4WYKA

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
344
Chain Sequence
ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear RNA export factor 1
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 87
structure length 344
sequence length 347
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4wykA01
3RFSA 1OF5A 4CDLA 1OH0A 2STDA 3H51A 3UJMA 5CXOA 2F99A 4ARRA 1WQLB 4PEQB 3ECFA 1ULIB 4HZ9B 3DUKA 3E99A 2Z62A 4R5DA 3NUVA 4L3FA 5IJBA 5D81A 2IFGA 5EVHA 5AIFA 1OGQA 3OJAB 1YRGA 1QYYA 4M7EC 1U0ND 1OTNA 3RJ0A 2P1MB 3ROBA 5KP3A 4P91A 3WN4A 3C6OB 4LSXA 3OWUA 3WPHA 3MHEA 2V9TB 1OHSA 3RFJA 3EJVA 3MG2A 4J9AA 3B4OA 1EG9B 3OGMB 3JUOA 1OGXA 2BMOB 1CQSA 1Q42A 2YFJB 4HM7B 4G8AA 3O6NA 1W00A 4RWTC 2QIYA 3OWSA 4CNMA 4HZBB 2GBXB 4QXEA 1SJWA 5IEPA 4B8CD 5IF6A 2P1OB 1QJGA 3EHCA 4R58A 4Z94G 3KJ4A 2Z77A 3ZYOA 2Z7AA 1E3VA 4L7KA 2RGQA 5CF1A 1E97A 4CC4A 4WWUC 3H3HA 1O7GB 4U06A 5CF2A 2P1QB 2OMVA 3W3NA 2Z81A 4PSJA 3VGNA 5IG5A 4GB5A 3FH1A 2HMJB 2Z7XB 1OOKG 5AWDA 4XDWA 3HK4A 1C7HA 2UZYA 2BMQB 1TP6A 2GEYA 5FTTB 3ZYJA 4HM6B 3RGRA 3SOYA 5HDHA 1FQVA 4EZGA 4R1KA 4H09A 1DMMA 3S5CA 1SQ0B 3HX8A 5GMHA 1U5OA 4HM4B 3JB9j 1M9SA 3WPFA 3UN9A 3JUMA 5IG0A 4FD0A 3OWYA 3EN1B 3E4GA 1W02A 1K5DC 4PQ8A 1OHPA 3CNMA 3RIZA 4OUQA 2UZXA 3HZPA 3RW6A 4AY9X 3EX9A 4WYKA 3K0ZA 5KP4A 4BSSA 1FS2A 4R5CA 1O6VA 3ZYIA 4LGQA 2CHCA 5BXQA 3VQ1A 4HM0B 3ULVA 3F9SA 3VSYA 3GZRA 4NKHA 4TZHA 1LTXA 1ISKA 4V2DA 7STDA 3EBTA 3NV0A 4KVHA 1D0BA 1O7NB 1JL5A 4FCGA 3EN8A 3MYTA 3TSRE 1DS9A 4ARNA 1P9AG 3G16A 2YFLB 5AIHA 3WPGA 3LZAA 3W3KA 2INXA 3GRDA 4H3UA 5KP1A 3OXAA 3FGYA 4LI1A 2BNGA 4K1UA 4XBYA 3NBRA 2WQVA 4Q62A 3C6NB 3WPBA 1O6TA 2JE1A 3OJAA 4R07A 1AR0A 2ELLA 4RZMA 3D9RA 4LXRA 4MN8B 5A5CA 3UNLA 3ER7A 3G8ZA 2BEXA 4MJDA 1DFJI 4U08A 1PGVA 2Z76A 1A2KA 2UX0A 3DZEA 4U09A 2OMZA 1JN5B 2R9UA 3RGZA 3CVRA 2RFRA 2RA8A 2OMWA 1ZX2A 5CMPA 4IM6A 3F7SA 4J8TA 4ECOA 4WP5A 4FMZA 3M8CA 3CPOA 4IIAA 3O53A 5IYXC 5AI1A 4ECNA 3WPDA 2ID5A 2HMMB 4Z64C 2XSOB 2Q4GW 3OGKB 1H6UA 4M7EA 5HZLB 4R08A 4R6AA 3JUPA 3FKAA 4Q3IA 3W3MA 3CIYA 3CU3A 2BNHA 4CNCA 1DCEA 3WPEA 5CLKA 5AIIA 4GT6A 2WFHA 1GYBA 3KKGA 3E2JA 4OQTA 3ZYNA 2XRXB 2Z7XA 3RW7A 3M18A 3WPIA 3WMDA 4Q3GA 4KT1A 4FDWA 3PMHG 2XR8B 2O6SA 3MG3A 2B1XB 2HMLB 1BUQA 2ASSB 5GMFA 5B0TA 1IO0A 3REZA 5DRVA 1GS3A 1Q40B 4R6FA 4X2OA 4R6GA 4BSRA 2PZVA 5GQRK 3BB9A 3KZTA 3P72A 1A4YA 4R6JA 3C6PB 3LYGA 3E6JA 5STDA 3KE7A 3OV4A 1OPYA 1G9UA 3SOAA 4X2HA 3G06A 1W6YA 4K1VA 5D3IA 4STDA 1DMQA 4XBXA 1P8TA 1VZZA 1ULJB 3WPCA 1M10B 5DREA 2I9WA 1ZIWA 2HMKB 4R09A 2CKFB 5GMGA 2WQXA 4HM8B 1OZNA 3NXJA 3UL8A 4XDVA 3MG1A 3EQQB 1A9NA 2F86B 1OTOA 1JB4A 5G2GA 3G39A 3F8HA 2FT3A 4Y61B 4RCAB 2IMJA 2YFIB 5CK6A 3CIGA 2JQDA 4L8PA 4BSUA 4HVNA 3W3JA 1W01A 1S5AA 1FO1A 4FHOA 3Q90A 3B7CA 3G0KA 2O6RA 3MKIA 5AEWB 4XOSA 1XCDA 1GY7A 2Z64A 2HMNB 3OX9A 1STDA 1M0ZA 3UL7A 5FW5A 5IJDA 3A76A 3NHXA 8CHOA 5B0NA 4PEJA 4Z61C 2JE0A 5IEOA 1JB2A 2RR6A 2GXFA 4HM1B 1UUVB 4LSXC 2BMRB 3DM8A 3KSPA 4L8OA 1JB5A 2F98A 4XM4A 3JUNA 2V9SA 1M9LA 4HM2B 1NWWA 1OCVA 4N3VA 1Z7XW 5D82A 3T8NA 5JPPA 1JKGB 1W8AA 5JPUA 4FCJA 3STDA 1IDPA 1OF5B 3FZWA 3GOZA 1EA2A 4KNGA 3W3LA 3GZYB 1JN5A 3NM2A 6STDA 1GWBA 4K17A 4HJLB 1OUNA 4C2AB 3RGXA 3GZBA 4PKIG 4LXSA 4OVMA 1NU3A 1NDOB 4R9KA 3GWRA 4I6JB 4CP6A 4CC4C 4C2BB 3I0YA 2CA6A 5GS2B 1KOOA 1WWLA 4LSAA 4P8SA 3W3GA 3CNXA 3B8LA 3G3BA 1O7HB 3FF2A 1ASKA 2O6QA 4WP6A 4YEBB 1K5GC 3RFEA 4BV4R 3EF8A 2Z82A 1XKUA 1K41A 1UUWB 3UL9A 4HM5B 3ULAA 4HM3B 3JUQA 3A79B 3E3ZA 2JQ5A 3BZ5A 3DXOA 3OGLB 3FLJA 5HGRA 2OMTA 4RCWA 1O6SA 1OHOA 2WQWA 3ULUA 2W2CA 1O7PB 3F14A 3FSDA 5AWBA 1Q40A 5AIGA 2OWPA 4ORLA 3F7XA 5TGNA 2XWTC 3BLZA 3EBYA 5AWAA 5B4PA 2A15A 2QGUA 3F40A 4GLPA 1HKXA 3T8UA 1OGZA 4LEHA 4FCMA 4XSQA 2Z65A 4LI2A 2B24B 4L3AA 1XECA 4XGOA 4XB5A 5BVBA 2ASTB 1H6TA 3G04C 2K54A 4QBZA 2Z63A 5D83A 2V70A 3M19A 2A0ZA 4LMIA 1QMAA 1XWDC 4U7LA 2R4IA 4KXFB 4CILA 3B4PA 1XEUA 4LSCA 3DMCA 2P1PB 4J0MA 2XOTA 3EC9A 2RCDA 2P1NB 4Z8GA 2HMOB 1O7MB 4U13A 3G3AA 3FF0A 4FS7A 5AZ5A 4XBTA 2WQUA 1Z1SA 1KOHA 4MQWX 4AW4A 4I4KA 4Z79A 1GY5A 4UFRA 4J4LA 1OTMA 4V2CA 1O7WB 4HKVB 2OMUA 3DZLA 4R0AA 2XSHB 2OMXA 4R9LA 5GS0A 2GEXA 1ZO2A 3K7CA 4QC0A 5IG4A 4NKGA 3SEDA 5AWCA 1E3RA 4V2EA 4WYKB 3VQ2A 5IENA 3RGAA 2OMYA 4Q53A 5IJCA 1TUHA 3FXIA 2Z66A 1DMNA 2GBWB 3MSOA 1GY6A 5AEUB 5LFNA 4PERA 2Y5QA 1FT8A 3F8XA 5IG3A 3SB4A 3GZXB 1P8VA 4HQ1A 3IPTA 5CMNA 3NV0B 5IERA 1JKGA
chains in the Genus database with same CATH superfamily
1OH0A 1IVWA 4ARRA 1RLSA 3DY5A 3FG4A 3LMLA 2IFGA 1KQS2 1U0ND 1OTNA 3ROBA 5KP3A 1TU5A 3WN4A 3V92A 5M18A 6GSPA 3MG2A 3CCS3 1JNQA 3B4OA 1FGOA 2IUJA 1Q42A 2GBXB 1RN4A 3T0UA 5IEPA 3EHCA 2OQEC 4J5GA 1UW1A 1IU7A 1DYUA 2RGQA 1E97A 4WWUC 3H3HA 3QRDA 1W6CA 2Z81A 4BL2A 1YVSA 1UGIA 3K9MC 2W9QA 2O9UX 1TRQA 1OOKG 1LNHA 4LZIA 3HK4A 2IYJA 2KAAA 5M19A 2BMQB 1TP6A 2GEYA 3ZYJA 4HM6B 4EZGA 1HU9A 1IVVA 3AMOA 3S5CA 1T2IA 2E2TA 2BHMA 3GAXA 1M9SA 1VQP3 3WPFA 1WMOA 4RBNA 5IG0A 2RNTA 1K8A4 1N9EA 3KFQC 3RIZA 3CCR3 4OUQA 2UZXA 3SXXA 4AY9X 3BNDA 1UDII 5KP4A 4R5CA 4AKZA 5FGOA 5BXQA 3VQ1A 3F9SA 3D79A 4NKHA 1ISKA 3EBTA 2WGOA 3PCRA 1JL5A 3MYTA 3TSRE 1W2ZA 2J8XB 2INXA 3GRDA 3SLUA 3KCHA 1US1A 5EQLA 2XFSA 3CPW2 3WPBA 4NZTM 1O6TA 3FCSB 4RZMA 1AV4A 1AVKA 3WOFB 5A5CA 4FMDA 3WR2A 2KF6A 1MWTA 3S28A 2Z76A 2UX0A 3X41A 2R9UA 5CMPA 3HI7A 3AGNA 4J8TA 1VQL3 4ECOA 3N8BA 3M8CA 4IIAA 4ECNA 3WPDA 4Z64C 2XSOB 4EBGA 2Y74A 4R08A 1PU4A 3CXC2 2QA43 2BNHA 3LT9A 5AIIA 2WFHA 4OQTA 3AHSA 1JZDA 1BRHA 2HMLB 2ASSB 1IO0A 3X3YA 1GS3A 4R6GA 1LOYA 1A4YA 3SX1A 2OQEA 1YJ93 3C6PB 2P38A 2C4BA 2CFKA 4LSOA 1W6YA 1IV7A 4H61A 4BU4A 3JVCA 1M10B 1B20A 2CKFB 1VQN3 1QAFA 3UL8A 3NXJA 9RNTA 4XDVA 3MG1A 1UCJA 3EQQB 1JB4A 3CC73 3G39A 1IQYA 5CK6A 1VQO3 1OACA 1MGRA 1Q864 3W3JA 4FMAA 3Q90A 3B7CA 2O6RA 2XGLA 1GOYA 3RNTA 1M0ZA 1SARA 4GSPA 2ZDJA 2CFWA 2AADA 4N6LA 1JB2A 3CD63 4HM1B 1UUVB 2BMRB 3KSED 3KSPA 1G02A 2V9SA 3PYJA 1OCVA 1JKGB 4FCJA 2W04A 2W6JH 4NZRM 4KNGA 1BNGA 1A67A 5GSPA 2BU4A 3IMAB 1GWBA 3DGYA 2ML6A 1RGHA 2CW9A 1K734 4I6JB 1CYVA 1N8QA 1N5HA 3I0YA 1AQZA 1RJOA 4P8SA 3W3GA 2O6QA 1VQ73 3RFEA 3EF8A 1XKUA 2UUGC 2QEX3 3UL9A 1ZGXA 4HM3B 1I2GA 3A79B 1VQK3 3E3ZA 2JQ5A 5HGRA 1MNLA 4I5QA 1OHOA 1V57A 2W2CA 1O7PB 3F14A 1UUGB 4ORLA 3NM7A 3F7XA 4AEQA 1B2SA 1YHQ3 5TGNA 5LC7A 2CIUA 3EBYA 2QGUA 1HKXA 4LI2A 1F8NA 1XECA 3G04C 2WO0A 2K54A 4FR9A 1FUSA 2V70A 4AKYA 4MMZB 4MEIA 4LMIA 1QMAA 4U7LA 4J5KA 4KXFB 4LSCA 4J0MA 2XOTA 1PY3A 2HMOB 4U13A 2AAEA 1KOHA 4I4KA 4Z79A 4J4LA 3KIIA 1VQ63 4R9LA 5GS0A 1ZO2A 3K7CA 1IT8A 3S29A 1E3RA 4WYKB 1KD14 4Q53A 6RNTA 1TUHA 2Z66A 1I3FA 4K90B 3ZG0A 1UCLA 3MSOA 4PERA 1ZS7A 1FT8A 1P8VA 1JKGA 3RFSA 4CDLA 2STDA 1NB5I 1UCKA 5CXOA 2CG1A 4N6V0 2PNCA 4PEQB 3CCL3 1WMPA 1A2PA 4KFEA 2C10A 3DUKA 2W56B 3I563 4R5DA 3NUVA 5IJBA 1B2XA 3OJAB 1YRGA 1QYYA 2P1MB 3OWUA 3WPHA 2RSXA 3UL6A 1OHSA 3RFJA 3EJVA 5G1LA 1BAOA 4RNYA 4BTYA 1EG9B 1IYYA 3JUOA 1OGXA 1B2ZA 4RWTC 2QIYA 3ZYOA 1T3BA 1W6GA 1E3VA 4L7KA 3WODG 2WOHA 5CF1A 5A0OB 3PCSA 1TFOA 4MMXB 3VGNA 5IG5A 4GB5A 3FH1A 3ZG5A 5ELJA 5AWDA 3SYUA 2XGNA 4XDWA 5BIRA 5I97A 5HDHA 2CX1A 1FQVA 4HOHA 4R1KA 4H09A 1DVCA 1DMMA 1SQ0B 3S27A 3OWYA 4LYLB 4FCZA 3E4GA 3DGLA 1FUTA 1K5DC 4WFOA 3RW6A 3EX9A 4WYKA 1VQ83 3K0ZA 3CCV3 4ZM8A 1LQGC 4BIRA 3ULVA 3VSYA 1BVIA 1FGQA 3OW22 1P9AG 1VQ43 3G16A 2M7OA 2YFLB 3WOEB 3LZAA 2W56A 1WNHA 1RDSA 3FGYA 3FG3A 1M904 2BNGA 4XBYA 3C6NB 3NX0A 3OJAA 4R07A 1K28A 1BNIA 2ELLA 3D9RA 4KFFA 2GSPA 1MWSA 3HIGA 3ER7A 1PFPA 1N8R4 1PGVA 4GHOA 3ZFZA 1RN1A 4U09A 2OMZA 3BU4A 3RGZA 3WA3A 2RA8A 2OMWA 1ZX2A 4IM6A 1WMNA 1VQ93 1TTOA 7GSPA 2H0IA 2KCDA 2FGTA 1I0XA 1H6UA 2D42A 4R6AA 3JUPA 3FKAA 3W3MA 3CIYA 3CU3A 4CNCA 1DCEA 1EEJA 2ML5A 3CCU3 3WPEA 3DH2A 3WPIA 4KT1A 4FDWA 3CCQ3 5GMFA 3PGBA 3REZA 2GU1A 2P0MA 1ROAA 1Q40B 4R6FA 1HYFA 3BB9A 3KZTA 4R6JA 5STDA 1SIIA 3KE7A 3OV4A 3VF1A 1OPYA 2W03A 2IY2A 3SOAA 3G06A 1Q9EA 1DMQA 1BRSA 1VZZA 3PZWA 1DE3A 4JF8A 3TDGA 1A9NA 2F86B 4TX4A 3LTCA 5G2GA 2FT3A 3LTAA 2FNQA 4EV2A 1LOVA 2YFIB 1NB3I 3CIGA 2JQDA 1JBRA 1W01A 3PXMA 1S5AA 1FO1A 3G0KA 4XOSA 2UGIA 3G4S3 1XCDA 1GY7A 2Z64A 2HMNB 1GOVA 1V74A 5FW5A 5IJDA 3A76A 1BIRA 1IVUA 4EW5A 2JE0A 2XH9A 2ZL8A 4LSXC 1RTUA 1JB5A 4XM4A 3NBBA 4HM2B 1NWWA 4N3VA 3T8NA 5JPPA 4RNZA 2F56A 1W7CA 3STDA 1OF5B 3GOZA 1EA2A 3NM2A 3K63A 4K17A 3DGMA 4HJLB 1EQKA 1OUNA 4KT3B 1AY7A 4PKIG 4OVMA 4R9KA 1TJDA 4CC4C 2CA6A 1KOOA 4LSAA 1TFKA 3G3BA 3FF2A 4WP6A 1D6YA 4BV4R 3MPHA 1BSAA 2Z82A 1K41A 3BZ5A 1BSBA 1R4YA 4RCWA 2WQWA 3FSDA 2BO9B 1Q40A 3BNBA 2A15A 4GLPA 1RGAA 1RGFA 1OGZA 4FCMA 1MOLA 2Z65A 4L3AA 4XGOA 4XB5A 2ASTB 2V1LA 4QBZA 3BNCA 2Z63A 1VQM3 5D83A 3M19A 2KF4A 2E2UA 3BIRA 2P1PB 1UGHI 1LNIA 1Q814 4FS7A 1FW7A 1Z1SA 4EC6A 1BNEA 1RGLA 2OMUA 2XF3A 3DZLA 2XSHB 1Y4KA 3LOYA 2OMXA 1YVBI 1I70A 3SEDA 5AWCA 1I3IA 3U1WA 5IJCA 3Q1CA 1Q7Y4 1GY6A 5AEUB 3F8XA 1QALA 5IG3A 1TIJA 5CMNA 2BT3A 3NV0B 5IERA 4V2DA 2CC3A 1OF5A 3H51A 2F99A 1RSNA 3D5GA 1ULIB 4HZ9B 1KSIA 5D81A 5AIFA 1OGQA 3RJ0A 4P91A 2OTL3 3C6OB 4LSXA 1YI23 2CFDA 4J9AA 1S723 2YFJB 4HM7B 4G8AA 3OWSA 1RMSA 4CNMA 4HZBB 4B8CD 5IF6A 1YGWA 1QJGA 2Q07A 5M1AA 5JBSA 8RNTA 4CC4A 4U06A 5CF2A 2P1QB 2OMVA 2P09A 4PSJA 2P05A 2CK3H 4NHFA 2Z7XB 4CJNA 1L5GB 1C7HA 2Z6BA 2UZYA 1UI7A 1FGMA 5FTTB 3RGRA 3SOYA 1NJI4 2CFGA 2YX9A 4N6TA 1X1UA 5GMHA 3JB9j 1I0VA 3UN9A 3JUMA 2L1SA 3V99A 1W02A 1BNSA 4PQ8A 1AVLA 1KC84 4NREA 1GMQA 3HZPA 3X3XA 1BRIA 4CPKA 4BSSA 1RKYA 3J7Yd 1O6VA 2CHCA 1IV9A 7STDA 3NV0A 4RNTA 5BU4A 1LRAA 4HYZA 4R4KA 1O7NB 4FCGA 3EN8A 1DS9A 5AIHA 1BNRA 4N6MA 1BU4A 3W3KA 3N9HA 2WQVA 4Q62A 4BTWA 2JE1A 1AR0A 2SARA 4LXRA 3UNLA 1GOUA 2XEPA 2BEXA 4MJDA 1BRGA 1V58A 2BIRA 1A2KA 1CH0A 1CYUA 1JN5B 2RFRA 2MC8A 1ROVA 3SVAA 2P0XA 3N54B 4WP5A 4FMZA 2C11A 1LVNA 3L0RA 1BRNL 1BSCA 2KRTA 1BUJA 2SBLA 3AHWA 2ZHXB 4KFDA 4BL3A 1GYBA 1YNVX 2K0MA 3CCJ3 2Z7XA 5RNTA 3M18A 4Q3GA 2D1WA 2O6SA 3MG3A 1A90A 1BUQA 4FMCA 5DRVA 4X2OA 4BSRA 2PZVA 5GQRK 4O02B 4IPBA 5AYRB 3LYGA 4EXRA 1W2B2 1G9UA 5D3IA 1FGRA 1P8TA 3X42A 3WPCA 5DREA 3WHOA 1ZIWA 2HMKB 4R09A 5GMGA 1OZNA 1JZOA 4Y61B 2IMJA 4L8PA 4HVNA 1HZ1A 3FG1A 4O8SA 2Y73A 1CEWI 2W0QA 3MKIA 4N6OB 1RCLA 3OX9A 1T5YA 4Z61C 4PEJA 2RBIA 1C54A 3CME3 2RR6A 3HOHA 2GXFA 1YGEA 3DM8A 2F98A 3JUNA 4NPBA 1IDPA 2XFTA 4KZ1A 3V98A 3GZYB 1JN5A 6STDA 2W9PA 4O2HA 3RGXA 3GZBA 3G713 1M9GA 2IA7A 1NU3A 3RDEA 2CH9A 3U97A 3CC23 4C2BB 1RCKA 3IJEB 3HIIA 5GS2B 3D5IA 1WWLA 4R80A 1RGKA 1G0TA 3CNXA 3B8LA 1ASKA 4JRFA 1B2UA 2IUKA 1R4CA 4BTXA 3ULAA 3JUQA 1KWIA 4MMYB 1LOXA 4GL6A 3OGLB 1MGWA 1O6SA 3A5EA 5AWBA 5AIGA 2OWPA 1BOXA 2HOHA 2XWTC 5B4PA 1A2VA 4LEHA 5AYSC 1W5ZA 1BRKA 3ALAA 5BVBA 1VQ53 1H6TA 2CWTA 1X1YA 1JBSA 3NQYA 1RRLA 4FMBA 3K5TA 2A0ZA 1BSEA 1LQMB 1XWDC 3LXUX 1RN7A 2R4IA 4CILA 3B4PA 1EKMA 3CCM3 1QAKA 2RCDA 2KF5A 1YIJ3 4Z8GA 1O7MB 1RGCA 4XBTA 2WQUA 4AW4A 1GY5A 3EB8A 4UFRA 4V2CA 1O7WB 4HKVB 2OCTA 2FXTA 2GEXA 1FUWA 4QC0A 5IG4A 1QVG2 2WGQA 4V2EA 3VQ2A 1RNBA 5IENA 2OMYA 3FXIA 3MWZA 2GBWB 5LFNA 1IK3A 3GZXB 3SB4A 3IPTA 3AGOA 5G1KA 3UJMA 1WQLB 3ECFA 1I8VA 3E99A 2Z62A 1SIHA 4L3FA 5EVHA 4M7EC 1RGEA 1JBTA 4HAAA 1BGSA 3MHEA 1YJW3 4N6UA 2V9TB 3OGMB 2BMOB 1RNTA 1CQSA 3O6NA 1W00A 2H0GA 2CX0A 2O3OA 1SJWA 2CWVA 2P1OB 1JV2B 4R58A 4Z94G 2H0HA 4N6NB 3KJ4A 3X40A 2Z77A 2Z7AA 2KF3A 1FA3A 1GMPA 1O7GB 3W3NA 3PS8A 1RRHA 2HMJB 1BNFA 1GD4A 1YJN3 3NBJA 1T2HA 1B3SA 1UCIA 1B2MA 3HX8A 1U5OA 4HM4B 1M1XB 1EUIC 4IT7A 4FD0A 3Q3FA 1IVXA 3EN1B 3BNEA 1OHPA 2LYXA 3CNMA 1D6ZA 1FS2A 3ZYIA 4LGQA 1QVF2 1K9M4 4HM0B 3GZRA 4TZHA 1LTXA 3WDGB 1IT7A 4KVHA 1D0BA 1I2FA 1WTHA 4ARNA 3WPGA 4ILFA 2GU3A 4EYCA 4H3UA 5KP1A 3OXAA 4LI1A 1M1K4 5HOHA 4K1UA 4G1MB 3LTBA 3UL5A 3NBRA 1FZUA 4MN8B 3O8YA 1LXEA 3G8ZA 1BANA 1N9JA 1DFJI 4U08A 3CC43 1GMRA 2MF7A 1UI8A 3DZEA 3CVRA 3D4AA 3F7SA 3CPOA 1BRJA 3O53A 5IYXC 5AI1A 3KN4A 2ID5A 2HMMB 3S67A 3UB1A 2Q4GW 3OGKB 4M7EA 5HZLB 1FGTA 4Q3IA 5CLKA 4GT6A 1PYLA 3KKGA 3E2JA 3ZYNA 2XRXB 3RW7A 3WMDA 1STFI 3PMHG 2XR8B 2B1XB 1RHLA 5B0TA 1MWRA 3WA2X 3P72A 1NNVA 1Q7HA 3E6JA 1RGGA 4X2HA 4K1VA 3QK9A 2JDIH 4STDA 4XBXA 2ZA4A 1ULJB 1LOWA 3GSPA 2OOVC 3CMA3 2I9WA 1TRPA 2KXGA 2CWUA 2WQXA 4HM8B 1FYSA 2F4YA 1OTOA 3F8HA 4RCAB 4BSUA 4FHOA 5AEWB 7RNTA 1STDA 3UL7A 3NHXA 4EV5A 8CHOA 5B0NA 3D3LA 2K3DA 5LC6A 5IEOA 5ELUA 3Q2PA 4CCVA 4L8OA 1SPUA 1M9LA 1Z7XW 5D82A 3X3ZA 5IW9A 1W8AA 5JPUA 3FZWA 1N5PA 3W3LA 1JRQA 2OTJ3 4C2AB 4LXSA 1NDOB 3GWRA 4CP6A 1J2BA 4O3VA 1DETA 5EEOA 1X1XA 4OK0A 1YIT3 1IQ8A 1O7HB 1NO3A 2CFLA 1GD3A 1BSDA 4YEBB 1K5GC 2LQVA 1UUWB 4HM5B 1I2EA 4K61A 4HBRA 3DXOA 3FLJA 1X1WA 2L4VA 2OMTA 3CCE3 3ULUA 1JJ22 2WOFA 1B21A 3BLZA 2F5WA 5AWAA 3F40A 3T8UA 3DGNA 4XSQA 2B24B 1DVDA 2R41A 3EE1A 4QWTA 1SQWA 1U8CB 1BNJA 2E2VA 1GSPA 1W4NA 3G6E3 1XEUA 1MWUA 3DMCA 3AMOB 3URPA 1Q824 3EC9A 1B27A 3LTDA 4WHAA 2P1NB 3G3AA 3FF0A 5AZ5A 4MQWX 1OTMA 3LH4A 1G96A 4DKIA 4R0AA 3DGOA 4NKGA 2OOVA 1VQQA 2CG0A 3RGAA 3LT8A 2F5MA 1DMNA 3NQZA 1IQXA 2Y5QA 3I553 4HQ1A 1D6UA 4QXEA
chains in the Genus database with same CATH topology
3RFSA 1OF5A 4CDLA 1OH0A 2STDA 3H51A 1NB5I 3UJMA 5CXOA 1IVWA 2CG1A 2F99A 4N6V0 4ARRA 1WQLB 2PNCA 4PEQB 3CCL3 1WMPA 3ECFA 1ULIB 4KFEA 2C10A 3DY5A 3DUKA 3FG4A 3E99A 2W56B 4HZ9B 3I563 2Z62A 4R5DA 1SIHA 3NUVA 3LMLA 1KSIA 4L3FA 5IJBA 5D81A 2IFGA 1KQS2 5EVHA 5AIFA 1OGQA 3OJAB 1YRGA 1QYYA 4M7EC 1U0ND 1OTNA 3RJ0A 2P1MB 3ROBA 5KP3A 4P91A 2OTL3 4Q62A 1TU5A 3C6OB 3WN4A 4LSXA 3OWUA 3WPHA 2RSXA 3MHEA 1YJW3 4N6UA 3V92A 1YI23 3UL6A 2V9TB 1OHSA 2CFDA 3RFJA 3EJVA 3MG2A 4J9AA 3CCS3 4RNYA 4BTYA 1JNQA 3B4OA 1EG9B 1FGOA 3OGMB 3JUOA 1OGXA 2BMOB 1S723 2IUJA 1CQSA 1Q42A 2YFJB 4HM7B 4G8AA 3O6NA 1W00A 4RWTC 2QIYA 3OWSA 4CNMA 4HZBB 2GBXB 2O3OA 1SJWA 2CWVA 3T0UA 5IEPA 4QXEA 5IF6A 2P1OB 1JV2B 1QJGA 2Q07A 2OQEC 3EHCA 4R58A 4Z94G 4N6NB 3KJ4A 5JBSA 3X40A 2Z77A 3ZYOA 1UW1A 2Z7AA 1IU7A 1W6GA 1DYUA 1FA3A 1E3VA 4L7KA 2RGQA 2WOHA 3WODG 1E97A 5CF1A 4CC4A 4WWUC 3H3HA 3QRDA 5A0OB 1O7GB 4U06A 3PCSA 5CF2A 2P1QB 2OMVA 1TFOA 1W6CA 2P09A 2Z81A 3PS8A 4MMXB 4PSJA 3W3NA 3VGNA 2P05A 5IG5A 3K9MC 2CK3H 4GB5A 3FH1A 2W9QA 2O9UX 4NHFA 1RRHA 2HMJB 2Z7XB 5ELJA 1OOKG 5AWDA 1LNHA 1GD4A 2XGNA 4LZIA 4XDWA 3HK4A 1L5GB 1C7HA 1YJN3 3NBJA 2Z6BA 5I97A 2UZYA 1UI7A 1FGMA 1TP6A 2BMQB 2GEYA 5FTTB 3ZYJA 4HM6B 3RGRA 3SOYA 1NJI4 5HDHA 1FQVA 4EZGA 4R1KA 1HU9A 1IVVA 2CFGA 3AMOA 2YX9A 1DVCA 4H09A 1DMMA 4N6TA 3S5CA 1SQ0B 3HX8A 2E2TA 1U5OA 2BHMA 4HM4B 5GMHA 1M1XB 3JB9j 3GAXA 1M9SA 4IT7A 1VQP3 3S27A 3WPFA 3UN9A 1WMOA 3JUMA 4RBNA 5IG0A 4FD0A 3OWYA 1IVXA 3EN1B 4FCZA 3V99A 3E4GA 1W02A 3DGLA 1K5DC 4PQ8A 1K8A4 1AVLA 1N9EA 3BNEA 3KFQC 1OHPA 1KC84 2LYXA 4NREA 3CNMA 3RIZA 3CCR3 4OUQA 4WFOA 2UZXA 1D6ZA 3HZPA 3RW6A 3X3XA 3SXXA 4AY9X 3EX9A 4WYKA 1VQ83 3BNDA 3K0ZA 5KP4A 4BSSA 1RKYA 1FS2A 3J7Yd 4AKZA 4R5CA 1O6VA 3ZYIA 5FGOA 3CCV3 4LGQA 1QVF2 4ZM8A 2CHCA 5BXQA 1K9M4 1IV9A 4HM0B 3ULVA 3VQ1A 3F9SA 3VSYA 3GZRA 4NKHA 4TZHA 1LTXA 3WDGB 1ISKA 4V2DA 7STDA 3EBTA 3NV0A 1IT7A 1FGQA 2WGOA 4HYZA 4KVHA 1D0BA 4R4KA 3PCRA 1O7NB 1JL5A 4FCGA 1WTHA 3EN8A 3MYTA 3TSRE 1DS9A 4ARNA 3OW22 1P9AG 1VQ43 3G16A 1W2ZA 2M7OA 2YFLB 5AIHA 3WOEB 3WPGA 3LZAA 4N6MA 3W3KA 2GU3A 2INXA 2W56A 1WNHA 3GRDA 4EYCA 4H3UA 5KP1A 3OXAA 3FGYA 3SLUA 1US1A 3FG3A 4LI1A 5EQLA 1M1K4 2BNGA 1M904 3N9HA 4G1MB 2XFSA 3LTBA 3NBRA 4K1UA 4XBYA 3UL5A 3NX0A 3CPW2 2WQVA 3C6NB 1O6TA 4BTWA 2JE1A 1K28A 3OJAA 3WPBA 3FCSB 4R07A 1AR0A 2ELLA 4RZMA 1AV4A 3D9RA 4KFFA 1AVKA 3O8YA 3WOFB 4LXRA 4MN8B 5A5CA 3UNLA 4FMDA 3HIGA 1LXEA 3ER7A 3G8ZA 2XEPA 2BEXA 1PFPA 1N9JA 4MJDA 1DFJI 3S28A 1N8R4 4U08A 1PGVA 3CC43 2Z76A 2MF7A 1UI8A 1A2KA 2UX0A 3DZEA 3X41A 4U09A 1CYUA 2OMZA 1JN5B 2R9UA 3RGZA 3CVRA 2RFRA 3WA3A 2RA8A 2OMWA 1ZX2A 3HI7A 2MC8A 5CMPA 4IM6A 1WMNA 3F7SA 1VQ93 1ROVA 4J8TA 3SVAA 1VQL3 2P0XA 4ECOA 3N54B 4WP5A 4FMZA 3N8BA 2C11A 3M8CA 3CPOA 4IIAA 3O53A 1LVNA 5IYXC 2KCDA 5AI1A 4ECNA 3KN4A 3WPDA 2ID5A 2HMMB 3S67A 2FGTA 3L0RA 3UB1A 2XSOB 4EBGA 2Q4GW 4Z64C 3OGKB 1H6UA 4M7EA 2KRTA 2D42A 2Y74A 1PU4A 1FGTA 4R6AA 3JUPA 4R08A 3FKAA 2SBLA 3CXC2 4Q3IA 3W3MA 3CIYA 2QA43 3CU3A 2BNHA 4CNCA 1DCEA 2ML5A 3CCU3 3WPEA 3LT9A 5CLKA 5AIIA 4KFDA 4GT6A 2WFHA 1GYBA 3KKGA 2K0MA 3E2JA 3CCJ3 2XRXB 2Z7XA 4OQTA 3RW7A 3ZYNA 3M18A 3WPIA 3WMDA 1STFI 4Q3GA 2D1WA 4KT1A 4FDWA 3PMHG 2XR8B 2O6SA 3MG3A 2B1XB 2HMLB 1A90A 1BUQA 3CCQ3 2ASSB 5GMFA 5B0TA 1IO0A 3PGBA 3REZA 2GU1A 4FMCA 5DRVA 2P0MA 1ROAA 3X3YA 1GS3A 1Q40B 4R6FA 4X2OA 4R6GA 4BSRA 2PZVA 5GQRK 3WA2X 3BB9A 3KZTA 4O02B 1A4YA 4IPBA 5AYRB 3P72A 3SX1A 2OQEA 1YJ93 4R6JA 3C6PB 3LYGA 3E6JA 4EXRA 5STDA 1SIIA 2P38A 3KE7A 3OV4A 3VF1A 1OPYA 2CFKA 2W03A 1W2B2 1G9UA 3SOAA 4LSOA 4X2HA 3G06A 1W6YA 4K1VA 1IV7A 1FGRA 5D3IA 4H61A 3QK9A 2JDIH 4STDA 1DMQA 4XBXA 1P8TA 1VZZA 3X42A 1ULJB 3JVCA 3CMA3 2OOVC 5DREA 2I9WA 1M10B 3WPCA 3PZWA 1ZIWA 2HMKB 2KXGA 2CWUA 2CKFB 4R09A 1VQN3 4HM8B 4JF8A 1QAFA 2WQXA 5GMGA 3TDGA 1OZNA 3NXJA 3UL8A 4XDVA 3MG1A 3EQQB 1A9NA 2F86B 4TX4A 1OTOA 1JB4A 3LTCA 5G2GA 3CC73 3F8HA 3G39A 1IQYA 2FT3A 3LTAA 4Y61B 2FNQA 4EV2A 4RCAB 2IMJA 2YFIB 5CK6A 1NB3I 3CIGA 2JQDA 1VQO3 4L8PA 1OACA 1Q864 4BSUA 4HVNA 3FG1A 3W3JA 5HZLB 1W01A 4FMAA 3PXMA 1S5AA 1FO1A 4FHOA 4O8SA 3Q90A 2Y73A 1CEWI 2W0QA 3B7CA 3G0KA 2O6RA 2XGLA 3MKIA 5AEWB 4XOSA 3G4S3 4N6OB 1XCDA 1GY7A 2Z64A 2HMNB 3OX9A 1STDA 1M0ZA 1T5YA 3UL7A 1V74A 5FW5A 5IJDA 3A76A 3NHXA 4EV5A 8CHOA 4PEJA 5B0NA 1IVUA 2ZDJA 4Z61C 2CFWA 2JE0A 3D3LA 4N6LA 5LC6A 3CME3 2XH9A 2V9SA 5IEOA 2ZL8A 5ELUA 1JB2A 2RR6A 3CD63 2GXFA 1YGEA 1UUVB 3Q2PA 2BMRB 3DM8A 4HM1B 4LSXC 3KSED 3KSPA 4L8OA 1JB5A 4CCVA 2F98A 4XM4A 1SPUA 3JUNA 3NBBA 4HM2B 3PYJA 1NWWA 1M9LA 1OCVA 4N3VA 1Z7XW 5D82A 3T8NA 3X3ZA 5IW9A 5JPPA 1JKGB 4RNZA 5JPUA 4FCJA 1W7CA 3STDA 1W8AA 1IDPA 1OF5B 2W04A 2W6JH 3FZWA 3GOZA 1EA2A 1N5PA 4KNGA 3W3LA 1JRQA 2XFTA 4KZ1A 1A67A 3V98A 3GZYB 1JN5A 3K63A 3NM2A 2OTJ3 6STDA 3IMAB 1GWBA 4K17A 3DGMA 2ML6A 4HJLB 1EQKA 2W9PA 4O2HA 1OUNA 4C2AB 3RGXA 3GZBA 4PKIG 4LXSA 4OVMA 2CW9A 1M9GA 2IA7A 1NU3A 3G713 1NDOB 4R9KA 3RDEA 1K734 3GWRA 4I6JB 4CP6A 2CH9A 1J2BA 1CYVA 3U97A 1N8QA 4CC4C 4O3VA 3CC23 4C2BB 1N5HA 3I0YA 3IJEB 5EEOA 3HIIA 2CA6A 1RJOA 5GS2B 1KOOA 1WWLA 4R80A 4LSAA 4OK0A 4P8SA 3W3GA 1TFKA 1YIT3 1IQ8A 3B8LA 3CNXA 1O7HB 1NO3A 2CFLA 1GD3A 3FF2A 1ASKA 3G3BA 2O6QA 1VQ73 4WP6A 4YEBB 1D6YA 4JRFA 1K5GC 2LQVA 3RFEA 3MPHA 4BV4R 3EF8A 2IUKA 2Z82A 1R4CA 1XKUA 1K41A 4BTXA 1UUWB 2QEX3 4HM5B 3UL9A 3ULAA 4HM3B 4K61A 3JUQA 1KWIA 4HBRA 1VQK3 4MMYB 3A79B 3E3ZA 1LOXA 2JQ5A 3BZ5A 3DXOA 4GL6A 3OGLB 3FLJA 5HGRA 2L4VA 2OMTA 1MNLA 4RCWA 3CCE3 1OHOA 1O6SA 2WQWA 3ULUA 2W2CA 1O7PB 3F14A 3FSDA 5AWBA 2BO9B 1Q40A 5AIGA 2OWPA 4ORLA 3NM7A 1JJ22 3F7XA 2WOFA 4AEQA 1YHQ3 5TGNA 5LC7A 3BNBA 2XWTC 3BLZA 2CIUA 3EBYA 5AWAA 5B4PA 2A15A 2QGUA 3F40A 4GLPA 1HKXA 3T8UA 1OGZA 1A2VA 4LEHA 3DGNA 4FCMA 5AYSC 1MOLA 1W5ZA 4XSQA 3ALAA 2Z65A 4LI2A 2B24B 1F8NA 4L3AA 1XECA 4XGOA 4XB5A 5BVBA 2ASTB 1VQ53 1H6TA 1DVDA 2CWTA 3G04C 4B8CD 2V1LA 2WO0A 2K54A 3EE1A 4FR9A 4QBZA 3BNCA 2Z63A 4QWTA 3NQYA 1RRLA 4FMBA 3K5TA 1SQWA 5D83A 1U8CB 1VQM3 4AKYA 2V70A 3M19A 2A0ZA 4MMZB 4MEIA 4LMIA 1QMAA 2E2VA 1XWDC 3LXUX 1RN7A 1W4NA 4U7LA 2R4IA 3G6E3 4KXFB 4CILA 2E2UA 3B4PA 1XEUA 4LSCA 3DMCA 3AMOB 1Q824 2P1PB 1EKMA 4J0MA 3CCM3 2XOTA 3EC9A 1QAKA 3LTDA 2RCDA 4WHAA 1YIJ3 2P1NB 1Q814 4Z8GA 2HMOB 1O7MB 4U13A 3G3AA 3FF0A 4FS7A 5AZ5A 4XBTA 2WQUA 1Z1SA 1KOHA 4MQWX 4AW4A 4EC6A 4I4KA 4Z79A 1GY5A 3EB8A 4UFRA 4J4LA 1OTMA 3LH4A 4V2CA 1G96A 1O7WB 4HKVB 3KIIA 2XF3A 3DZLA 2OCTA 2FXTA 3DGOA 1VQ63 2OMUA 4R0AA 2XSHB 1Y4KA 3LOYA 4R9LA 2OMXA 2GEXA 1ZO2A 3K7CA 1FUWA 4QC0A 5GS0A 1IT8A 1YVBI 5IG4A 2OOVA 2WGQA 1QVG2 4NKGA 3SEDA 5AWCA 3S29A 1E3RA 4V2EA 4WYKB 3U1WA 3VQ2A 2CG0A 1KD14 5IENA 3RGAA 2OMYA 4Q53A 3LT8A 1TUHA 5IJCA 3FXIA 2Z66A 1DMNA 3MWZA 3Q1CA 4K90B 1Q7Y4 2GBWB 3MSOA 3NQZA 1IQXA 1GY6A 5AEUB 4PERA 5LFNA 2Y5QA 1FT8A 3F8XA 1QALA 5IG3A 1TIJA 3GZXB 1IK3A 3I553 1P8VA 3SB4A 4HQ1A 3IPTA 5CMNA 2BT3A 3NV0B 1D6UA 5IERA 1JKGA 2CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFS A;  1OF5 A;  4CDL A;  1OH0 A;  2STD A;  3H51 A;  3UJM A;  5CXO A;  2F99 A;  4ARR A;  1WQL B;  4PEQ B;  3ECF A;  1ULI B;  4HZ9 B;  3DUK A;  3E99 A;  2Z62 A;  4R5D A;  3NUV A;  4L3F A;  5IJB A;  5D81 A;  2IFG A;  5EVH A;  5AIF A;  1OGQ A;  3OJA B;  1YRG A;  1QYY A;  4M7E C;  1U0N D;  1OTN A;  3RJ0 A;  2P1M B;  3ROB A;  5KP3 A;  4P91 A;  3WN4 A;  3C6O B;  4LSX A;  3OWU A;  3WPH A;  3MHE A;  2V9T B;  1OHS A;  3RFJ A;  3EJV A;  3MG2 A;  4J9A A;  3B4O A;  1EG9 B;  3OGM B;  3JUO A;  1OGX A;  2BMO B;  1CQS A;  1Q42 A;  2YFJ B;  4HM7 B;  4G8A A;  3O6N A;  1W00 A;  4RWT C;  2QIY A;  3OWS A;  4CNM A;  4HZB B;  2GBX B;  4QXE A;  1SJW A;  5IEP A;  4B8C D;  5IF6 A;  2P1O B;  1QJG A;  3EHC A;  4R58 A;  4Z94 G;  3KJ4 A;  2Z77 A;  3ZYO A;  2Z7A A;  1E3V A;  4L7K A;  2RGQ A;  5CF1 A;  1E97 A;  4CC4 A;  4WWU C;  3H3H A;  1O7G B;  4U06 A;  5CF2 A;  2P1Q B;  2OMV A;  3W3N A;  2Z81 A;  4PSJ A;  3VGN A;  5IG5 A;  4GB5 A;  3FH1 A;  2HMJ B;  2Z7X B;  1OOK G;  5AWD A;  4XDW A;  3HK4 A;  1C7H A;  2UZY A;  2BMQ B;  1TP6 A;  2GEY A;  5FTT B;  3ZYJ A;  4HM6 B;  3RGR A;  3SOY A;  5HDH A;  1FQV A;  4EZG A;  4R1K A;  4H09 A;  1DMM A;  3S5C A;  1SQ0 B;  3HX8 A;  5GMH A;  1U5O A;  4HM4 B;  3JB9 j;  1M9S A;  3WPF A;  3UN9 A;  3JUM A;  5IG0 A;  4FD0 A;  3OWY A;  3EN1 B;  3E4G A;  1W02 A;  1K5D C;  4PQ8 A;  1OHP A;  3CNM A;  3RIZ A;  4OUQ A;  2UZX A;  3HZP A;  3RW6 A;  4AY9 X;  3EX9 A;  4WYK A;  3K0Z A;  5KP4 A;  4BSS A;  1FS2 A;  4R5C A;  1O6V A;  3ZYI A;  4LGQ A;  2CHC A;  5BXQ A;  3VQ1 A;  4HM0 B;  3ULV A;  3F9S A;  3VSY A;  3GZR A;  4NKH A;  4TZH A;  1LTX A;  1ISK A;  4V2D A;  7STD A;  3EBT A;  3NV0 A;  4KVH A;  1D0B A;  1O7N B;  1JL5 A;  4FCG A;  3EN8 A;  3MYT A;  3TSR E;  1DS9 A;  4ARN A;  1P9A G;  3G16 A;  2YFL B;  5AIH A;  3WPG A;  3LZA A;  3W3K A;  2INX A;  3GRD A;  4H3U A;  5KP1 A;  3OXA A;  3FGY A;  4LI1 A;  2BNG A;  4K1U A;  4XBY A;  3NBR A;  2WQV A;  4Q62 A;  3C6N B;  3WPB A;  1O6T A;  2JE1 A;  3OJA A;  4R07 A;  1AR0 A;  2ELL A;  4RZM A;  3D9R A;  4LXR A;  4MN8 B;  5A5C A;  3UNL A;  3ER7 A;  3G8Z A;  2BEX A;  4MJD A;  1DFJ I;  4U08 A;  1PGV A;  2Z76 A;  1A2K A;  2UX0 A;  3DZE A;  4U09 A;  2OMZ A;  1JN5 B;  2R9U A;  3RGZ A;  3CVR A;  2RFR A;  2RA8 A;  2OMW A;  1ZX2 A;  5CMP A;  4IM6 A;  3F7S A;  4J8T A;  4ECO A;  4WP5 A;  4FMZ A;  3M8C A;  3CPO A;  4IIA A;  3O53 A;  5IYX C;  5AI1 A;  4ECN A;  3WPD A;  2ID5 A;  2HMM B;  4Z64 C;  2XSO B;  2Q4G W;  3OGK B;  1H6U A;  4M7E A;  5HZL B;  4R08 A;  4R6A A;  3JUP A;  3FKA A;  4Q3I A;  3W3M A;  3CIY A;  3CU3 A;  2BNH A;  4CNC A;  1DCE A;  3WPE A;  5CLK A;  5AII A;  4GT6 A;  2WFH A;  1GYB A;  3KKG A;  3E2J A;  4OQT A;  3ZYN A;  2XRX B;  2Z7X A;  3RW7 A;  3M18 A;  3WPI A;  3WMD A;  4Q3G A;  4KT1 A;  4FDW A;  3PMH G;  2XR8 B;  2O6S A;  3MG3 A;  2B1X B;  2HML B;  1BUQ A;  2ASS B;  5GMF A;  5B0T A;  1IO0 A;  3REZ A;  5DRV A;  1GS3 A;  1Q40 B;  4R6F A;  4X2O A;  4R6G A;  4BSR A;  2PZV A;  5GQR K;  3BB9 A;  3KZT A;  3P72 A;  1A4Y A;  4R6J A;  3C6P B;  3LYG A;  3E6J A;  5STD A;  3KE7 A;  3OV4 A;  1OPY A;  1G9U A;  3SOA A;  4X2H A;  3G06 A;  1W6Y A;  4K1V A;  5D3I A;  4STD A;  1DMQ A;  4XBX A;  1P8T A;  1VZZ A;  1ULJ B;  3WPC A;  1M10 B;  5DRE A;  2I9W A;  1ZIW A;  2HMK B;  4R09 A;  2CKF B;  5GMG A;  2WQX A;  4HM8 B;  1OZN A;  3NXJ A;  3UL8 A;  4XDV A;  3MG1 A;  3EQQ B;  1A9N A;  2F86 B;  1OTO A;  1JB4 A;  5G2G A;  3G39 A;  3F8H A;  2FT3 A;  4Y61 B;  4RCA B;  2IMJ A;  2YFI B;  5CK6 A;  3CIG A;  2JQD A;  4L8P A;  4BSU A;  4HVN A;  3W3J A;  1W01 A;  1S5A A;  1FO1 A;  4FHO A;  3Q90 A;  3B7C A;  3G0K A;  2O6R A;  3MKI A;  5AEW B;  4XOS A;  1XCD A;  1GY7 A;  2Z64 A;  2HMN B;  3OX9 A;  1STD A;  1M0Z A;  3UL7 A;  5FW5 A;  5IJD A;  3A76 A;  3NHX A;  8CHO A;  5B0N A;  4PEJ A;  4Z61 C;  2JE0 A;  5IEO A;  1JB2 A;  2RR6 A;  2GXF A;  4HM1 B;  1UUV B;  4LSX C;  2BMR B;  3DM8 A;  3KSP A;  4L8O A;  1JB5 A;  2F98 A;  4XM4 A;  3JUN A;  2V9S A;  1M9L A;  4HM2 B;  1NWW A;  1OCV A;  4N3V A;  1Z7X W;  5D82 A;  3T8N A;  5JPP A;  1JKG B;  1W8A A;  5JPU A;  4FCJ A;  3STD A;  1IDP A;  1OF5 B;  3FZW A;  3GOZ A;  1EA2 A;  4KNG A;  3W3L A;  3GZY B;  1JN5 A;  3NM2 A;  6STD A;  1GWB A;  4K17 A;  4HJL B;  1OUN A;  4C2A B;  3RGX A;  3GZB A;  4PKI G;  4LXS A;  4OVM A;  1NU3 A;  1NDO B;  4R9K A;  3GWR A;  4I6J B;  4CP6 A;  4CC4 C;  4C2B B;  3I0Y A;  2CA6 A;  5GS2 B;  1KOO A;  1WWL A;  4LSA A;  4P8S A;  3W3G A;  3CNX A;  3B8L A;  3G3B A;  1O7H B;  3FF2 A;  1ASK A;  2O6Q A;  4WP6 A;  4YEB B;  1K5G C;  3RFE A;  4BV4 R;  3EF8 A;  2Z82 A;  1XKU A;  1K41 A;  1UUW B;  3UL9 A;  4HM5 B;  3ULA A;  4HM3 B;  3JUQ A;  3A79 B;  3E3Z A;  2JQ5 A;  3BZ5 A;  3DXO A;  3OGL B;  3FLJ A;  5HGR A;  2OMT A;  4RCW A;  1O6S A;  1OHO A;  2WQW A;  3ULU A;  2W2C A;  1O7P B;  3F14 A;  3FSD A;  5AWB A;  1Q40 A;  5AIG A;  2OWP A;  4ORL A;  3F7X A;  5TGN A;  2XWT C;  3BLZ A;  3EBY A;  5AWA A;  5B4P A;  2A15 A;  2QGU A;  3F40 A;  4GLP A;  1HKX A;  3T8U A;  1OGZ A;  4LEH A;  4FCM A;  4XSQ A;  2Z65 A;  4LI2 A;  2B24 B;  4L3A A;  1XEC A;  4XGO A;  4XB5 A;  5BVB A;  2AST B;  1H6T A;  3G04 C;  2K54 A;  4QBZ A;  2Z63 A;  5D83 A;  2V70 A;  3M19 A;  2A0Z A;  4LMI A;  1QMA A;  1XWD C;  4U7L A;  2R4I A;  4KXF B;  4CIL A;  3B4P A;  1XEU A;  4LSC A;  3DMC A;  2P1P B;  4J0M A;  2XOT A;  3EC9 A;  2RCD A;  2P1N B;  4Z8G A;  2HMO B;  1O7M B;  4U13 A;  3G3A A;  3FF0 A;  4FS7 A;  5AZ5 A;  4XBT A;  2WQU A;  1Z1S A;  1KOH A;  4MQW X;  4AW4 A;  4I4K A;  4Z79 A;  1GY5 A;  4UFR A;  4J4L A;  1OTM A;  4V2C A;  1O7W B;  4HKV B;  2OMU A;  3DZL A;  4R0A A;  2XSH B;  2OMX A;  4R9L A;  5GS0 A;  2GEX A;  1ZO2 A;  3K7C A;  4QC0 A;  5IG4 A;  4NKG A;  3SED A;  5AWC A;  1E3R A;  4V2E A;  4WYK B;  3VQ2 A;  5IEN A;  3RGA A;  2OMY A;  4Q53 A;  5IJC A;  1TUH A;  3FXI A;  2Z66 A;  1DMN A;  2GBW B;  3MSO A;  1GY6 A;  5AEU B;  5LFN A;  4PER A;  2Y5Q A;  1FT8 A;  3F8X A;  5IG3 A;  3SB4 A;  3GZX B;  1P8V A;  4HQ1 A;  3IPT A;  5CMN A;  3NV0 B;  5IER A;  1JKG A; 
#chains in the Genus database with same CATH topology
 1OH0 A;  1IVW A;  4ARR A;  1RLS A;  3DY5 A;  3FG4 A;  3LML A;  2IFG A;  1KQS 2;  1U0N D;  1OTN A;  3ROB A;  5KP3 A;  1TU5 A;  3WN4 A;  3V92 A;  5M18 A;  6GSP A;  3MG2 A;  3CCS 3;  1JNQ A;  3B4O A;  1FGO A;  2IUJ A;  1Q42 A;  2GBX B;  1RN4 A;  3T0U A;  5IEP A;  3EHC A;  2OQE C;  4J5G A;  1UW1 A;  1IU7 A;  1DYU A;  2RGQ A;  1E97 A;  4WWU C;  3H3H A;  3QRD A;  1W6C A;  2Z81 A;  4BL2 A;  1YVS A;  1UGI A;  3K9M C;  2W9Q A;  2O9U X;  1TRQ A;  1OOK G;  1LNH A;  4LZI A;  3HK4 A;  2IYJ A;  2KAA A;  5M19 A;  2BMQ B;  1TP6 A;  2GEY A;  3ZYJ A;  4HM6 B;  4EZG A;  1HU9 A;  1IVV A;  3AMO A;  3S5C A;  1T2I A;  2E2T A;  2BHM A;  3GAX A;  1M9S A;  1VQP 3;  3WPF A;  1WMO A;  4RBN A;  5IG0 A;  2RNT A;  1K8A 4;  1N9E A;  3KFQ C;  3RIZ A;  3CCR 3;  4OUQ A;  2UZX A;  3SXX A;  4AY9 X;  3BND A;  1UDI I;  5KP4 A;  4R5C A;  4AKZ A;  5FGO A;  5BXQ A;  3VQ1 A;  3F9S A;  3D79 A;  4NKH A;  1ISK A;  3EBT A;  2WGO A;  3PCR A;  1JL5 A;  3MYT A;  3TSR E;  1W2Z A;  2J8X B;  2INX A;  3GRD A;  3SLU A;  3KCH A;  1US1 A;  5EQL A;  2XFS A;  3CPW 2;  3WPB A;  4NZT M;  1O6T A;  3FCS B;  4RZM A;  1AV4 A;  1AVK A;  3WOF B;  5A5C A;  4FMD A;  3WR2 A;  2KF6 A;  1MWT A;  3S28 A;  2Z76 A;  2UX0 A;  3X41 A;  2R9U A;  5CMP A;  3HI7 A;  3AGN A;  4J8T A;  1VQL 3;  4ECO A;  3N8B A;  3M8C A;  4IIA A;  4ECN A;  3WPD A;  4Z64 C;  2XSO B;  4EBG A;  2Y74 A;  4R08 A;  1PU4 A;  3CXC 2;  2QA4 3;  2BNH A;  3LT9 A;  5AII A;  2WFH A;  4OQT A;  3AHS A;  1JZD A;  1BRH A;  2HML B;  2ASS B;  1IO0 A;  3X3Y A;  1GS3 A;  4R6G A;  1LOY A;  1A4Y A;  3SX1 A;  2OQE A;  1YJ9 3;  3C6P B;  2P38 A;  2C4B A;  2CFK A;  4LSO A;  1W6Y A;  1IV7 A;  4H61 A;  4BU4 A;  3JVC A;  1M10 B;  1B20 A;  2CKF B;  1VQN 3;  1QAF A;  3UL8 A;  3NXJ A;  9RNT A;  4XDV A;  3MG1 A;  1UCJ A;  3EQQ B;  1JB4 A;  3CC7 3;  3G39 A;  1IQY A;  5CK6 A;  1VQO 3;  1OAC A;  1MGR A;  1Q86 4;  3W3J A;  4FMA A;  3Q90 A;  3B7C A;  2O6R A;  2XGL A;  1GOY A;  3RNT A;  1M0Z A;  1SAR A;  4GSP A;  2ZDJ A;  2CFW A;  2AAD A;  4N6L A;  1JB2 A;  3CD6 3;  4HM1 B;  1UUV B;  2BMR B;  3KSE D;  3KSP A;  1G02 A;  2V9S A;  3PYJ A;  1OCV A;  1JKG B;  4FCJ A;  2W04 A;  2W6J H;  4NZR M;  4KNG A;  1BNG A;  1A67 A;  5GSP A;  2BU4 A;  3IMA B;  1GWB A;  3DGY A;  2ML6 A;  1RGH A;  2CW9 A;  1K73 4;  4I6J B;  1CYV A;  1N8Q A;  1N5H A;  3I0Y A;  1AQZ A;  1RJO A;  4P8S A;  3W3G A;  2O6Q A;  1VQ7 3;  3RFE A;  3EF8 A;  1XKU A;  2UUG C;  2QEX 3;  3UL9 A;  1ZGX A;  4HM3 B;  1I2G A;  3A79 B;  1VQK 3;  3E3Z A;  2JQ5 A;  5HGR A;  1MNL A;  4I5Q A;  1OHO A;  1V57 A;  2W2C A;  1O7P B;  3F14 A;  1UUG B;  4ORL A;  3NM7 A;  3F7X A;  4AEQ A;  1B2S A;  1YHQ 3;  5TGN A;  5LC7 A;  2CIU A;  3EBY A;  2QGU A;  1HKX A;  4LI2 A;  1F8N A;  1XEC A;  3G04 C;  2WO0 A;  2K54 A;  4FR9 A;  1FUS A;  2V70 A;  4AKY A;  4MMZ B;  4MEI A;  4LMI A;  1QMA A;  4U7L A;  4J5K A;  4KXF B;  4LSC A;  4J0M A;  2XOT A;  1PY3 A;  2HMO B;  4U13 A;  2AAE A;  1KOH A;  4I4K A;  4Z79 A;  4J4L A;  3KII A;  1VQ6 3;  4R9L A;  5GS0 A;  1ZO2 A;  3K7C A;  1IT8 A;  3S29 A;  1E3R A;  4WYK B;  1KD1 4;  4Q53 A;  6RNT A;  1TUH A;  2Z66 A;  1I3F A;  4K90 B;  3ZG0 A;  1UCL A;  3MSO A;  4PER A;  1ZS7 A;  1FT8 A;  1P8V A;  1JKG A;  3RFS A;  4CDL A;  2STD A;  1NB5 I;  1UCK A;  5CXO A;  2CG1 A;  4N6V 0;  2PNC A;  4PEQ B;  3CCL 3;  1WMP A;  1A2P A;  4KFE A;  2C10 A;  3DUK A;  2W56 B;  3I56 3;  4R5D A;  3NUV A;  5IJB A;  1B2X A;  3OJA B;  1YRG A;  1QYY A;  2P1M B;  3OWU A;  3WPH A;  2RSX A;  3UL6 A;  1OHS A;  3RFJ A;  3EJV A;  5G1L A;  1BAO A;  4RNY A;  4BTY A;  1EG9 B;  1IYY A;  3JUO A;  1OGX A;  1B2Z A;  4RWT C;  2QIY A;  3ZYO A;  1T3B A;  1W6G A;  1E3V A;  4L7K A;  3WOD G;  2WOH A;  5CF1 A;  5A0O B;  3PCS A;  1TFO A;  4MMX B;  3VGN A;  5IG5 A;  4GB5 A;  3FH1 A;  3ZG5 A;  5ELJ A;  5AWD A;  3SYU A;  2XGN A;  4XDW A;  5BIR A;  5I97 A;  5HDH A;  2CX1 A;  1FQV A;  4HOH A;  4R1K A;  4H09 A;  1DVC A;  1DMM A;  1SQ0 B;  3S27 A;  3OWY A;  4LYL B;  4FCZ A;  3E4G A;  3DGL A;  1FUT A;  1K5D C;  4WFO A;  3RW6 A;  3EX9 A;  4WYK A;  1VQ8 3;  3K0Z A;  3CCV 3;  4ZM8 A;  1LQG C;  4BIR A;  3ULV A;  3VSY A;  1BVI A;  1FGQ A;  3OW2 2;  1P9A G;  1VQ4 3;  3G16 A;  2M7O A;  2YFL B;  3WOE B;  3LZA A;  2W56 A;  1WNH A;  1RDS A;  3FGY A;  3FG3 A;  1M90 4;  2BNG A;  4XBY A;  3C6N B;  3NX0 A;  3OJA A;  4R07 A;  1K28 A;  1BNI A;  2ELL A;  3D9R A;  4KFF A;  2GSP A;  1MWS A;  3HIG A;  3ER7 A;  1PFP A;  1N8R 4;  1PGV A;  4GHO A;  3ZFZ A;  1RN1 A;  4U09 A;  2OMZ A;  3BU4 A;  3RGZ A;  3WA3 A;  2RA8 A;  2OMW A;  1ZX2 A;  4IM6 A;  1WMN A;  1VQ9 3;  1TTO A;  7GSP A;  2H0I A;  2KCD A;  2FGT A;  1I0X A;  1H6U A;  2D42 A;  4R6A A;  3JUP A;  3FKA A;  3W3M A;  3CIY A;  3CU3 A;  4CNC A;  1DCE A;  1EEJ A;  2ML5 A;  3CCU 3;  3WPE A;  3DH2 A;  3WPI A;  4KT1 A;  4FDW A;  3CCQ 3;  5GMF A;  3PGB A;  3REZ A;  2GU1 A;  2P0M A;  1ROA A;  1Q40 B;  4R6F A;  1HYF A;  3BB9 A;  3KZT A;  4R6J A;  5STD A;  1SII A;  3KE7 A;  3OV4 A;  3VF1 A;  1OPY A;  2W03 A;  2IY2 A;  3SOA A;  3G06 A;  1Q9E A;  1DMQ A;  1BRS A;  1VZZ A;  3PZW A;  1DE3 A;  4JF8 A;  3TDG A;  1A9N A;  2F86 B;  4TX4 A;  3LTC A;  5G2G A;  2FT3 A;  3LTA A;  2FNQ A;  4EV2 A;  1LOV A;  2YFI B;  1NB3 I;  3CIG A;  2JQD A;  1JBR A;  1W01 A;  3PXM A;  1S5A A;  1FO1 A;  3G0K A;  4XOS A;  2UGI A;  3G4S 3;  1XCD A;  1GY7 A;  2Z64 A;  2HMN B;  1GOV A;  1V74 A;  5FW5 A;  5IJD A;  3A76 A;  1BIR A;  1IVU A;  4EW5 A;  2JE0 A;  2XH9 A;  2ZL8 A;  4LSX C;  1RTU A;  1JB5 A;  4XM4 A;  3NBB A;  4HM2 B;  1NWW A;  4N3V A;  3T8N A;  5JPP A;  4RNZ A;  2F56 A;  1W7C A;  3STD A;  1OF5 B;  3GOZ A;  1EA2 A;  3NM2 A;  3K63 A;  4K17 A;  3DGM A;  4HJL B;  1EQK A;  1OUN A;  4KT3 B;  1AY7 A;  4PKI G;  4OVM A;  4R9K A;  1TJD A;  4CC4 C;  2CA6 A;  1KOO A;  4LSA A;  1TFK A;  3G3B A;  3FF2 A;  4WP6 A;  1D6Y A;  4BV4 R;  3MPH A;  1BSA A;  2Z82 A;  1K41 A;  3BZ5 A;  1BSB A;  1R4Y A;  4RCW A;  2WQW A;  3FSD A;  2BO9 B;  1Q40 A;  3BNB A;  2A15 A;  4GLP A;  1RGA A;  1RGF A;  1OGZ A;  4FCM A;  1MOL A;  2Z65 A;  4L3A A;  4XGO A;  4XB5 A;  2AST B;  2V1L A;  4QBZ A;  3BNC A;  2Z63 A;  1VQM 3;  5D83 A;  3M19 A;  2KF4 A;  2E2U A;  3BIR A;  2P1P B;  1UGH I;  1LNI A;  1Q81 4;  4FS7 A;  1FW7 A;  1Z1S A;  4EC6 A;  1BNE A;  1RGL A;  2OMU A;  2XF3 A;  3DZL A;  2XSH B;  1Y4K A;  3LOY A;  2OMX A;  1YVB I;  1I70 A;  3SED A;  5AWC A;  1I3I A;  3U1W A;  5IJC A;  3Q1C A;  1Q7Y 4;  1GY6 A;  5AEU B;  3F8X A;  1QAL A;  5IG3 A;  1TIJ A;  5CMN A;  2BT3 A;  3NV0 B;  5IER A;  4V2D A;  2CC3 A;  1OF5 A;  3H51 A;  2F99 A;  1RSN A;  3D5G A;  1ULI B;  4HZ9 B;  1KSI A;  5D81 A;  5AIF A;  1OGQ A;  3RJ0 A;  4P91 A;  2OTL 3;  3C6O B;  4LSX A;  1YI2 3;  2CFD A;  4J9A A;  1S72 3;  2YFJ B;  4HM7 B;  4G8A A;  3OWS A;  1RMS A;  4CNM A;  4HZB B;  4B8C D;  5IF6 A;  1YGW A;  1QJG A;  2Q07 A;  5M1A A;  5JBS A;  8RNT A;  4CC4 A;  4U06 A;  5CF2 A;  2P1Q B;  2OMV A;  2P09 A;  4PSJ A;  2P05 A;  2CK3 H;  4NHF A;  2Z7X B;  4CJN A;  1L5G B;  1C7H A;  2Z6B A;  2UZY A;  1UI7 A;  1FGM A;  5FTT B;  3RGR A;  3SOY A;  1NJI 4;  2CFG A;  2YX9 A;  4N6T A;  1X1U A;  5GMH A;  3JB9 j;  1I0V A;  3UN9 A;  3JUM A;  2L1S A;  3V99 A;  1W02 A;  1BNS A;  4PQ8 A;  1AVL A;  1KC8 4;  4NRE A;  1GMQ A;  3HZP A;  3X3X A;  1BRI A;  4CPK A;  4BSS A;  1RKY A;  3J7Y d;  1O6V A;  2CHC A;  1IV9 A;  7STD A;  3NV0 A;  4RNT A;  5BU4 A;  1LRA A;  4HYZ A;  4R4K A;  1O7N B;  4FCG A;  3EN8 A;  1DS9 A;  5AIH A;  1BNR A;  4N6M A;  1BU4 A;  3W3K A;  3N9H A;  2WQV A;  4Q62 A;  4BTW A;  2JE1 A;  1AR0 A;  2SAR A;  4LXR A;  3UNL A;  1GOU A;  2XEP A;  2BEX A;  4MJD A;  1BRG A;  1V58 A;  2BIR A;  1A2K A;  1CH0 A;  1CYU A;  1JN5 B;  2RFR A;  2MC8 A;  1ROV A;  3SVA A;  2P0X A;  3N54 B;  4WP5 A;  4FMZ A;  2C11 A;  1LVN A;  3L0R A;  1BRN L;  1BSC A;  2KRT A;  1BUJ A;  2SBL A;  3AHW A;  2ZHX B;  4KFD A;  4BL3 A;  1GYB A;  1YNV X;  2K0M A;  3CCJ 3;  2Z7X A;  5RNT A;  3M18 A;  4Q3G A;  2D1W A;  2O6S A;  3MG3 A;  1A90 A;  1BUQ A;  4FMC A;  5DRV A;  4X2O A;  4BSR A;  2PZV A;  5GQR K;  4O02 B;  4IPB A;  5AYR B;  3LYG A;  4EXR A;  1W2B 2;  1G9U A;  5D3I A;  1FGR A;  1P8T A;  3X42 A;  3WPC A;  5DRE A;  3WHO A;  1ZIW A;  2HMK B;  4R09 A;  5GMG A;  1OZN A;  1JZO A;  4Y61 B;  2IMJ A;  4L8P A;  4HVN A;  1HZ1 A;  3FG1 A;  4O8S A;  2Y73 A;  1CEW I;  2W0Q A;  3MKI A;  4N6O B;  1RCL A;  3OX9 A;  1T5Y A;  4Z61 C;  4PEJ A;  2RBI A;  1C54 A;  3CME 3;  2RR6 A;  3HOH A;  2GXF A;  1YGE A;  3DM8 A;  2F98 A;  3JUN A;  4NPB A;  1IDP A;  2XFT A;  4KZ1 A;  3V98 A;  3GZY B;  1JN5 A;  6STD A;  2W9P A;  4O2H A;  3RGX A;  3GZB A;  3G71 3;  1M9G A;  2IA7 A;  1NU3 A;  3RDE A;  2CH9 A;  3U97 A;  3CC2 3;  4C2B B;  1RCK A;  3IJE B;  3HII A;  5GS2 B;  3D5I A;  1WWL A;  4R80 A;  1RGK A;  1G0T A;  3CNX A;  3B8L A;  1ASK A;  4JRF A;  1B2U A;  2IUK A;  1R4C A;  4BTX A;  3ULA A;  3JUQ A;  1KWI A;  4MMY B;  1LOX A;  4GL6 A;  3OGL B;  1MGW A;  1O6S A;  3A5E A;  5AWB A;  5AIG A;  2OWP A;  1BOX A;  2HOH A;  2XWT C;  5B4P A;  1A2V A;  4LEH A;  5AYS C;  1W5Z A;  1BRK A;  3ALA A;  5BVB A;  1VQ5 3;  1H6T A;  2CWT A;  1X1Y A;  1JBS A;  3NQY A;  1RRL A;  4FMB A;  3K5T A;  2A0Z A;  1BSE A;  1LQM B;  1XWD C;  3LXU X;  1RN7 A;  2R4I A;  4CIL A;  3B4P A;  1EKM A;  3CCM 3;  1QAK A;  2RCD A;  2KF5 A;  1YIJ 3;  4Z8G A;  1O7M B;  1RGC A;  4XBT A;  2WQU A;  4AW4 A;  1GY5 A;  3EB8 A;  4UFR A;  4V2C A;  1O7W B;  4HKV B;  2OCT A;  2FXT A;  2GEX A;  1FUW A;  4QC0 A;  5IG4 A;  1QVG 2;  2WGQ A;  4V2E A;  3VQ2 A;  1RNB A;  5IEN A;  2OMY A;  3FXI A;  3MWZ A;  2GBW B;  5LFN A;  1IK3 A;  3GZX B;  3SB4 A;  3IPT A;  3AGO A;  5G1K A;  3UJM A;  1WQL B;  3ECF A;  1I8V A;  3E99 A;  2Z62 A;  1SIH A;  4L3F A;  5EVH A;  4M7E C;  1RGE A;  1JBT A;  4HAA A;  1BGS A;  3MHE A;  1YJW 3;  4N6U A;  2V9T B;  3OGM B;  2BMO B;  1RNT A;  1CQS A;  3O6N A;  1W00 A;  2H0G A;  2CX0 A;  2O3O A;  1SJW A;  2CWV A;  2P1O B;  1JV2 B;  4R58 A;  4Z94 G;  2H0H A;  4N6N B;  3KJ4 A;  3X40 A;  2Z77 A;  2Z7A A;  2KF3 A;  1FA3 A;  1GMP A;  1O7G B;  3W3N A;  3PS8 A;  1RRH A;  2HMJ B;  1BNF A;  1GD4 A;  1YJN 3;  3NBJ A;  1T2H A;  1B3S A;  1UCI A;  1B2M A;  3HX8 A;  1U5O A;  4HM4 B;  1M1X B;  1EUI C;  4IT7 A;  4FD0 A;  3Q3F A;  1IVX A;  3EN1 B;  3BNE A;  1OHP A;  2LYX A;  3CNM A;  1D6Z A;  1FS2 A;  3ZYI A;  4LGQ A;  1QVF 2;  1K9M 4;  4HM0 B;  3GZR A;  4TZH A;  1LTX A;  3WDG B;  1IT7 A;  4KVH A;  1D0B A;  1I2F A;  1WTH A;  4ARN A;  3WPG A;  4ILF A;  2GU3 A;  4EYC A;  4H3U A;  5KP1 A;  3OXA A;  4LI1 A;  1M1K 4;  5HOH A;  4K1U A;  4G1M B;  3LTB A;  3UL5 A;  3NBR A;  1FZU A;  4MN8 B;  3O8Y A;  1LXE A;  3G8Z A;  1BAN A;  1N9J A;  1DFJ I;  4U08 A;  3CC4 3;  1GMR A;  2MF7 A;  1UI8 A;  3DZE A;  3CVR A;  3D4A A;  3F7S A;  3CPO A;  1BRJ A;  3O53 A;  5IYX C;  5AI1 A;  3KN4 A;  2ID5 A;  2HMM B;  3S67 A;  3UB1 A;  2Q4G W;  3OGK B;  4M7E A;  5HZL B;  1FGT A;  4Q3I A;  5CLK A;  4GT6 A;  1PYL A;  3KKG A;  3E2J A;  3ZYN A;  2XRX B;  3RW7 A;  3WMD A;  1STF I;  3PMH G;  2XR8 B;  2B1X B;  1RHL A;  5B0T A;  1MWR A;  3WA2 X;  3P72 A;  1NNV A;  1Q7H A;  3E6J A;  1RGG A;  4X2H A;  4K1V A;  3QK9 A;  2JDI H;  4STD A;  4XBX A;  2ZA4 A;  1ULJ B;  1LOW A;  3GSP A;  2OOV C;  3CMA 3;  2I9W A;  1TRP A;  2KXG A;  2CWU A;  2WQX A;  4HM8 B;  1FYS A;  2F4Y A;  1OTO A;  3F8H A;  4RCA B;  4BSU A;  4FHO A;  5AEW B;  7RNT A;  1STD A;  3UL7 A;  3NHX A;  4EV5 A;  8CHO A;  5B0N A;  3D3L A;  2K3D A;  5LC6 A;  5IEO A;  5ELU A;  3Q2P A;  4CCV A;  4L8O A;  1SPU A;  1M9L A;  1Z7X W;  5D82 A;  3X3Z A;  5IW9 A;  1W8A A;  5JPU A;  3FZW A;  1N5P A;  3W3L A;  1JRQ A;  2OTJ 3;  4C2A B;  4LXS A;  1NDO B;  3GWR A;  4CP6 A;  1J2B A;  4O3V A;  1DET A;  5EEO A;  1X1X A;  4OK0 A;  1YIT 3;  1IQ8 A;  1O7H B;  1NO3 A;  2CFL A;  1GD3 A;  1BSD A;  4YEB B;  1K5G C;  2LQV A;  1UUW B;  4HM5 B;  1I2E A;  4K61 A;  4HBR A;  3DXO A;  3FLJ A;  1X1W A;  2L4V A;  2OMT A;  3CCE 3;  3ULU A;  1JJ2 2;  2WOF A;  1B21 A;  3BLZ A;  2F5W A;  5AWA A;  3F40 A;  3T8U A;  3DGN A;  4XSQ A;  2B24 B;  1DVD A;  2R41 A;  3EE1 A;  4QWT A;  1SQW A;  1U8C B;  1BNJ A;  2E2V A;  1GSP A;  1W4N A;  3G6E 3;  1XEU A;  1MWU A;  3DMC A;  3AMO B;  3URP A;  1Q82 4;  3EC9 A;  1B27 A;  3LTD A;  4WHA A;  2P1N B;  3G3A A;  3FF0 A;  5AZ5 A;  4MQW X;  1OTM A;  3LH4 A;  1G96 A;  4DKI A;  4R0A A;  3DGO A;  4NKG A;  2OOV A;  1VQQ A;  2CG0 A;  3RGA A;  3LT8 A;  2F5M A;  1DMN A;  3NQZ A;  1IQX A;  2Y5Q A;  3I55 3;  4HQ1 A;  1D6U A;  4QXE A; 
#chains in the Genus database with same CATH homology
 3RFS A;  1OF5 A;  4CDL A;  1OH0 A;  2STD A;  3H51 A;  1NB5 I;  3UJM A;  5CXO A;  1IVW A;  2CG1 A;  2F99 A;  4N6V 0;  4ARR A;  1WQL B;  2PNC A;  4PEQ B;  3CCL 3;  1WMP A;  3ECF A;  1ULI B;  4KFE A;  2C10 A;  3DY5 A;  3DUK A;  3FG4 A;  3E99 A;  2W56 B;  4HZ9 B;  3I56 3;  2Z62 A;  4R5D A;  1SIH A;  3NUV A;  3LML A;  1KSI A;  4L3F A;  5IJB A;  5D81 A;  2IFG A;  1KQS 2;  5EVH A;  5AIF A;  1OGQ A;  3OJA B;  1YRG A;  1QYY A;  4M7E C;  1U0N D;  1OTN A;  3RJ0 A;  2P1M B;  3ROB A;  5KP3 A;  4P91 A;  2OTL 3;  4Q62 A;  1TU5 A;  3C6O B;  3WN4 A;  4LSX A;  3OWU A;  3WPH A;  2RSX A;  3MHE A;  1YJW 3;  4N6U A;  3V92 A;  1YI2 3;  3UL6 A;  2V9T B;  1OHS A;  2CFD A;  3RFJ A;  3EJV A;  3MG2 A;  4J9A A;  3CCS 3;  4RNY A;  4BTY A;  1JNQ A;  3B4O A;  1EG9 B;  1FGO A;  3OGM B;  3JUO A;  1OGX A;  2BMO B;  1S72 3;  2IUJ A;  1CQS A;  1Q42 A;  2YFJ B;  4HM7 B;  4G8A A;  3O6N A;  1W00 A;  4RWT C;  2QIY A;  3OWS A;  4CNM A;  4HZB B;  2GBX B;  2O3O A;  1SJW A;  2CWV A;  3T0U A;  5IEP A;  4QXE A;  5IF6 A;  2P1O B;  1JV2 B;  1QJG A;  2Q07 A;  2OQE C;  3EHC A;  4R58 A;  4Z94 G;  4N6N B;  3KJ4 A;  5JBS A;  3X40 A;  2Z77 A;  3ZYO A;  1UW1 A;  2Z7A A;  1IU7 A;  1W6G A;  1DYU A;  1FA3 A;  1E3V A;  4L7K A;  2RGQ A;  2WOH A;  3WOD G;  1E97 A;  5CF1 A;  4CC4 A;  4WWU C;  3H3H A;  3QRD A;  5A0O B;  1O7G B;  4U06 A;  3PCS A;  5CF2 A;  2P1Q B;  2OMV A;  1TFO A;  1W6C A;  2P09 A;  2Z81 A;  3PS8 A;  4MMX B;  4PSJ A;  3W3N A;  3VGN A;  2P05 A;  5IG5 A;  3K9M C;  2CK3 H;  4GB5 A;  3FH1 A;  2W9Q A;  2O9U X;  4NHF A;  1RRH A;  2HMJ B;  2Z7X B;  5ELJ A;  1OOK G;  5AWD A;  1LNH A;  1GD4 A;  2XGN A;  4LZI A;  4XDW A;  3HK4 A;  1L5G B;  1C7H A;  1YJN 3;  3NBJ A;  2Z6B A;  5I97 A;  2UZY A;  1UI7 A;  1FGM A;  1TP6 A;  2BMQ B;  2GEY A;  5FTT B;  3ZYJ A;  4HM6 B;  3RGR A;  3SOY A;  1NJI 4;  5HDH A;  1FQV A;  4EZG A;  4R1K A;  1HU9 A;  1IVV A;  2CFG A;  3AMO A;  2YX9 A;  1DVC A;  4H09 A;  1DMM A;  4N6T A;  3S5C A;  1SQ0 B;  3HX8 A;  2E2T A;  1U5O A;  2BHM A;  4HM4 B;  5GMH A;  1M1X B;  3JB9 j;  3GAX A;  1M9S A;  4IT7 A;  1VQP 3;  3S27 A;  3WPF A;  3UN9 A;  1WMO A;  3JUM A;  4RBN A;  5IG0 A;  4FD0 A;  3OWY A;  1IVX A;  3EN1 B;  4FCZ A;  3V99 A;  3E4G A;  1W02 A;  3DGL A;  1K5D C;  4PQ8 A;  1K8A 4;  1AVL A;  1N9E A;  3BNE A;  3KFQ C;  1OHP A;  1KC8 4;  2LYX A;  4NRE A;  3CNM A;  3RIZ A;  3CCR 3;  4OUQ A;  4WFO A;  2UZX A;  1D6Z A;  3HZP A;  3RW6 A;  3X3X A;  3SXX A;  4AY9 X;  3EX9 A;  4WYK A;  1VQ8 3;  3BND A;  3K0Z A;  5KP4 A;  4BSS A;  1RKY A;  1FS2 A;  3J7Y d;  4AKZ A;  4R5C A;  1O6V A;  3ZYI A;  5FGO A;  3CCV 3;  4LGQ A;  1QVF 2;  4ZM8 A;  2CHC A;  5BXQ A;  1K9M 4;  1IV9 A;  4HM0 B;  3ULV A;  3VQ1 A;  3F9S A;  3VSY A;  3GZR A;  4NKH A;  4TZH A;  1LTX A;  3WDG B;  1ISK A;  4V2D A;  7STD A;  3EBT A;  3NV0 A;  1IT7 A;  1FGQ A;  2WGO A;  4HYZ A;  4KVH A;  1D0B A;  4R4K A;  3PCR A;  1O7N B;  1JL5 A;  4FCG A;  1WTH A;  3EN8 A;  3MYT A;  3TSR E;  1DS9 A;  4ARN A;  3OW2 2;  1P9A G;  1VQ4 3;  3G16 A;  1W2Z A;  2M7O A;  2YFL B;  5AIH A;  3WOE B;  3WPG A;  3LZA A;  4N6M A;  3W3K A;  2GU3 A;  2INX A;  2W56 A;  1WNH A;  3GRD A;  4EYC A;  4H3U A;  5KP1 A;  3OXA A;  3FGY A;  3SLU A;  1US1 A;  3FG3 A;  4LI1 A;  5EQL A;  1M1K 4;  2BNG A;  1M90 4;  3N9H A;  4G1M B;  2XFS A;  3LTB A;  3NBR A;  4K1U A;  4XBY A;  3UL5 A;  3NX0 A;  3CPW 2;  2WQV A;  3C6N B;  1O6T A;  4BTW A;  2JE1 A;  1K28 A;  3OJA A;  3WPB A;  3FCS B;  4R07 A;  1AR0 A;  2ELL A;  4RZM A;  1AV4 A;  3D9R A;  4KFF A;  1AVK A;  3O8Y A;  3WOF B;  4LXR A;  4MN8 B;  5A5C A;  3UNL A;  4FMD A;  3HIG A;  1LXE A;  3ER7 A;  3G8Z A;  2XEP A;  2BEX A;  1PFP A;  1N9J A;  4MJD A;  1DFJ I;  3S28 A;  1N8R 4;  4U08 A;  1PGV A;  3CC4 3;  2Z76 A;  2MF7 A;  1UI8 A;  1A2K A;  2UX0 A;  3DZE A;  3X41 A;  4U09 A;  1CYU A;  2OMZ A;  1JN5 B;  2R9U A;  3RGZ A;  3CVR A;  2RFR A;  3WA3 A;  2RA8 A;  2OMW A;  1ZX2 A;  3HI7 A;  2MC8 A;  5CMP A;  4IM6 A;  1WMN A;  3F7S A;  1VQ9 3;  1ROV A;  4J8T A;  3SVA A;  1VQL 3;  2P0X A;  4ECO A;  3N54 B;  4WP5 A;  4FMZ A;  3N8B A;  2C11 A;  3M8C A;  3CPO A;  4IIA A;  3O53 A;  1LVN A;  5IYX C;  2KCD A;  5AI1 A;  4ECN A;  3KN4 A;  3WPD A;  2ID5 A;  2HMM B;  3S67 A;  2FGT A;  3L0R A;  3UB1 A;  2XSO B;  4EBG A;  2Q4G W;  4Z64 C;  3OGK B;  1H6U A;  4M7E A;  2KRT A;  2D42 A;  2Y74 A;  1PU4 A;  1FGT A;  4R6A A;  3JUP A;  4R08 A;  3FKA A;  2SBL A;  3CXC 2;  4Q3I A;  3W3M A;  3CIY A;  2QA4 3;  3CU3 A;  2BNH A;  4CNC A;  1DCE A;  2ML5 A;  3CCU 3;  3WPE A;  3LT9 A;  5CLK A;  5AII A;  4KFD A;  4GT6 A;  2WFH A;  1GYB A;  3KKG A;  2K0M A;  3E2J A;  3CCJ 3;  2XRX B;  2Z7X A;  4OQT A;  3RW7 A;  3ZYN A;  3M18 A;  3WPI A;  3WMD A;  1STF I;  4Q3G A;  2D1W A;  4KT1 A;  4FDW A;  3PMH G;  2XR8 B;  2O6S A;  3MG3 A;  2B1X B;  2HML B;  1A90 A;  1BUQ A;  3CCQ 3;  2ASS B;  5GMF A;  5B0T A;  1IO0 A;  3PGB A;  3REZ A;  2GU1 A;  4FMC A;  5DRV A;  2P0M A;  1ROA A;  3X3Y A;  1GS3 A;  1Q40 B;  4R6F A;  4X2O A;  4R6G A;  4BSR A;  2PZV A;  5GQR K;  3WA2 X;  3BB9 A;  3KZT A;  4O02 B;  1A4Y A;  4IPB A;  5AYR B;  3P72 A;  3SX1 A;  2OQE A;  1YJ9 3;  4R6J A;  3C6P B;  3LYG A;  3E6J A;  4EXR A;  5STD A;  1SII A;  2P38 A;  3KE7 A;  3OV4 A;  3VF1 A;  1OPY A;  2CFK A;  2W03 A;  1W2B 2;  1G9U A;  3SOA A;  4LSO A;  4X2H A;  3G06 A;  1W6Y A;  4K1V A;  1IV7 A;  1FGR A;  5D3I A;  4H61 A;  3QK9 A;  2JDI H;  4STD A;  1DMQ A;  4XBX A;  1P8T A;  1VZZ A;  3X42 A;  1ULJ B;  3JVC A;  3CMA 3;  2OOV C;  5DRE A;  2I9W A;  1M10 B;  3WPC A;  3PZW A;  1ZIW A;  2HMK B;  2KXG A;  2CWU A;  2CKF B;  4R09 A;  1VQN 3;  4HM8 B;  4JF8 A;  1QAF A;  2WQX A;  5GMG A;  3TDG A;  1OZN A;  3NXJ A;  3UL8 A;  4XDV A;  3MG1 A;  3EQQ B;  1A9N A;  2F86 B;  4TX4 A;  1OTO A;  1JB4 A;  3LTC A;  5G2G A;  3CC7 3;  3F8H A;  3G39 A;  1IQY A;  2FT3 A;  3LTA A;  4Y61 B;  2FNQ A;  4EV2 A;  4RCA B;  2IMJ A;  2YFI B;  5CK6 A;  1NB3 I;  3CIG A;  2JQD A;  1VQO 3;  4L8P A;  1OAC A;  1Q86 4;  4BSU A;  4HVN A;  3FG1 A;  3W3J A;  5HZL B;  1W01 A;  4FMA A;  3PXM A;  1S5A A;  1FO1 A;  4FHO A;  4O8S A;  3Q90 A;  2Y73 A;  1CEW I;  2W0Q A;  3B7C A;  3G0K A;  2O6R A;  2XGL A;  3MKI A;  5AEW B;  4XOS A;  3G4S 3;  4N6O B;  1XCD A;  1GY7 A;  2Z64 A;  2HMN B;  3OX9 A;  1STD A;  1M0Z A;  1T5Y A;  3UL7 A;  1V74 A;  5FW5 A;  5IJD A;  3A76 A;  3NHX A;  4EV5 A;  8CHO A;  4PEJ A;  5B0N A;  1IVU A;  2ZDJ A;  4Z61 C;  2CFW A;  2JE0 A;  3D3L A;  4N6L A;  5LC6 A;  3CME 3;  2XH9 A;  2V9S A;  5IEO A;  2ZL8 A;  5ELU A;  1JB2 A;  2RR6 A;  3CD6 3;  2GXF A;  1YGE A;  1UUV B;  3Q2P A;  2BMR B;  3DM8 A;  4HM1 B;  4LSX C;  3KSE D;  3KSP A;  4L8O A;  1JB5 A;  4CCV A;  2F98 A;  4XM4 A;  1SPU A;  3JUN A;  3NBB A;  4HM2 B;  3PYJ A;  1NWW A;  1M9L A;  1OCV A;  4N3V A;  1Z7X W;  5D82 A;  3T8N A;  3X3Z A;  5IW9 A;  5JPP A;  1JKG B;  4RNZ A;  5JPU A;  4FCJ A;  1W7C A;  3STD A;  1W8A A;  1IDP A;  1OF5 B;  2W04 A;  2W6J H;  3FZW A;  3GOZ A;  1EA2 A;  1N5P A;  4KNG A;  3W3L A;  1JRQ A;  2XFT A;  4KZ1 A;  1A67 A;  3V98 A;  3GZY B;  1JN5 A;  3K63 A;  3NM2 A;  2OTJ 3;  6STD A;  3IMA B;  1GWB A;  4K17 A;  3DGM A;  2ML6 A;  4HJL B;  1EQK A;  2W9P A;  4O2H A;  1OUN A;  4C2A B;  3RGX A;  3GZB A;  4PKI G;  4LXS A;  4OVM A;  2CW9 A;  1M9G A;  2IA7 A;  1NU3 A;  3G71 3;  1NDO B;  4R9K A;  3RDE A;  1K73 4;  3GWR A;  4I6J B;  4CP6 A;  2CH9 A;  1J2B A;  1CYV A;  3U97 A;  1N8Q A;  4CC4 C;  4O3V A;  3CC2 3;  4C2B B;  1N5H A;  3I0Y A;  3IJE B;  5EEO A;  3HII A;  2CA6 A;  1RJO A;  5GS2 B;  1KOO A;  1WWL A;  4R80 A;  4LSA A;  4OK0 A;  4P8S A;  3W3G A;  1TFK A;  1YIT 3;  1IQ8 A;  3B8L A;  3CNX A;  1O7H B;  1NO3 A;  2CFL A;  1GD3 A;  3FF2 A;  1ASK A;  3G3B A;  2O6Q A;  1VQ7 3;  4WP6 A;  4YEB B;  1D6Y A;  4JRF A;  1K5G C;  2LQV A;  3RFE A;  3MPH A;  4BV4 R;  3EF8 A;  2IUK A;  2Z82 A;  1R4C A;  1XKU A;  1K41 A;  4BTX A;  1UUW B;  2QEX 3;  4HM5 B;  3UL9 A;  3ULA A;  4HM3 B;  4K61 A;  3JUQ A;  1KWI A;  4HBR A;  1VQK 3;  4MMY B;  3A79 B;  3E3Z A;  1LOX A;  2JQ5 A;  3BZ5 A;  3DXO A;  4GL6 A;  3OGL B;  3FLJ A;  5HGR A;  2L4V A;  2OMT A;  1MNL A;  4RCW A;  3CCE 3;  1OHO A;  1O6S A;  2WQW A;  3ULU A;  2W2C A;  1O7P B;  3F14 A;  3FSD A;  5AWB A;  2BO9 B;  1Q40 A;  5AIG A;  2OWP A;  4ORL A;  3NM7 A;  1JJ2 2;  3F7X A;  2WOF A;  4AEQ A;  1YHQ 3;  5TGN A;  5LC7 A;  3BNB A;  2XWT C;  3BLZ A;  2CIU A;  3EBY A;  5AWA A;  5B4P A;  2A15 A;  2QGU A;  3F40 A;  4GLP A;  1HKX A;  3T8U A;  1OGZ A;  1A2V A;  4LEH A;  3DGN A;  4FCM A;  5AYS C;  1MOL A;  1W5Z A;  4XSQ A;  3ALA A;  2Z65 A;  4LI2 A;  2B24 B;  1F8N A;  4L3A A;  1XEC A;  4XGO A;  4XB5 A;  5BVB A;  2AST B;  1VQ5 3;  1H6T A;  1DVD A;  2CWT A;  3G04 C;  4B8C D;  2V1L A;  2WO0 A;  2K54 A;  3EE1 A;  4FR9 A;  4QBZ A;  3BNC A;  2Z63 A;  4QWT A;  3NQY A;  1RRL A;  4FMB A;  3K5T A;  1SQW A;  5D83 A;  1U8C B;  1VQM 3;  4AKY A;  2V70 A;  3M19 A;  2A0Z A;  4MMZ B;  4MEI A;  4LMI A;  1QMA A;  2E2V A;  1XWD C;  3LXU X;  1RN7 A;  1W4N A;  4U7L A;  2R4I A;  3G6E 3;  4KXF B;  4CIL A;  2E2U A;  3B4P A;  1XEU A;  4LSC A;  3DMC A;  3AMO B;  1Q82 4;  2P1P B;  1EKM A;  4J0M A;  3CCM 3;  2XOT A;  3EC9 A;  1QAK A;  3LTD A;  2RCD A;  4WHA A;  1YIJ 3;  2P1N B;  1Q81 4;  4Z8G A;  2HMO B;  1O7M B;  4U13 A;  3G3A A;  3FF0 A;  4FS7 A;  5AZ5 A;  4XBT A;  2WQU A;  1Z1S A;  1KOH A;  4MQW X;  4AW4 A;  4EC6 A;  4I4K A;  4Z79 A;  1GY5 A;  3EB8 A;  4UFR A;  4J4L A;  1OTM A;  3LH4 A;  4V2C A;  1G96 A;  1O7W B;  4HKV B;  3KII A;  2XF3 A;  3DZL A;  2OCT A;  2FXT A;  3DGO A;  1VQ6 3;  2OMU A;  4R0A A;  2XSH B;  1Y4K A;  3LOY A;  4R9L A;  2OMX A;  2GEX A;  1ZO2 A;  3K7C A;  1FUW A;  4QC0 A;  5GS0 A;  1IT8 A;  1YVB I;  5IG4 A;  2OOV A;  2WGQ A;  1QVG 2;  4NKG A;  3SED A;  5AWC A;  3S29 A;  1E3R A;  4V2E A;  4WYK B;  3U1W A;  3VQ2 A;  2CG0 A;  1KD1 4;  5IEN A;  3RGA A;  2OMY A;  4Q53 A;  3LT8 A;  1TUH A;  5IJC A;  3FXI A;  2Z66 A;  1DMN A;  3MWZ A;  3Q1C A;  4K90 B;  1Q7Y 4;  2GBW B;  3MSO A;  3NQZ A;  1IQX A;  1GY6 A;  5AEU B;  4PER A;  5LFN A;  2Y5Q A;  1FT8 A;  3F8X A;  1QAL A;  5IG3 A;  1TIJ A;  3GZX B;  1IK3 A;  3I55 3;  1P8V A;  3SB4 A;  4HQ1 A;  3IPT A;  5CMN A;  2BT3 A;  3NV0 B;  1D6U A;  5IER A;  1JKG A;  2CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...