 1IU7A 1IQYA 4HM2B 5EVHA 2ID5A 1D0BA 1NB5I 4J5KA 3CD63 5IG5A 3T8UA 4LI1A 1J2BA 1G96A 1W2ZA 3OJAB 4U08A 3CIGA 1VQ93 3UL6A 3OV4A 3EC9A 1T3BA 1DYUA 3WA2X 5ELUA 1PGVA 3D9RA 4BTWA 1E97A 1RCKA 1EEJA 1LXEA 3ECFA 1BAOA 4MMYB 1XECA 2W56B 1BSBA 1TFOA 2CFGA 2GXFA 3TDGA 4EC6A 5LC7A 2GU3A 4XOSA 3A79B 3G6E3 4R6AA 1RN7A 3CNMA 1MNLA 8RNTA 3FG1A 1Y4KA 1B20A 1N9JA 3KSED 4HOHA 1D6UA 3SOAA 1S723 1TRPA 2OMYA 5B4PA 2IUKA 3MG3A 1UGIA 3KCHA 5AI1A 1ISKA 1UUGB 2F56A 3CCJ3 5M18A 2R9UA 3RGZA 2H0IA 3NBBA 4GB5A 1GOUA 3RGRA 1EUIC 3CC73 2F5WA 4LZIA 1LQMB 2C4BA 1VQP3 4RCAB 3DZEA 2CH9A 3ALAA 1LRAA 2XWTC 1I3FA 4HM3B 4BV4R 5IJDA 3X41A 4LXRA 1QVF2 3DGYA 3UL5A 1X1XA 3AHSA 1I0VA 1A2VA 4AKZA 3K9MC 5M19A 2OMTA 4AY9X 4RNZA 3ULAA 4R07A 3LYGA 2XFSA 1RTUA 4X2HA 1FYSA 1K5GC 3PGBA 4CJNA 4CNCA 5BXQA 1GY6A 1RJOA 1KQS2 4WP6A 5GMHA 2KF4A 3ER7A 1B2MA 3C6NB 4WFOA 2UUGC 3EN1B 3ROBA 3V98A 4R9LA 1PU4A 1A4YA 4RWTC 2WQWA 3EB8A 2LYXA 2Z62A 1AVLA 2RCDA 2XRXB 1RRLA 2H0GA 1GSPA 3NV0B 3Q90A 2RR6A 2Y5QA 5G2GA 2ASTB 1BIRA 1IVUA 1IQ8A 3FLJA 3CU3A 3CCR3 1M0ZA 2P1PB 1KC84 4R6JA 3Q3FA 1QAFA 2KF3A 4FMDA 5AIGA 2Z81A 1B2UA 1VQQA 3ZG0A 5GMFA 1TIJA 4PERA 2RBIA 3DY5A 4LMIA 3SB4A 1M9SA 1GMRA 3LTAA 1BNEA 2CW9A 3JUPA 3EJVA 4U06A 1K41A 4J4LA 3DMCA 4N3VA 2GBWB 4AW4A 3Q1CA 4N6UA 3NV0A 1Z1SA 1LNHA 1LOVA 1GMPA 1U8CB 2L1SA 4HM7B 2IUJA 3VSYA 2A15A 1WQLB 1KSIA 2OQEC 1PY3A 3MG2A 2Z66A 3FG4A 4JRFA 3W3JA 3G3AA 3NUVA 1O7WB 3UJMA 3LZAA 2Y73A 4XBXA 1NWWA 3N8BA 1UUVB 3WPBA 1HKXA 2OQEA 3U97A 1OGXA 1FO1A 1RNBA 1RGGA 1TP6A 2ASSB 1IK3A 1GOVA 4GL6A 4L3AA 3BB9A 3E3ZA 2F98A 1ROAA 2INXA 4J5GA 4FDWA 4ILFA 1MGRA 3MHEA 2OMUA 4K1VA 1I2GA 2RNTA 4RZMA 4HZBB 2F86B 2P0XA 3D3LA 4EYCA 1YRGA 2GU1A 1W5ZA 3EBTA 1VQL3 1BSCA 2JQ5A 3J7Yd 1D6YA 2BMOB 2FT3A 1A9NA 2O3OA 4HVNA 2CKFB 1FZUA 5BVBA 5IEPA 5GS0A 4MMXB 5GS2B 1NNVA 3DXOA 3WPGA 1JB5A 5HGRA 1RMSA 1PYLA 1A2KA 1IT8A 2RGQA 2RSXA 4HYZA 4R9KA 4RNYA 5CMPA 2IFGA 3EHCA 3GSPA 1WMNA 4WYKB 4WWUC 3DZLA 2IMJA 3ZG5A 2CA6A 4FMAA 1W6CA 1V58A 3KE7A 1DE3A 4G8AA 1KWIA 3KIIA 3WPCA 1GYBA 1BRIA 4I4KA 9RNTA 3STDA 1OF5A 1T5YA 5IYXC 3LTDA 1GD4A 1UCKA 1RGEA 1VQ73 3LTBA 1BNGA 3RFSA 5IF6A 2WOHA 3NQZA 1FGOA 2P05A 3S5CA 3P72A 1OHPA 1QVG2 1FGRA 2XH9A 1DCEA 5A5CA 3WPIA 4ZM8A 2CWTA 3WPDA 2UX0A 3MKIA 3K0ZA 5GMGA 1ROVA 2BO9B 2Z63A 3N9HA 1OOKG 3B4OA 4HQ1A 3SOYA 1BRKA 2W0QA 4P91A 1B2ZA 1LVNA 2CFKA 2FXTA 3BLZA 4AEQA 1JJ22 1YGWA 3RW7A 2PZVA 3FF2A 1OH0A 3BZ5A 1STFI 1EA2A 2W56A 4BIRA 1YIJ3 1LNIA 3DGLA 2D1WA 4FHOA 1BSDA 1RRHA 1T2HA 2ZA4A 1O6TA 1RGFA 1ULJB 3G4S3 4JF8A 1JB4A 5LC6A 1RHLA 1M9LA 1X1YA 4XB5A 1IV9A 5FW5A 1LQGC 2V9TB 4QBZA 3HX8A 5AZ5A 5HZLB 4ECOA 1GOYA 3FH1A 1F8NA 2QIYA 3D5GA 4NHFA 2BEXA 1O7HB 3T0UA 1BRHA 5B0TA 2Z76A 4V2DA 6RNTA 3LMLA 3KFQC 5KP1A 4I6JB 3W3LA 4OUQA 4MJDA 1AVKA 3URPA 4CCVA 2FNQA 4NKHA 2BU4A 3IPTA 2WGOA 4N6TA 4O2HA 5CF1A 4XGOA 3G04C 2XGLA 4B8CD 2AAEA 1RGKA 4XM4A 3LXUX 2UZXA 2XOTA 2RFRA 3BIRA 1CYUA 2KCDA 4WP5A 1RGCA 2O6SA 4R1KA 4BU4A 3C6PB 4QXEA 4P8SA 1W6GA 3KN4A 1TFKA 4LGQA 3CC23 1MWUA 3G39A 5KP4A 1SIIA 3VF1A 5CMNA 1IT7A 1JZOA 5DRVA 1YHQ3 2Q4GW 2Z6BA 3G713 2V9SA 1VQN3 3DGOA 3OX9A 1RLSA 1RN1A 2CHCA 1BNRA 4BSSA 1K9M4 3AMOB 4R5DA 1C7HA 2QEX3 3WPHA 1BSEA 1R4CA 5JPPA 3F14A 1U0ND 3JB9j 3CCL3 1WWLA 4QWTA 4LEHA 3FZWA 1B27A 1CQSA 3RGXA 3MWZA 5BIRA 4HM1B 4O3VA 5IERA 2GBXB 1FQVA 1P8TA 2ZDJA 1NJI4 4N6OB 3NBJA 4HM6B 2ELLA 6STDA 2ZL8A 5HDHA 3W3MA 4KFEA 1G02A 2WO0A 3EN8A 3JVCA 1GWBA 1ULIB 4Z94G 2YFJB 1NDOB 2F5MA 2O6RA 4BSRA 1ZIWA 1B2SA 1EKMA 3WOEB 3A76A 3F8XA 5CLKA 4H61A 1CYVA 3UL7A 3SX1A 3KZTA 2CG0A 2O6QA 4GSPA 2Z82A 1DFJI 1NU3A 2XEPA 3ZYNA 1WNHA 1OHSA 1ZO2A 2BMQB 4KT3B 3C6OB 4K17A 5GQRK 4N6LA 5AIFA 1GMQA 4R6GA 4PQ8A 1OGQA 3O6NA 4MN8B 2Z7XB 3CC43 4OVMA 1JKGB 1MWSA 3W3KA 3ULUA 1M9GA 4BTYA 4CDLA 4NPBA 3T8NA 4PEJA 1BNSA 4M7EC 4RBNA 2C10A 1TU5A 3PZWA 1LTXA 3UL9A 4R0AA 2YFLB 2Z7AA 1M10B 1I70A 1GY7A 2STDA 3NX0A 3RGAA 1W2B2 2CX0A 4EBGA 5CF2A 3BU4A 3M8CA 2KF6A 3MYTA 4STDA 8CHOA 2OMVA 2P1OB 5G1LA 1IQXA 4R4KA 1X1WA 3DUKA 3WHOA 4U7LA 3GZBA 1YJW3 4C2AB 4OK0A 1BSAA 3EX9A 3GZYB 3CVRA 3UNLA 3FGYA 3GAXA 1YIT3 1OACA 2HMMB 2K0MA 3CCU3 4LI2A 1OPYA 3I553 3LOYA 4ECNA 2OCTA 3G0KA 1AV4A 3B8LA 3S67A 1A67A 3W3NA 1TTOA 2IYJA 1OUNA 1YVSA 3JUNA 3B4PA 2KF5A 3H51A 4CPKA 2XGNA 4MEIA 1Q814 1CH0A 1BUQA 4ORLA 4KNGA 5AWDA 1US1A 1FW7A 1FA3A 2Z65A 5LFNA 2MC8A 3AGNA 3H3HA 3DGNA 1UCIA 1Q42A 5I97A 2HOHA 2OTL3 1G9UA 4KT1A 1OCVA 4R6FA 1MOLA 3NM2A 1DS9A 4NZTM 1BNIA 3FKAA 2AADA 1VQ43 1OGZA 5IEOA 1JNQA 2MF7A 3SVAA 4J8TA 4Z61C 4Q3IA 4XDVA 1AQZA 4M7EA 4UFRA 3V92A 3VQ1A 1BNFA 2WQUA 1E3RA 1TUHA 1WTHA 3HI7A 1VQ53 1XCDA 2L4VA 3RFJA 1CEWI 1UGHI 2Z77A 2OOVC 3HZPA 3K7CA 3G06A 3PMHG 4G1MB 4LSCA 3VQ2A 5IG4A 4V2EA 4CC4C 1C54A 1TJDA 3S29A 3F9SA 1HZ1A 3PYJA 5IG3A 3CPW2 2QA43 4CC4A 1ZGXA 1RKYA 3GRDA 1FUWA 2Y74A 3CXC2 1N8R4 5JBSA 1BU4A 4EW5A 4HZ9B 1JBRA 2JE1A 1HU9A 3CCV3 4CILA 1SJWA 2W9PA 3MG1A 2WGQA 1YVBI 4L7KA 1OTNA 4HAAA 3Q2PA
chains in the Genus database with same CATH topology
4N6NB 4LSXC 2HMKB 3NBRA 2LQVA 4N6V0 1XEUA 3RIZA 1UI8A 5AYSC 1OZNA 2QGUA 4NKGA 3W3GA 5AWAA 1LOXA 3BNCA 2CIUA 1Q7Y4 4YEBB 3KSPA 1OTOA 4FCGA 4Q3GA 4FCZA 1Q40B 4TZHA 2O9UX 4LXSA 1ASKA 4LSOA 2OTJ3 5AYRB 3CCQ3 1K28A 3SEDA 4TX4A 1FT8A 2BMRB 4KZ1A 5JPUA 2R4IA 1IVXA 3LTCA 4LSXA 2JQDA 3O8YA 4BSUA 4EV2A 3GWRA 4KFFA 3WA3A 1H6UA 1P8VA 2JE0A 5AEUB 3CCS3 2XSOB 1S5AA 4U13A 5EEOA 1XWDC 3BNEA 5IJBA 2P38A 3OWSA 3HIIA 3IJEB 1P9AG 1V74A 2XFTA 1UUWB 1EQKA 3EE1A 5FGOA 2WQVA 3WOFB 2B24B 4CNMA 2OOVA 2D42A 4O8SA 3ZYOA 1VQO3 1DMQA 1NO3A 3UB1A 1DMNA 3EBYA 1GY5A 1W8AA 3ZYJA 3QRDA 4ARRA 1JN5A 4L8PA 4R5CA 4R58A 4R09A 2HMLB 1N9EA 5AIHA 3RW6A 3NQYA 1IV7A 5CK6A 3CMA3 1VQM3 1JV2B 4FR9A 2OWPA 3I0YA 2GEXA 2PNCA 2CK3H 1PFPA 5D83A 1W01A 1K8A4 3OGKB 1FGTA 1A90A 2JDIH 3FCSB 2Z7XA 1O7MB 2E2TA 4EV5A 1W7CA 1FGMA 3M18A 3OXAA 1NB3I 1VZZA 5KP3A 3X42A 1JL5A 2CC3A 4FCMA 4PEQB 3JUQA 1Q40A 4HM0B 1K734 4AKYA 1QYYA 5D82A 2GEYA 1JB2A 3K5TA 2Z64A 4K90B 2I9WA 2CFLA 3CME3 1XKUA 4EZGA 4WYKA 3S28A 5AIIA 2V1LA 2HMNB 1H6TA 1O6VA 3EF8A 2KXGA 4QC0A 3IMAB 4K1UA 2P0MA 4FMBA 4CP6A 1UI7A 2BHMA 4FD0A 4XDWA 1DVDA 4L3FA 4Q62A 1QJGA 3SLUA 2CWVA 2ML6A 4H3UA 4MMZB 3WODG 1IVWA 3LT9A 1KOHA 3X3YA 3F40A 3FXIA 1OTMA 4PKIG 1YI23 3KKGA 1O6SA 3UN9A 2WQXA 1IDPA 3MSOA 3KJ4A 3OGMB 2XR8B 3K63A 1N5HA 2UZYA 4PSJA 5IG0A 3JUOA 4FMCA 1VQ83 2KRTA 3E99A 1N8QA 3CCM3 3GZRA 2P1QB 4Z79A 4HKVB 1JN5B 1O7GB 2WOFA 2OMZA 1STDA 1SPUA 4H09A 5A0OB 1L5GB 3BNDA 3RDEA 4WHAA 2V70A 2F99A 5AWCA 1QAKA 2M7OA 3GOZA 2XF3A 1IO0A 4HM4B 5D3IA 2BNGA 2E2UA 3AMOA 2HMJB 1Q864 3DGMA 1M1K4 4R08A 3F8HA 1ZX2A 2W6JH 1OF5B 3E4GA 4KXFB 1M1XB 5CXOA 4FS7A 4Y61B 2BNHA 5STDA 3RJ0A 4XBTA 1N5PA 3WDGB 4RCWA 1GD3A 4XBYA 3FSDA 3G8ZA 4U09A 4R80A 3S27A 2YX9A 3DM8A 2Q07A 3F7SA 3G3BA 4LSAA 2K54A 1Z7XW 2RA8A 3CPOA 4IT7A 1EG9B 1YGEA 5DREA 1W6YA 2E2VA 2P1NB 3GZXB 3PCRA 1DVCA 3PCSA 3CIYA 3REZA 1AR0A 3LH4A 3FG3A 3E2JA 2SBLA 4ARNA 1QMAA 1SIHA 4IPBA 2CFWA 3JUMA 4K61A 2W2CA 4Q53A 1SQWA 5TGNA 3ZYIA 1JKGA 3HK4A 4MQWX 3I563 3CCE3 5AWBA 2IA7A 5IENA 3NHXA 3FF0A 3QK9A 3U1WA 4BTXA 3MPHA 4J0MA 2YFIB 2HMOB 5EQLA 3WMDA 3UL8A 3WPEA 5D81A 3OW22 4XSQA 2WFHA 1O7PB 2C11A 3LT8A 1KD14 1WMPA 4IIAA 2BT3A 2P09A 3X40A 1K5DC 2OMXA 1JRQA 4HM5B 2B1XB 3L0RA 4X2OA 3V99A 3NM7A 3SXXA 1FGQA 1VQK3 2CG1A 3X3ZA 1W4NA 1E3VA 3B7CA 3OWYA 3VGNA 1FS2A 4IM6A 2OMWA 3O53A 5IW9A 1KOOA 4FMZA 3OWUA 1D6ZA 3BNBA 3PXMA 4J9AA 5FTTB 4Z8GA 2W9QA 2XSHB 4FCJA 3X3XA 3E6JA 1DMMA 1WMOA 4EXRA 2ML5A 4GLPA 1U5OA 1VQ63 3ULVA 3OGLB 5ELJA 3N54B 2A0ZA 4V2CA 4C2BB 5B0NA 3HIGA 1W00A 4KVHA 2CFDA 1W02A 2FGTA 3G16A 2P1MB 4O02B 1YJN3 3RFEA 4KFDA 3NXJA 2CWUA 7STDA 3TSRE 5AEWB 4HBRA 1Q824 3WN4A 4Z64C 3F7XA 4L8OA 3M19A 4NREA 3OJAA 3WPFA 1YJ93 2W04A 3PS8A 1GS3A 4HM8B 1QALA 1UW1A 3CNXA 3EQQB 1O7NB 2W03A 4N6MA 1M904 4HJLB 1OHOA 1IVVA 4GT6A 1IU7A 1IQYA 4HM2B 5EVHA 2ID5A 1D0BA 1NB5I 3CD63 5IG5A 3T8UA 4LI1A 1J2BA 1G96A 1W2ZA 3OJAB 3CIGA 2UZXA 3UL6A 3OV4A 3EC9A 4U08A 1DYUA 3WA2X 5ELUA 1PGVA 3D9RA 4BTWA 1E97A 1LXEA 3ECFA 4MMYB 1XECA 2W56B 1TFOA 2CFGA 2GXFA 3TDGA 4EC6A 5LC7A 2GU3A 4XOSA 3A79B 3G6E3 1RN7A 3CNMA 1MNLA 3FG1A 1Y4KA 3KSED 1N9JA 3SOAA 2OMYA 1D6UA 5B4PA 1S723 2IUKA 3MG3A 5AI1A 1ISKA 3CCJ3 2R9UA 3RGZA 3NBBA 4GB5A 3RGRA 1VQ93 3CC73 1SQ0B 5IJCA 4LZIA 1VQP3 4RCAB 3DZEA 2CH9A 3ALAA 2XWTC 4BV4R 4HM3B 3X41A 4LXRA 1QVF2 3UL5A 1A2VA 4AKZA 3K9MC 2OMTA 4AY9X 4RNZA 3ULAA 4R07A 3LYGA 2XFSA 4X2HA 1K5GC 3PGBA 4CNCA 5BXQA 1GY6A 1RJOA 1KQS2 4WP6A 5GMHA 3ER7A 3C6NB 4WFOA 3EN1B 3ROBA 3V98A 4R9LA 1PU4A 1A4YA 4RWTC 2WQWA 3EB8A 2LYXA 2Z62A 1AVLA 2RCDA 2XRXB 1RRLA 3NV0B 3Q90A 2RR6A 2Y5QA 5G2GA 2ASTB 1IVUA 3FLJA 1IQ8A 1M0ZA 3CU3A 3CCR3 2P1PB 4R6JA 1KC84 5IJDA 1QAFA 2Z81A 4FMDA 5AIGA 5GMFA 1TIJA 4PERA 3DY5A 4LMIA 3SB4A 1M9SA 3LTAA 3JUPA 2CW9A 4U06A 3EJVA 1K41A 4J4LA 3DMCA 4N3VA 2GBWB 4AW4A 3Q1CA 4N6UA 3NV0A 1Z1SA 1LNHA 4HM7B 1U8CB 2IUJA 3VSYA 2BEXA 2A15A 1WQLB 1KSIA 2OQEC 3MG2A 2Z66A 3FG4A 4JRFA 3W3JA 3G3AA 3NUVA 1O7WB 3UJMA 3LZAA 2Y73A 4XBXA 1NWWA 3N8BA 1UUVB 3WPBA 1HKXA 2OQEA 3U97A 1OGXA 1FO1A 1TP6A 2ASSB 1IK3A 4GL6A 4L3AA 3BB9A 3E3ZA 2F98A 1ROAA 2INXA 4FDWA 3MHEA 2OMUA 4K1VA 4RZMA 4HZBB 2F86B 2P0XA 3D3LA 4EYCA 1YRGA 2GU1A 1W5ZA 3EBTA 1VQL3 2JQ5A 3J7Yd 2FT3A 1D6YA 2BMOB 1A9NA 2O3OA 4HVNA 2CKFB 5BVBA 5IEPA 5GS0A 4MMXB 5GS2B 3DXOA 3WPGA 1JB5A 5HGRA 2RSXA 1A2KA 1IT8A 2RGQA 4HYZA 4R9KA 4RNYA 5CMPA 2IFGA 3EHCA 4OQTA 1WMNA 4WYKB 4WWUC 3DZLA 2IMJA 3W3LA 2CA6A 4FMAA 1W6CA 3KE7A 4G8AA 1KWIA 3KIIA 3WPCA 1GYBA 4I4KA 3STDA 1OF5A 1T5YA 5IYXC 3LTDA 1GD4A 1VQ73 3LTBA 3RFSA 5IF6A 2WOHA 3NQZA 1FGOA 2P05A 3S5CA 3P72A 1OHPA 1QVG2 1FGRA 2XH9A 1DCEA 5A5CA 3WPIA 4ZM8A 2CWTA 3WPDA 2UX0A 3MKIA 3K0ZA 5GMGA 1ROVA 2BO9B 2Z63A 3N9HA 1OOKG 3B4OA 4HQ1A 3SOYA 2W0QA 4P91A 2FXTA 1LVNA 2CFKA 3BLZA 4AEQA 1JJ22 3RW7A 2PZVA 3FF2A 1OH0A 3BZ5A 1STFI 1EA2A 2W56A 1YIJ3 3DGLA 4FHOA 2D1WA 1RRHA 1O6TA 1ULJB 3G4S3 4JF8A 1JB4A 5LC6A 1M9LA 4XB5A 1IV9A 5FW5A 2V9TB 4QBZA 5HZLB 3HX8A 5AZ5A 4ECOA 3FH1A 1F8NA 2QIYA 4NHFA 1O7HB 3T0UA 5B0TA 2Z76A 4V2DA 3LMLA 3KFQC 5KP1A 4I6JB 4OUQA 4MJDA 1AVKA 4CCVA 4NKHA 2FNQA 3IPTA 2WGOA 4N6TA 4O2HA 5CF1A 4XGOA 3G04C 2XGLA 4B8CD 4XM4A 3LXUX 2XOTA 2RFRA 1CYUA 2KCDA 4WP5A 2O6SA 4R1KA 3C6PB 4QXEA 4P8SA 1W6GA 3KN4A 1TFKA 4LGQA 3CC23 3G39A 5KP4A 1SIIA 3VF1A 5CMNA 1IT7A 5DRVA 1YHQ3 2Q4GW 2Z6BA 2V9SA 1VQN3 3DGOA 3OX9A 2CHCA 4BSSA 1K9M4 3AMOB 4R5DA 1C7HA 2QEX3 3WPHA 1R4CA 5JPPA 3F14A 1U0ND 3JB9j 3CCL3 1WWLA 4QWTA 4LEHA 3FZWA 1CQSA 3RGXA 3MWZA 5IERA 4HM1B 4O3VA 1FQVA 2GBXB 1P8TA 2ZDJA 1NJI4 4N6OB 3NBJA 4HM6B 2ELLA 6STDA 2ZL8A 5HDHA 3W3MA 4KFEA 3JVCA 2WO0A 3EN8A 1GWBA 1ULIB 4Z94G 2YFJB 1NDOB 4BSRA 2O6RA 1ZIWA 1EKMA 3WOEB 3A76A 3F8XA 5CLKA 4H61A 1CYVA 3UL7A 3SX1A 3KZTA 2CG0A 2O6QA 2Z82A 1DFJI 1NU3A 2XEPA 3ZYNA 1WNHA 1OHSA 1ZO2A 2BMQB 3C6OB 4K17A 5GQRK 4N6LA 5AIFA 4R6GA 4PQ8A 1OGQA 3O6NA 4MN8B 2Z7XB 3CC43 4OVMA 1JKGB 3W3KA 3ULUA 1M9GA 4BTYA 4CDLA 3T8NA 4PEJA 4M7EC 4RBNA 2C10A 1TU5A 3PZWA 1LTXA 3UL9A 4R0AA 2YFLB 2Z7AA 1M10B 1GY7A 2STDA 3NX0A 3RGAA 1W2B2 4EBGA 5CF2A 3MYTA 3M8CA 4STDA 8CHOA 2P1OB 2OMVA 1IQXA 4R4KA 3DUKA 4U7LA 3GZBA 1YJW3 4C2AB 4OK0A 3EX9A 3GZYB 3CVRA 3UNLA 3FGYA 3GAXA 1YIT3 1OACA 2HMMB 2K0MA 3CCU3 4LI2A 1OPYA 3I553 3LOYA 4ECNA 2OCTA 3G0KA 1AV4A 3B8LA 3S67A 1A67A 3W3NA 1OUNA 3JUNA 3B4PA 3H51A 1BUQA 4R6AA 2XGNA 4MEIA 1Q814 5AWDA 4KNGA 4ORLA 1US1A 2Z65A 1FA3A 5LFNA 2MC8A 3H3HA 5I97A 3DGNA 1Q42A 1G9UA 2OTL3 4KT1A 4R6FA 1DS9A 1OCVA 1MOLA 3NM2A 3FKAA 1VQ43 1OGZA 5IEOA 1JNQA 2MF7A 3SVAA 4J8TA 4Z61C 4Q3IA 4XDVA 4M7EA 4UFRA 3V92A 3VQ1A 2WQUA 1E3RA 1TUHA 1WTHA 3HI7A 1VQ53 1XCDA 2L4VA 3RFJA 1CEWI 2Z77A 2OOVC 3HZPA 3K7CA 3G06A 3PMHG 4G1MB 4LSCA 3VQ2A 5IG4A 4V2EA 4CC4C 3S29A 3F9SA 3PYJA 3CPW2 5IG3A 2QA43 4CC4A 1RKYA 3GRDA 1FUWA 2Y74A 3CXC2 1N8R4 5JBSA 4HZ9B 2JE1A 1HU9A 3CCV3 4CILA 1SJWA 2W9PA 3MG1A 2WGQA 1YVBI 4L7KA 1OTNA 3G713 3Q2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSX C;  2HMK B;  3NBR A;  3RIZ A;  1XEU A;  1OZN A;  2QGU A;  4NKG A;  3W3G A;  5AWA A;  4YEB B;  3KSP A;  1OTO A;  4FCG A;  4Q3G A;  4TZH A;  1Q40 B;  4LXS A;  1ASK A;  3SED A;  1FT8 A;  2BMR B;  5JPU A;  2R4I A;  4LSX A;  2JQD A;  4BSU A;  3GWR A;  1H6U A;  1P8V A;  2JE0 A;  5AEU B;  2XSO B;  1S5A A;  4U13 A;  1XWD C;  5IJB A;  3OWS A;  1P9A G;  1UUW B;  2WQV A;  2B24 B;  4CNM A;  3ZYO A;  1DMQ A;  1W8A A;  1DMN A;  3EBY A;  1GY5 A;  3ZYJ A;  4ARR A;  1JN5 A;  4L8P A;  4R5C A;  4R58 A;  4R09 A;  2HML B;  5AIH A;  3RW6 A;  5CK6 A;  2OWP A;  3I0Y A;  2GEX A;  5D83 A;  1W01 A;  3OGK B;  2Z7X A;  1O7M B;  3M18 A;  3OXA A;  1VZZ A;  5KP3 A;  1JL5 A;  4FCM A;  4PEQ B;  3JUQ A;  1Q40 A;  4HM0 B;  1QYY A;  5D82 A;  2GEY A;  1JB2 A;  2Z64 A;  1XKU A;  2I9W A;  4EZG A;  4WYK A;  5AII A;  2HMN B;  1H6T A;  1O6V A;  3EF8 A;  4QC0 A;  4K1U A;  4CP6 A;  4FD0 A;  4XDW A;  4L3F A;  4Q62 A;  1QJG A;  4H3U A;  1KOH A;  4PKI G;  3F40 A;  3FXI A;  1OTM A;  3UN9 A;  3KKG A;  1O6S A;  2WQX A;  1IDP A;  3MSO A;  3KJ4 A;  3OGM B;  2XR8 B;  2UZY A;  4PSJ A;  3WN4 A;  5IG0 A;  3JUO A;  2P1Q B;  3E99 A;  3GZR A;  4Z79 A;  4HKV B;  1JN5 B;  1O7G B;  2OMZ A;  1STD A;  4H09 A;  2V70 A;  5AWC A;  2F99 A;  3GOZ A;  1IO0 A;  4HM4 B;  5D3I A;  2BNG A;  2HMJ B;  4R08 A;  3F8H A;  1ZX2 A;  3E4G A;  1OF5 B;  4KXF B;  5CXO A;  4FS7 A;  4Y61 B;  2BNH A;  5STD A;  3RJ0 A;  4XBT A;  4RCW A;  4XBY A;  3FSD A;  3G8Z A;  4U09 A;  3G3B A;  3DM8 A;  3F7S A;  4LSA A;  2K54 A;  1Z7X W;  2RA8 A;  3CPO A;  1EG9 B;  5DRE A;  1W6Y A;  2P1N B;  3GZX B;  3CIY A;  3REZ A;  1AR0 A;  4ARN A;  3E2J A;  1QMA A;  5TGN A;  4Q53 A;  3ZYI A;  3JUM A;  2W2C A;  5AWB A;  1JKG A;  3HK4 A;  4MQW X;  5IEN A;  3NHX A;  3FF0 A;  4J0M A;  2YFI B;  2HMO B;  3WMD A;  3UL8 A;  3WPE A;  5D81 A;  4XSQ A;  2WFH A;  1O7P B;  4IIA A;  1K5D C;  2OMX A;  4HM5 B;  2B1X B;  4X2O A;  1E3V A;  3B7C A;  3OWY A;  3VGN A;  1FS2 A;  4IM6 A;  2OMW A;  3O53 A;  1KOO A;  4FMZ A;  3OWU A;  4J9A A;  5FTT B;  4Z8G A;  2XSH B;  3E6J A;  4FCJ A;  1DMM A;  4GLP A;  1U5O A;  3ULV A;  3OGL B;  2A0Z A;  4V2C A;  4C2B B;  5B0N A;  1W00 A;  4KVH A;  1W02 A;  3G16 A;  2P1M B;  3RFE A;  3NXJ A;  7STD A;  3TSR E;  5AEW B;  4Z64 C;  3F7X A;  4L8O A;  3M19 A;  3OJA A;  3WPF A;  1GS3 A;  4HM8 B;  3CNX A;  3EQQ B;  1O7N B;  4HJL B;  1OHO A;  4GT6 A;  5EVH A;  4HM2 B;  2ID5 A;  1D0B A;  5IG5 A;  3T8U A;  4LI1 A;  3OJA B;  3CIG A;  2UZX A;  3OV4 A;  3EC9 A;  4U08 A;  1PGV A;  3D9R A;  1E97 A;  3ECF A;  1XEC A;  2GXF A;  4XOS A;  3A79 B;  3CNM A;  3SOA A;  2OMY A;  5B4P A;  3MG3 A;  5AI1 A;  1ISK A;  2R9U A;  3RGZ A;  4GB5 A;  3RGR A;  1SQ0 B;  5IJC A;  4RCA B;  3DZE A;  2XWT C;  4BV4 R;  4HM3 B;  4LXR A;  2OMT A;  4AY9 X;  3ULA A;  4R07 A;  3LYG A;  4X2H A;  1K5G C;  4CNC A;  5BXQ A;  1GY6 A;  4WP6 A;  5GMH A;  3ER7 A;  3C6N B;  3EN1 B;  3ROB A;  4R9L A;  1A4Y A;  4RWT C;  2WQW A;  2Z62 A;  2RCD A;  2XRX B;  3NV0 B;  3Q90 A;  2RR6 A;  2Y5Q A;  5G2G A;  2AST B;  3FLJ A;  1M0Z A;  2P1P B;  5IJD A;  3CU3 A;  4R6J A;  2Z81 A;  5AIG A;  5GMF A;  4PER A;  4LMI A;  3SB4 A;  1M9S A;  3JUP A;  4U06 A;  3EJV A;  1K41 A;  4J4L A;  3DMC A;  4N3V A;  2GBW B;  4AW4 A;  3NV0 A;  1Z1S A;  4HM7 B;  3VSY A;  2BEX A;  2A15 A;  1WQL B;  3MG2 A;  2Z66 A;  3W3J A;  3G3A A;  3NUV A;  1O7W B;  3UJM A;  3LZA A;  4XBX A;  1NWW A;  1UUV B;  3WPB A;  1HKX A;  1FO1 A;  1OGX A;  1TP6 A;  2ASS B;  4L3A A;  3BB9 A;  3E3Z A;  2F98 A;  2INX A;  4FDW A;  3MHE A;  2OMU A;  4K1V A;  4RZM A;  4HZB B;  2F86 B;  1YRG A;  3EBT A;  2JQ5 A;  2FT3 A;  1A9N A;  2BMO B;  4HVN A;  2CKF B;  5BVB A;  5IEP A;  5GS0 A;  5GS2 B;  3DXO A;  3WPG A;  1JB5 A;  5HGR A;  1A2K A;  2RGQ A;  4R9K A;  5CMP A;  2IFG A;  3EHC A;  4OQT A;  3W3L A;  4WYK B;  4WWU C;  3DZL A;  2IMJ A;  2CA6 A;  3KE7 A;  4G8A A;  3WPC A;  1GYB A;  4I4K A;  3STD A;  1OF5 A;  5IYX C;  3RFS A;  5IF6 A;  3P72 A;  3S5C A;  1OHP A;  1DCE A;  5A5C A;  3WPI A;  3WPD A;  2UX0 A;  3MKI A;  3K0Z A;  5GMG A;  2Z63 A;  1OOK G;  3B4O A;  4HQ1 A;  3SOY A;  4P91 A;  3BLZ A;  3RW7 A;  2PZV A;  3FF2 A;  1OH0 A;  3BZ5 A;  1EA2 A;  4FHO A;  1O6T A;  1ULJ B;  1M9L A;  1JB4 A;  4XB5 A;  5FW5 A;  2V9T B;  4QBZ A;  5HZL B;  3HX8 A;  5AZ5 A;  4ECO A;  3FH1 A;  2QIY A;  1O7H B;  5B0T A;  2Z76 A;  4V2D A;  5KP1 A;  4I6J B;  4OUQ A;  4MJD A;  4NKH A;  3IPT A;  5CF1 A;  4XGO A;  3G04 C;  4B8C D;  4XM4 A;  2XOT A;  2RFR A;  4WP5 A;  2O6S A;  4R1K A;  3C6P B;  4QXE A;  4P8S A;  4LGQ A;  3G39 A;  5KP4 A;  5CMN A;  5DRV A;  2Q4G W;  2V9S A;  3OX9 A;  2CHC A;  4BSS A;  4R5D A;  1C7H A;  3WPH A;  5JPP A;  3F14 A;  1U0N D;  3JB9 j;  1WWL A;  4LEH A;  3FZW A;  1CQS A;  3RGX A;  5IER A;  4HM1 B;  1FQV A;  2GBX B;  1P8T A;  2ELL A;  4HM6 B;  5HDH A;  6STD A;  3W3M A;  3EN8 A;  1GWB A;  1ULI B;  4Z94 G;  2YFJ B;  1NDO B;  4BSR A;  2O6R A;  1ZIW A;  3A76 A;  3F8X A;  5CLK A;  3UL7 A;  3KZT A;  2O6Q A;  2Z82 A;  1DFJ I;  1NU3 A;  3ZYN A;  1OHS A;  1ZO2 A;  2BMQ B;  3C6O B;  4K17 A;  5GQR K;  5AIF A;  4R6G A;  4PQ8 A;  1OGQ A;  3O6N A;  4MN8 B;  2Z7X B;  4OVM A;  1JKG B;  3W3K A;  3ULU A;  4CDL A;  3T8N A;  4PEJ A;  4M7E C;  1LTX A;  4R0A A;  3UL9 A;  2YFL B;  2Z7A A;  1M10 B;  1GY7 A;  2STD A;  3RGA A;  5CF2 A;  3MYT A;  8CHO A;  3M8C A;  4STD A;  2P1O B;  2OMV A;  3DUK A;  4U7L A;  3GZB A;  4C2A B;  3EX9 A;  3GZY B;  3CVR A;  3UNL A;  3FGY A;  2HMM B;  4LI2 A;  1OPY A;  4ECN A;  3G0K A;  3B8L A;  3W3N A;  1OUN A;  3JUN A;  3B4P A;  3H51 A;  1BUQ A;  4R6A A;  5AWD A;  4KNG A;  4ORL A;  2Z65 A;  5LFN A;  3H3H A;  1Q42 A;  1G9U A;  1DS9 A;  4KT1 A;  4R6F A;  1OCV A;  3NM2 A;  3FKA A;  1OGZ A;  5IEO A;  4J8T A;  4Z61 C;  4Q3I A;  4XDV A;  4M7E A;  4UFR A;  3VQ1 A;  2WQU A;  1E3R A;  1TUH A;  1XCD A;  3RFJ A;  2Z77 A;  3HZP A;  3K7C A;  3G06 A;  3PMH G;  4LSC A;  3VQ2 A;  4CC4 C;  5IG4 A;  4V2E A;  3F9S A;  5IG3 A;  4CC4 A;  3GRD A;  4HZ9 B;  2JE1 A;  4CIL A;  1SJW A;  3MG1 A;  4L7K A;  1OTN A; 
#chains in the Genus database with same CATH topology
 1A2P A;  4N6N B;  4LSX C;  2HMK B;  3NBR A;  2LQV A;  4N6V 0;  1XEU A;  1MGW A;  3RIZ A;  1UI8 A;  5AYS C;  1OZN A;  4NZR M;  1B21 A;  2QGU A;  4NKG A;  3W3G A;  5AWA A;  1BRJ A;  1LOX A;  3BNC A;  2CIU A;  1Q7Y 4;  3D79 A;  1I2E A;  4YEB B;  3KSP A;  1OTO A;  4FCG A;  4Q3G A;  4BL3 A;  4FCZ A;  1Q40 B;  1RCL A;  4TZH A;  2O9U X;  4LXS A;  1ASK A;  4LSO A;  2OTJ 3;  5AYR B;  3CCQ 3;  1K28 A;  1BGS A;  1G0T A;  4TX4 A;  3SED A;  1FT8 A;  2BMR B;  4KZ1 A;  5JPU A;  2R4I A;  1IVX A;  3LTC A;  4LSX A;  2JQD A;  3O8Y A;  4DKI A;  4BSU A;  4EV2 A;  3GWR A;  4KFF A;  3WA3 A;  1H6U A;  1P8V A;  2JE0 A;  1UCL A;  5AEU B;  1B3S A;  3A5E A;  3CCS 3;  2XSO B;  1S5A A;  4U13 A;  5EEO A;  1XWD C;  3BNE A;  5IJB A;  2P38 A;  3OWS A;  3HII A;  3IJE B;  1P9A G;  1FUT A;  2H0H A;  1V74 A;  2XFT A;  5GSP A;  1UUW B;  1EQK A;  3EE1 A;  5FGO A;  2WQV A;  3WOF B;  1BAN A;  2B24 B;  4CNM A;  2OOV A;  2D42 A;  4O8S A;  3ZYO A;  1VQO 3;  1DMQ A;  1NO3 A;  3UB1 A;  1DMN A;  1LOY A;  1GY5 A;  3EBY A;  1W8A A;  3QRD A;  3ZYJ A;  4ARR A;  1JN5 A;  4L8P A;  4R5C A;  4R58 A;  4R09 A;  2HML B;  1N9E A;  5AIH A;  1B2X A;  3DH2 A;  3NQY A;  3RW6 A;  1IV7 A;  5CK6 A;  3CMA 3;  7RNT A;  1VQM 3;  1DET A;  1JV2 B;  1UCJ A;  4FR9 A;  4OQT A;  1MWT A;  2OWP A;  1UDI I;  3I0Y A;  2GEX A;  2PNC A;  3RNT A;  2CK3 H;  1PFP A;  3ZFZ A;  5D83 A;  1W01 A;  1K8A 4;  3OGK B;  1FGT A;  1A90 A;  2JDI H;  3FCS B;  2Z7X A;  1O7M B;  2E2T A;  4I5Q A;  4EV5 A;  1W7C A;  4BL2 A;  1FGM A;  3M18 A;  3OXA A;  1NB3 I;  1VZZ A;  5KP3 A;  3X42 A;  1JL5 A;  2CC3 A;  1T2I A;  4FCM A;  4PEQ B;  3JUQ A;  4GHO A;  1Q40 A;  4HM0 B;  1K73 4;  4AKY A;  1QYY A;  1RN4 A;  5D82 A;  2GEY A;  1JB2 A;  3K5T A;  2Z64 A;  4K90 B;  2I9W A;  2CFL A;  3CME 3;  1XKU A;  4EZG A;  1TRQ A;  4WYK A;  3S28 A;  5AII A;  1ZS7 A;  2UGI A;  2V1L A;  2HMN B;  1H6T A;  1O6V A;  3EF8 A;  1AY7 A;  2KXG A;  4QC0 A;  3IMA B;  1Q9E A;  4K1U A;  2GSP A;  2P0M A;  4FMB A;  4CP6 A;  1UI7 A;  2BHM A;  4FD0 A;  4XDW A;  1DVD A;  4L3F A;  4Q62 A;  1QJG A;  3SLU A;  2CWV A;  2ML6 A;  4H3U A;  4MMZ B;  1V57 A;  3WOD G;  1IVW A;  3LT9 A;  1KOH A;  3X3Y A;  3F40 A;  3FXI A;  1OTM A;  4PKI G;  1YI2 3;  3KKG A;  1O6S A;  3UN9 A;  1Q7H A;  1BVI A;  2WQX A;  1IDP A;  3MSO A;  3KJ4 A;  3OGM B;  2XR8 B;  3AGO A;  3K63 A;  1N5H A;  2UZY A;  4PSJ A;  5IG0 A;  3JUO A;  2J8X B;  4FMC A;  1BOX A;  2KRT A;  1N8Q A;  3E99 A;  3GZR A;  3CCM 3;  1BRN L;  1VQ8 3;  4Z79 A;  1X1U A;  1I8V A;  2F4Y A;  1JN5 B;  1O7G B;  2WOF A;  4HKV B;  5BU4 A;  1JBT A;  2OMZ A;  1STD A;  1SPU A;  4H09 A;  5A0O B;  1L5G B;  1LOW A;  3BND A;  3D5I A;  4RNT A;  2F99 A;  4WHA A;  3RDE A;  2V70 A;  5AWC A;  1QAK A;  2M7O A;  3GOZ A;  2XF3 A;  1IO0 A;  3AHW A;  4HM4 B;  7GSP A;  5D3I A;  2BNG A;  2E2U A;  1BRS A;  3AMO A;  2P1Q B;  2HMJ B;  1Q86 4;  1I3I A;  1R4Y A;  3DGM A;  1M1K 4;  3F8H A;  4R08 A;  1ZX2 A;  2W6J H;  1OF5 B;  3E4G A;  1SQ0 B;  1M1X B;  5CXO A;  4FS7 A;  4KXF B;  1RGH A;  2BNH A;  5STD A;  4Y61 B;  1YNV X;  3RJ0 A;  4XBT A;  1N5P A;  3WDG B;  4RCW A;  1GD3 A;  4XBY A;  3FSD A;  3G8Z A;  4U09 A;  4R80 A;  3S27 A;  2YX9 A;  3DM8 A;  2Q07 A;  3F7S A;  3G3B A;  4LSA A;  2K54 A;  1Z7X W;  2RA8 A;  3SYU A;  3CPO A;  4IT7 A;  3HOH A;  1EG9 B;  1YGE A;  4LYL B;  5DRE A;  1W6Y A;  2E2V A;  2P1N B;  3GZX B;  3PCR A;  1DVC A;  3PCS A;  3CIY A;  3REZ A;  1AR0 A;  3LH4 A;  3FG3 A;  3E2J A;  2SBL A;  4ARN A;  1QMA A;  1SIH A;  4IPB A;  2CFW A;  3JUM A;  4K61 A;  2W2C A;  4Q53 A;  1SQW A;  5TGN A;  3ZYI A;  1JKG A;  3HK4 A;  4MQW X;  1BNJ A;  3I56 3;  3CCE 3;  2IA7 A;  5IEN A;  5AWB A;  3NHX A;  2ZHX B;  3FF0 A;  3QK9 A;  3U1W A;  4BTX A;  3MPH A;  1I0X A;  6GSP A;  4J0M A;  2YFI B;  2HMO B;  5EQL A;  1MWR A;  2R41 A;  3WMD A;  3UL8 A;  5D81 A;  3OW2 2;  4XSQ A;  3WPE A;  2WFH A;  1O7P B;  2C11 A;  5RNT A;  3LT8 A;  1KD1 4;  1WMP A;  4IIA A;  5M1A A;  2BT3 A;  2P09 A;  3X40 A;  1K5D C;  2OMX A;  1JRQ A;  4HM5 B;  5HOH A;  2B1X B;  3L0R A;  4X2O A;  3V99 A;  3NM7 A;  3SXX A;  1FGQ A;  1VQK 3;  2CG1 A;  1JBS A;  2KAA A;  3X3Z A;  1W4N A;  1E3V A;  1FUS A;  2CX1 A;  3B7C A;  3OWY A;  3VGN A;  1FS2 A;  4IM6 A;  2OMW A;  3O53 A;  1JZD A;  5IW9 A;  1IYY A;  2BIR A;  1KOO A;  4FMZ A;  3OWU A;  1D6Z A;  3BNB A;  3PXM A;  4J9A A;  5FTT B;  4Z8G A;  2W9Q A;  1RGL A;  2XSH B;  4FCJ A;  3X3X A;  3E6J A;  1DMM A;  1WMO A;  4EXR A;  2ML5 A;  4GLP A;  1U5O A;  1VQ6 3;  3ULV A;  3OGL B;  5ELJ A;  3N54 B;  1BRG A;  1RGA A;  2A0Z A;  4V2C A;  4C2B B;  5B0N A;  3HIG A;  1W00 A;  4KVH A;  2CFD A;  1W02 A;  2FGT A;  3G16 A;  1RSN A;  2P1M B;  3D4A A;  4O02 B;  1YJN 3;  3RFE A;  4KFD A;  3NXJ A;  2CWU A;  7STD A;  1BUJ A;  3TSR E;  5AEW B;  4HBR A;  1Q82 4;  3WN4 A;  4Z64 C;  3F7X A;  4L8O A;  3M19 A;  4NRE A;  3OJA A;  1SAR A;  3WPF A;  1YJ9 3;  2W04 A;  2IY2 A;  2K3D A;  1GS3 A;  3PS8 A;  4HM8 B;  5G1K A;  1QAL A;  1RNT A;  1UW1 A;  2SAR A;  1O7N B;  2W03 A;  3CNX A;  3EQQ B;  4HJL B;  4N6M A;  1HYF A;  1OHO A;  3WR2 A;  1M90 4;  5IJC A;  1I2F A;  1IVV A;  1RDS A;  4GT6 A;  1IU7 A;  1IQY A;  4HM2 B;  5EVH A;  2ID5 A;  1D0B A;  1NB5 I;  4J5K A;  3CD6 3;  5IG5 A;  3T8U A;  4LI1 A;  1J2B A;  1G96 A;  1W2Z A;  3OJA B;  4U08 A;  3CIG A;  1VQ9 3;  3UL6 A;  3OV4 A;  3EC9 A;  1T3B A;  1DYU A;  3WA2 X;  5ELU A;  1PGV A;  3D9R A;  4BTW A;  1E97 A;  1RCK A;  1EEJ A;  1LXE A;  3ECF A;  1BAO A;  4MMY B;  1XEC A;  2W56 B;  1BSB A;  1TFO A;  2CFG A;  2GXF A;  3TDG A;  4EC6 A;  5LC7 A;  2GU3 A;  4XOS A;  3A79 B;  3G6E 3;  4R6A A;  1RN7 A;  3CNM A;  1MNL A;  8RNT A;  3FG1 A;  1Y4K A;  1B20 A;  1N9J A;  3KSE D;  4HOH A;  1D6U A;  3SOA A;  1S72 3;  1TRP A;  2OMY A;  5B4P A;  2IUK A;  3MG3 A;  1UGI A;  3KCH A;  5AI1 A;  1ISK A;  1UUG B;  2F56 A;  3CCJ 3;  5M18 A;  2R9U A;  3RGZ A;  2H0I A;  3NBB A;  4GB5 A;  1GOU A;  3RGR A;  1EUI C;  3CC7 3;  2F5W A;  4LZI A;  1LQM B;  2C4B A;  1VQP 3;  4RCA B;  3DZE A;  2CH9 A;  3ALA A;  1LRA A;  2XWT C;  1I3F A;  4HM3 B;  4BV4 R;  5IJD A;  3X41 A;  4LXR A;  1QVF 2;  3DGY A;  3UL5 A;  1X1X A;  3AHS A;  1I0V A;  1A2V A;  4AKZ A;  3K9M C;  5M19 A;  2OMT A;  4AY9 X;  4RNZ A;  3ULA A;  4R07 A;  3LYG A;  2XFS A;  1RTU A;  4X2H A;  1FYS A;  1K5G C;  3PGB A;  4CJN A;  4CNC A;  5BXQ A;  1GY6 A;  1RJO A;  1KQS 2;  4WP6 A;  5GMH A;  2KF4 A;  3ER7 A;  1B2M A;  3C6N B;  4WFO A;  2UUG C;  3EN1 B;  3ROB A;  3V98 A;  4R9L A;  1PU4 A;  1A4Y A;  4RWT C;  2WQW A;  3EB8 A;  2LYX A;  2Z62 A;  1AVL A;  2RCD A;  2XRX B;  1RRL A;  2H0G A;  1GSP A;  3NV0 B;  3Q90 A;  2RR6 A;  2Y5Q A;  5G2G A;  2AST B;  1BIR A;  1IVU A;  1IQ8 A;  3FLJ A;  3CU3 A;  3CCR 3;  1M0Z A;  2P1P B;  1KC8 4;  4R6J A;  3Q3F A;  1QAF A;  2KF3 A;  4FMD A;  5AIG A;  2Z81 A;  1B2U A;  1VQQ A;  3ZG0 A;  5GMF A;  1TIJ A;  4PER A;  2RBI A;  3DY5 A;  4LMI A;  3SB4 A;  1M9S A;  1GMR A;  3LTA A;  1BNE A;  2CW9 A;  3JUP A;  3EJV A;  4U06 A;  1K41 A;  4J4L A;  3DMC A;  4N3V A;  2GBW B;  4AW4 A;  3Q1C A;  4N6U A;  3NV0 A;  1Z1S A;  1LNH A;  1LOV A;  1GMP A;  1U8C B;  2L1S A;  4HM7 B;  2IUJ A;  3VSY A;  2A15 A;  1WQL B;  1KSI A;  2OQE C;  1PY3 A;  3MG2 A;  2Z66 A;  3FG4 A;  4JRF A;  3W3J A;  3G3A A;  3NUV A;  1O7W B;  3UJM A;  3LZA A;  2Y73 A;  4XBX A;  1NWW A;  3N8B A;  1UUV B;  3WPB A;  1HKX A;  2OQE A;  3U97 A;  1OGX A;  1FO1 A;  1RNB A;  1RGG A;  1TP6 A;  2ASS B;  1IK3 A;  1GOV A;  4GL6 A;  4L3A A;  3BB9 A;  3E3Z A;  2F98 A;  1ROA A;  2INX A;  4J5G A;  4FDW A;  4ILF A;  1MGR A;  3MHE A;  2OMU A;  4K1V A;  1I2G A;  2RNT A;  4RZM A;  4HZB B;  2F86 B;  2P0X A;  3D3L A;  4EYC A;  1YRG A;  2GU1 A;  1W5Z A;  3EBT A;  1VQL 3;  1BSC A;  2JQ5 A;  3J7Y d;  1D6Y A;  2BMO B;  2FT3 A;  1A9N A;  2O3O A;  4HVN A;  2CKF B;  1FZU A;  5BVB A;  5IEP A;  5GS0 A;  4MMX B;  5GS2 B;  1NNV A;  3DXO A;  3WPG A;  1JB5 A;  5HGR A;  1RMS A;  1PYL A;  1A2K A;  1IT8 A;  2RGQ A;  2RSX A;  4HYZ A;  4R9K A;  4RNY A;  5CMP A;  2IFG A;  3EHC A;  3GSP A;  1WMN A;  4WYK B;  4WWU C;  3DZL A;  2IMJ A;  3ZG5 A;  2CA6 A;  4FMA A;  1W6C A;  1V58 A;  3KE7 A;  1DE3 A;  4G8A A;  1KWI A;  3KII A;  3WPC A;  1GYB A;  1BRI A;  4I4K A;  9RNT A;  3STD A;  1OF5 A;  1T5Y A;  5IYX C;  3LTD A;  1GD4 A;  1UCK A;  1RGE A;  1VQ7 3;  3LTB A;  1BNG A;  3RFS A;  5IF6 A;  2WOH A;  3NQZ A;  1FGO A;  2P05 A;  3S5C A;  3P72 A;  1OHP A;  1QVG 2;  1FGR A;  2XH9 A;  1DCE A;  5A5C A;  3WPI A;  4ZM8 A;  2CWT A;  3WPD A;  2UX0 A;  3MKI A;  3K0Z A;  5GMG A;  1ROV A;  2BO9 B;  2Z63 A;  3N9H A;  1OOK G;  3B4O A;  4HQ1 A;  3SOY A;  1BRK A;  2W0Q A;  4P91 A;  1B2Z A;  1LVN A;  2CFK A;  2FXT A;  3BLZ A;  4AEQ A;  1JJ2 2;  1YGW A;  3RW7 A;  2PZV A;  3FF2 A;  1OH0 A;  3BZ5 A;  1STF I;  1EA2 A;  2W56 A;  4BIR A;  1YIJ 3;  1LNI A;  3DGL A;  2D1W A;  4FHO A;  1BSD A;  1RRH A;  1T2H A;  2ZA4 A;  1O6T A;  1RGF A;  1ULJ B;  3G4S 3;  4JF8 A;  1JB4 A;  5LC6 A;  1RHL A;  1M9L A;  1X1Y A;  4XB5 A;  1IV9 A;  5FW5 A;  1LQG C;  2V9T B;  4QBZ A;  3HX8 A;  5AZ5 A;  5HZL B;  4ECO A;  1GOY A;  3FH1 A;  1F8N A;  2QIY A;  3D5G A;  4NHF A;  2BEX A;  1O7H B;  3T0U A;  1BRH A;  5B0T A;  2Z76 A;  4V2D A;  6RNT A;  3LML A;  3KFQ C;  5KP1 A;  4I6J B;  3W3L A;  4OUQ A;  4MJD A;  1AVK A;  3URP A;  4CCV A;  2FNQ A;  4NKH A;  2BU4 A;  3IPT A;  2WGO A;  4N6T A;  4O2H A;  5CF1 A;  4XGO A;  3G04 C;  2XGL A;  4B8C D;  2AAE A;  1RGK A;  4XM4 A;  3LXU X;  2UZX A;  2XOT A;  2RFR A;  3BIR A;  1CYU A;  2KCD A;  4WP5 A;  1RGC A;  2O6S A;  4R1K A;  4BU4 A;  3C6P B;  4QXE A;  4P8S A;  1W6G A;  3KN4 A;  1TFK A;  4LGQ A;  3CC2 3;  1MWU A;  3G39 A;  5KP4 A;  1SII A;  3VF1 A;  5CMN A;  1IT7 A;  1JZO A;  5DRV A;  1YHQ 3;  2Q4G W;  2Z6B A;  3G71 3;  2V9S A;  1VQN 3;  3DGO A;  3OX9 A;  1RLS A;  1RN1 A;  2CHC A;  1BNR A;  4BSS A;  1K9M 4;  3AMO B;  4R5D A;  1C7H A;  2QEX 3;  3WPH A;  1BSE A;  1R4C A;  5JPP A;  3F14 A;  1U0N D;  3JB9 j;  3CCL 3;  1WWL A;  4QWT A;  4LEH A;  3FZW A;  1B27 A;  1CQS A;  3RGX A;  3MWZ A;  5BIR A;  4HM1 B;  4O3V A;  5IER A;  2GBX B;  1FQV A;  1P8T A;  2ZDJ A;  1NJI 4;  4N6O B;  3NBJ A;  4HM6 B;  2ELL A;  6STD A;  2ZL8 A;  5HDH A;  3W3M A;  4KFE A;  1G02 A;  2WO0 A;  3EN8 A;  3JVC A;  1GWB A;  1ULI B;  4Z94 G;  2YFJ B;  1NDO B;  2F5M A;  2O6R A;  4BSR A;  1ZIW A;  1B2S A;  1EKM A;  3WOE B;  3A76 A;  3F8X A;  5CLK A;  4H61 A;  1CYV A;  3UL7 A;  3SX1 A;  3KZT A;  2CG0 A;  2O6Q A;  4GSP A;  2Z82 A;  1DFJ I;  1NU3 A;  2XEP A;  3ZYN A;  1WNH A;  1OHS A;  1ZO2 A;  2BMQ B;  4KT3 B;  3C6O B;  4K17 A;  5GQR K;  4N6L A;  5AIF A;  1GMQ A;  4R6G A;  4PQ8 A;  1OGQ A;  3O6N A;  4MN8 B;  2Z7X B;  3CC4 3;  4OVM A;  1JKG B;  1MWS A;  3W3K A;  3ULU A;  1M9G A;  4BTY A;  4CDL A;  4NPB A;  3T8N A;  4PEJ A;  1BNS A;  4M7E C;  4RBN A;  2C10 A;  1TU5 A;  3PZW A;  1LTX A;  3UL9 A;  4R0A A;  2YFL B;  2Z7A A;  1M10 B;  1I70 A;  1GY7 A;  2STD A;  3NX0 A;  3RGA A;  1W2B 2;  2CX0 A;  4EBG A;  5CF2 A;  3BU4 A;  3M8C A;  2KF6 A;  3MYT A;  4STD A;  8CHO A;  2OMV A;  2P1O B;  5G1L A;  1IQX A;  4R4K A;  1X1W A;  3DUK A;  3WHO A;  4U7L A;  3GZB A;  1YJW 3;  4C2A B;  4OK0 A;  1BSA A;  3EX9 A;  3GZY B;  3CVR A;  3UNL A;  3FGY A;  3GAX A;  1YIT 3;  1OAC A;  2HMM B;  2K0M A;  3CCU 3;  4LI2 A;  1OPY A;  3I55 3;  3LOY A;  4ECN A;  2OCT A;  3G0K A;  1AV4 A;  3B8L A;  3S67 A;  1A67 A;  3W3N A;  1TTO A;  2IYJ A;  1OUN A;  1YVS A;  3JUN A;  3B4P A;  2KF5 A;  3H51 A;  4CPK A;  2XGN A;  4MEI A;  1Q81 4;  1CH0 A;  1BUQ A;  4ORL A;  4KNG A;  5AWD A;  1US1 A;  1FW7 A;  1FA3 A;  2Z65 A;  5LFN A;  2MC8 A;  3AGN A;  3H3H A;  3DGN A;  1UCI A;  1Q42 A;  5I97 A;  2HOH A;  2OTL 3;  1G9U A;  4KT1 A;  1OCV A;  4R6F A;  1MOL A;  3NM2 A;  1DS9 A;  4NZT M;  1BNI A;  3FKA A;  2AAD A;  1VQ4 3;  1OGZ A;  5IEO A;  1JNQ A;  2MF7 A;  3SVA A;  4J8T A;  4Z61 C;  4Q3I A;  4XDV A;  1AQZ A;  4M7E A;  4UFR A;  3V92 A;  3VQ1 A;  1BNF A;  2WQU A;  1E3R A;  1TUH A;  1WTH A;  3HI7 A;  1VQ5 3;  1XCD A;  2L4V A;  3RFJ A;  1CEW I;  1UGH I;  2Z77 A;  2OOV C;  3HZP A;  3K7C A;  3G06 A;  3PMH G;  4G1M B;  4LSC A;  3VQ2 A;  5IG4 A;  4V2E A;  4CC4 C;  1C54 A;  1TJD A;  3S29 A;  3F9S A;  1HZ1 A;  3PYJ A;  5IG3 A;  3CPW 2;  2QA4 3;  4CC4 A;  1ZGX A;  1RKY A;  3GRD A;  1FUW A;  2Y74 A;  3CXC 2;  1N8R 4;  5JBS A;  1BU4 A;  4EW5 A;  4HZ9 B;  1JBR A;  2JE1 A;  1HU9 A;  3CCV 3;  4CIL A;  1SJW A;  2W9P A;  3MG1 A;  2WGQ A;  1YVB I;  4L7K A;  1OTN A;  4HAA A;  3Q2P A; 
#chains in the Genus database with same CATH homology
 4N6N B;  4LSX C;  2HMK B;  3NBR A;  2LQV A;  4N6V 0;  1XEU A;  3RIZ A;  1UI8 A;  5AYS C;  1OZN A;  2QGU A;  4NKG A;  3W3G A;  5AWA A;  1LOX A;  3BNC A;  2CIU A;  1Q7Y 4;  4YEB B;  3KSP A;  1OTO A;  4FCG A;  4Q3G A;  4FCZ A;  1Q40 B;  4TZH A;  2O9U X;  4LXS A;  1ASK A;  4LSO A;  2OTJ 3;  5AYR B;  3CCQ 3;  1K28 A;  3SED A;  4TX4 A;  1FT8 A;  2BMR B;  4KZ1 A;  5JPU A;  2R4I A;  1IVX A;  3LTC A;  4LSX A;  2JQD A;  3O8Y A;  4BSU A;  4EV2 A;  3GWR A;  4KFF A;  3WA3 A;  1H6U A;  1P8V A;  2JE0 A;  5AEU B;  3CCS 3;  2XSO B;  1S5A A;  4U13 A;  5EEO A;  1XWD C;  3BNE A;  5IJB A;  2P38 A;  3OWS A;  3HII A;  3IJE B;  1P9A G;  1V74 A;  2XFT A;  1UUW B;  1EQK A;  3EE1 A;  5FGO A;  2WQV A;  3WOF B;  2B24 B;  4CNM A;  2OOV A;  2D42 A;  4O8S A;  3ZYO A;  1VQO 3;  1DMQ A;  1NO3 A;  3UB1 A;  1DMN A;  3EBY A;  1GY5 A;  1W8A A;  3ZYJ A;  3QRD A;  4ARR A;  1JN5 A;  4L8P A;  4R5C A;  4R58 A;  4R09 A;  2HML B;  1N9E A;  5AIH A;  3RW6 A;  3NQY A;  1IV7 A;  5CK6 A;  3CMA 3;  1VQM 3;  1JV2 B;  4FR9 A;  2OWP A;  3I0Y A;  2GEX A;  2PNC A;  2CK3 H;  1PFP A;  5D83 A;  1W01 A;  1K8A 4;  3OGK B;  1FGT A;  1A90 A;  2JDI H;  3FCS B;  2Z7X A;  1O7M B;  2E2T A;  4EV5 A;  1W7C A;  1FGM A;  3M18 A;  3OXA A;  1NB3 I;  1VZZ A;  5KP3 A;  3X42 A;  1JL5 A;  2CC3 A;  4FCM A;  4PEQ B;  3JUQ A;  1Q40 A;  4HM0 B;  1K73 4;  4AKY A;  1QYY A;  5D82 A;  2GEY A;  1JB2 A;  3K5T A;  2Z64 A;  4K90 B;  2I9W A;  2CFL A;  3CME 3;  1XKU A;  4EZG A;  4WYK A;  3S28 A;  5AII A;  2V1L A;  2HMN B;  1H6T A;  1O6V A;  3EF8 A;  2KXG A;  4QC0 A;  3IMA B;  4K1U A;  2P0M A;  4FMB A;  4CP6 A;  1UI7 A;  2BHM A;  4FD0 A;  4XDW A;  1DVD A;  4L3F A;  4Q62 A;  1QJG A;  3SLU A;  2CWV A;  2ML6 A;  4H3U A;  4MMZ B;  3WOD G;  1IVW A;  3LT9 A;  1KOH A;  3X3Y A;  3F40 A;  3FXI A;  1OTM A;  4PKI G;  1YI2 3;  3KKG A;  1O6S A;  3UN9 A;  2WQX A;  1IDP A;  3MSO A;  3KJ4 A;  3OGM B;  2XR8 B;  3K63 A;  1N5H A;  2UZY A;  4PSJ A;  5IG0 A;  3JUO A;  4FMC A;  1VQ8 3;  2KRT A;  3E99 A;  1N8Q A;  3CCM 3;  3GZR A;  2P1Q B;  4Z79 A;  4HKV B;  1JN5 B;  1O7G B;  2WOF A;  2OMZ A;  1STD A;  1SPU A;  4H09 A;  5A0O B;  1L5G B;  3BND A;  3RDE A;  4WHA A;  2V70 A;  2F99 A;  5AWC A;  1QAK A;  2M7O A;  3GOZ A;  2XF3 A;  1IO0 A;  4HM4 B;  5D3I A;  2BNG A;  2E2U A;  3AMO A;  2HMJ B;  1Q86 4;  3DGM A;  1M1K 4;  4R08 A;  3F8H A;  1ZX2 A;  2W6J H;  1OF5 B;  3E4G A;  4KXF B;  1M1X B;  5CXO A;  4FS7 A;  4Y61 B;  2BNH A;  5STD A;  3RJ0 A;  4XBT A;  1N5P A;  3WDG B;  4RCW A;  1GD3 A;  4XBY A;  3FSD A;  3G8Z A;  4U09 A;  4R80 A;  3S27 A;  2YX9 A;  3DM8 A;  2Q07 A;  3F7S A;  3G3B A;  4LSA A;  2K54 A;  1Z7X W;  2RA8 A;  3CPO A;  4IT7 A;  1EG9 B;  1YGE A;  5DRE A;  1W6Y A;  2E2V A;  2P1N B;  3GZX B;  3PCR A;  1DVC A;  3PCS A;  3CIY A;  3REZ A;  1AR0 A;  3LH4 A;  3FG3 A;  3E2J A;  2SBL A;  4ARN A;  1QMA A;  1SIH A;  4IPB A;  2CFW A;  3JUM A;  4K61 A;  2W2C A;  4Q53 A;  1SQW A;  5TGN A;  3ZYI A;  1JKG A;  3HK4 A;  4MQW X;  3I56 3;  3CCE 3;  5AWB A;  2IA7 A;  5IEN A;  3NHX A;  3FF0 A;  3QK9 A;  3U1W A;  4BTX A;  3MPH A;  4J0M A;  2YFI B;  2HMO B;  5EQL A;  3WMD A;  3UL8 A;  3WPE A;  5D81 A;  3OW2 2;  4XSQ A;  2WFH A;  1O7P B;  2C11 A;  3LT8 A;  1KD1 4;  1WMP A;  4IIA A;  2BT3 A;  2P09 A;  3X40 A;  1K5D C;  2OMX A;  1JRQ A;  4HM5 B;  2B1X B;  3L0R A;  4X2O A;  3V99 A;  3NM7 A;  3SXX A;  1FGQ A;  1VQK 3;  2CG1 A;  3X3Z A;  1W4N A;  1E3V A;  3B7C A;  3OWY A;  3VGN A;  1FS2 A;  4IM6 A;  2OMW A;  3O53 A;  5IW9 A;  1KOO A;  4FMZ A;  3OWU A;  1D6Z A;  3BNB A;  3PXM A;  4J9A A;  5FTT B;  4Z8G A;  2W9Q A;  2XSH B;  4FCJ A;  3X3X A;  3E6J A;  1DMM A;  1WMO A;  4EXR A;  2ML5 A;  4GLP A;  1U5O A;  1VQ6 3;  3ULV A;  3OGL B;  5ELJ A;  3N54 B;  2A0Z A;  4V2C A;  4C2B B;  5B0N A;  3HIG A;  1W00 A;  4KVH A;  2CFD A;  1W02 A;  2FGT A;  3G16 A;  2P1M B;  4O02 B;  1YJN 3;  3RFE A;  4KFD A;  3NXJ A;  2CWU A;  7STD A;  3TSR E;  5AEW B;  4HBR A;  1Q82 4;  3WN4 A;  4Z64 C;  3F7X A;  4L8O A;  3M19 A;  4NRE A;  3OJA A;  3WPF A;  1YJ9 3;  2W04 A;  3PS8 A;  1GS3 A;  4HM8 B;  1QAL A;  1UW1 A;  3CNX A;  3EQQ B;  1O7N B;  2W03 A;  4N6M A;  1M90 4;  4HJL B;  1OHO A;  1IVV A;  4GT6 A;  1IU7 A;  1IQY A;  4HM2 B;  5EVH A;  2ID5 A;  1D0B A;  1NB5 I;  3CD6 3;  5IG5 A;  3T8U A;  4LI1 A;  1J2B A;  1G96 A;  1W2Z A;  3OJA B;  3CIG A;  2UZX A;  3UL6 A;  3OV4 A;  3EC9 A;  4U08 A;  1DYU A;  3WA2 X;  5ELU A;  1PGV A;  3D9R A;  4BTW A;  1E97 A;  1LXE A;  3ECF A;  4MMY B;  1XEC A;  2W56 B;  1TFO A;  2CFG A;  2GXF A;  3TDG A;  4EC6 A;  5LC7 A;  2GU3 A;  4XOS A;  3A79 B;  3G6E 3;  1RN7 A;  3CNM A;  1MNL A;  3FG1 A;  1Y4K A;  3KSE D;  1N9J A;  3SOA A;  2OMY A;  1D6U A;  5B4P A;  1S72 3;  2IUK A;  3MG3 A;  5AI1 A;  1ISK A;  3CCJ 3;  2R9U A;  3RGZ A;  3NBB A;  4GB5 A;  3RGR A;  1VQ9 3;  3CC7 3;  1SQ0 B;  5IJC A;  4LZI A;  1VQP 3;  4RCA B;  3DZE A;  2CH9 A;  3ALA A;  2XWT C;  4BV4 R;  4HM3 B;  3X41 A;  4LXR A;  1QVF 2;  3UL5 A;  1A2V A;  4AKZ A;  3K9M C;  2OMT A;  4AY9 X;  4RNZ A;  3ULA A;  4R07 A;  3LYG A;  2XFS A;  4X2H A;  1K5G C;  3PGB A;  4CNC A;  5BXQ A;  1GY6 A;  1RJO A;  1KQS 2;  4WP6 A;  5GMH A;  3ER7 A;  3C6N B;  4WFO A;  3EN1 B;  3ROB A;  3V98 A;  4R9L A;  1PU4 A;  1A4Y A;  4RWT C;  2WQW A;  3EB8 A;  2LYX A;  2Z62 A;  1AVL A;  2RCD A;  2XRX B;  1RRL A;  3NV0 B;  3Q90 A;  2RR6 A;  2Y5Q A;  5G2G A;  2AST B;  1IVU A;  3FLJ A;  1IQ8 A;  1M0Z A;  3CU3 A;  3CCR 3;  2P1P B;  4R6J A;  1KC8 4;  5IJD A;  1QAF A;  2Z81 A;  4FMD A;  5AIG A;  5GMF A;  1TIJ A;  4PER A;  3DY5 A;  4LMI A;  3SB4 A;  1M9S A;  3LTA A;  3JUP A;  2CW9 A;  4U06 A;  3EJV A;  1K41 A;  4J4L A;  3DMC A;  4N3V A;  2GBW B;  4AW4 A;  3Q1C A;  4N6U A;  3NV0 A;  1Z1S A;  1LNH A;  4HM7 B;  1U8C B;  2IUJ A;  3VSY A;  2BEX A;  2A15 A;  1WQL B;  1KSI A;  2OQE C;  3MG2 A;  2Z66 A;  3FG4 A;  4JRF A;  3W3J A;  3G3A A;  3NUV A;  1O7W B;  3UJM A;  3LZA A;  2Y73 A;  4XBX A;  1NWW A;  3N8B A;  1UUV B;  3WPB A;  1HKX A;  2OQE A;  3U97 A;  1OGX A;  1FO1 A;  1TP6 A;  2ASS B;  1IK3 A;  4GL6 A;  4L3A A;  3BB9 A;  3E3Z A;  2F98 A;  1ROA A;  2INX A;  4FDW A;  3MHE A;  2OMU A;  4K1V A;  4RZM A;  4HZB B;  2F86 B;  2P0X A;  3D3L A;  4EYC A;  1YRG A;  2GU1 A;  1W5Z A;  3EBT A;  1VQL 3;  2JQ5 A;  3J7Y d;  2FT3 A;  1D6Y A;  2BMO B;  1A9N A;  2O3O A;  4HVN A;  2CKF B;  5BVB A;  5IEP A;  5GS0 A;  4MMX B;  5GS2 B;  3DXO A;  3WPG A;  1JB5 A;  5HGR A;  2RSX A;  1A2K A;  1IT8 A;  2RGQ A;  4HYZ A;  4R9K A;  4RNY A;  5CMP A;  2IFG A;  3EHC A;  4OQT A;  1WMN A;  4WYK B;  4WWU C;  3DZL A;  2IMJ A;  3W3L A;  2CA6 A;  4FMA A;  1W6C A;  3KE7 A;  4G8A A;  1KWI A;  3KII A;  3WPC A;  1GYB A;  4I4K A;  3STD A;  1OF5 A;  1T5Y A;  5IYX C;  3LTD A;  1GD4 A;  1VQ7 3;  3LTB A;  3RFS A;  5IF6 A;  2WOH A;  3NQZ A;  1FGO A;  2P05 A;  3S5C A;  3P72 A;  1OHP A;  1QVG 2;  1FGR A;  2XH9 A;  1DCE A;  5A5C A;  3WPI A;  4ZM8 A;  2CWT A;  3WPD A;  2UX0 A;  3MKI A;  3K0Z A;  5GMG A;  1ROV A;  2BO9 B;  2Z63 A;  3N9H A;  1OOK G;  3B4O A;  4HQ1 A;  3SOY A;  2W0Q A;  4P91 A;  2FXT A;  1LVN A;  2CFK A;  3BLZ A;  4AEQ A;  1JJ2 2;  3RW7 A;  2PZV A;  3FF2 A;  1OH0 A;  3BZ5 A;  1STF I;  1EA2 A;  2W56 A;  1YIJ 3;  3DGL A;  4FHO A;  2D1W A;  1RRH A;  1O6T A;  1ULJ B;  3G4S 3;  4JF8 A;  1JB4 A;  5LC6 A;  1M9L A;  4XB5 A;  1IV9 A;  5FW5 A;  2V9T B;  4QBZ A;  5HZL B;  3HX8 A;  5AZ5 A;  4ECO A;  3FH1 A;  1F8N A;  2QIY A;  4NHF A;  1O7H B;  3T0U A;  5B0T A;  2Z76 A;  4V2D A;  3LML A;  3KFQ C;  5KP1 A;  4I6J B;  4OUQ A;  4MJD A;  1AVK A;  4CCV A;  4NKH A;  2FNQ A;  3IPT A;  2WGO A;  4N6T A;  4O2H A;  5CF1 A;  4XGO A;  3G04 C;  2XGL A;  4B8C D;  4XM4 A;  3LXU X;  2XOT A;  2RFR A;  1CYU A;  2KCD A;  4WP5 A;  2O6S A;  4R1K A;  3C6P B;  4QXE A;  4P8S A;  1W6G A;  3KN4 A;  1TFK A;  4LGQ A;  3CC2 3;  3G39 A;  5KP4 A;  1SII A;  3VF1 A;  5CMN A;  1IT7 A;  5DRV A;  1YHQ 3;  2Q4G W;  2Z6B A;  2V9S A;  1VQN 3;  3DGO A;  3OX9 A;  2CHC A;  4BSS A;  1K9M 4;  3AMO B;  4R5D A;  1C7H A;  2QEX 3;  3WPH A;  1R4C A;  5JPP A;  3F14 A;  1U0N D;  3JB9 j;  3CCL 3;  1WWL A;  4QWT A;  4LEH A;  3FZW A;  1CQS A;  3RGX A;  3MWZ A;  5IER A;  4HM1 B;  4O3V A;  1FQV A;  2GBX B;  1P8T A;  2ZDJ A;  1NJI 4;  4N6O B;  3NBJ A;  4HM6 B;  2ELL A;  6STD A;  2ZL8 A;  5HDH A;  3W3M A;  4KFE A;  3JVC A;  2WO0 A;  3EN8 A;  1GWB A;  1ULI B;  4Z94 G;  2YFJ B;  1NDO B;  4BSR A;  2O6R A;  1ZIW A;  1EKM A;  3WOE B;  3A76 A;  3F8X A;  5CLK A;  4H61 A;  1CYV A;  3UL7 A;  3SX1 A;  3KZT A;  2CG0 A;  2O6Q A;  2Z82 A;  1DFJ I;  1NU3 A;  2XEP A;  3ZYN A;  1WNH A;  1OHS A;  1ZO2 A;  2BMQ B;  3C6O B;  4K17 A;  5GQR K;  4N6L A;  5AIF A;  4R6G A;  4PQ8 A;  1OGQ A;  3O6N A;  4MN8 B;  2Z7X B;  3CC4 3;  4OVM A;  1JKG B;  3W3K A;  3ULU A;  1M9G A;  4BTY A;  4CDL A;  3T8N A;  4PEJ A;  4M7E C;  4RBN A;  2C10 A;  1TU5 A;  3PZW A;  1LTX A;  3UL9 A;  4R0A A;  2YFL B;  2Z7A A;  1M10 B;  1GY7 A;  2STD A;  3NX0 A;  3RGA A;  1W2B 2;  4EBG A;  5CF2 A;  3MYT A;  3M8C A;  4STD A;  8CHO A;  2P1O B;  2OMV A;  1IQX A;  4R4K A;  3DUK A;  4U7L A;  3GZB A;  1YJW 3;  4C2A B;  4OK0 A;  3EX9 A;  3GZY B;  3CVR A;  3UNL A;  3FGY A;  3GAX A;  1YIT 3;  1OAC A;  2HMM B;  2K0M A;  3CCU 3;  4LI2 A;  1OPY A;  3I55 3;  3LOY A;  4ECN A;  2OCT A;  3G0K A;  1AV4 A;  3B8L A;  3S67 A;  1A67 A;  3W3N A;  1OUN A;  3JUN A;  3B4P A;  3H51 A;  1BUQ A;  4R6A A;  2XGN A;  4MEI A;  1Q81 4;  5AWD A;  4KNG A;  4ORL A;  1US1 A;  2Z65 A;  1FA3 A;  5LFN A;  2MC8 A;  3H3H A;  5I97 A;  3DGN A;  1Q42 A;  1G9U A;  2OTL 3;  4KT1 A;  4R6F A;  1DS9 A;  1OCV A;  1MOL A;  3NM2 A;  3FKA A;  1VQ4 3;  1OGZ A;  5IEO A;  1JNQ A;  2MF7 A;  3SVA A;  4J8T A;  4Z61 C;  4Q3I A;  4XDV A;  4M7E A;  4UFR A;  3V92 A;  3VQ1 A;  2WQU A;  1E3R A;  1TUH A;  1WTH A;  3HI7 A;  1VQ5 3;  1XCD A;  2L4V A;  3RFJ A;  1CEW I;  2Z77 A;  2OOV C;  3HZP A;  3K7C A;  3G06 A;  3PMH G;  4G1M B;  4LSC A;  3VQ2 A;  5IG4 A;  4V2E A;  4CC4 C;  3S29 A;  3F9S A;  3PYJ A;  3CPW 2;  5IG3 A;  2QA4 3;  4CC4 A;  1RKY A;  3GRD A;  1FUW A;  2Y74 A;  3CXC 2;  1N8R 4;  5JBS A;  4HZ9 B;  2JE1 A;  1HU9 A;  3CCV 3;  4CIL A;  1SJW A;  2W9P A;  3MG1 A;  2WGQ A;  1YVB I;  4L7K A;  1OTN A;  3G71 3;  3Q2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...