4WYKA

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
344
Chain Sequence
b'ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear RNA export factor 1
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 87
structure length 344
sequence length 347
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4wykA01
1M9LA 3FXIA 4MJDA 1ZIWA 5JPPA 5AWDA 5HZLB 1FS2A 3EF8A 2WQVA 5KP4A 2FT3A 5A5CA 3ROBA 2GBXB 1OCVA 1NDOB 3FF2A 2OMUA 1DS9A 3NHXA 1IO0A 1W00A 1UUWB 2XR8B 5AIHA 4KNGA 5HDHA 4EZGA 1ISKA 4Z61C 3OXAA 2JE0A 3G8ZA 2P1NB 4HM1B 4R09A 1O7GB 4LSXC 1OF5A 1P9AG 1K5DC 2Z76A 2O6QA 3RJ0A 3ECFA 2UZXA 3WMDA 5B0NA 4Z64C 4Z8GA 3UNLA 3KJ4A 4FS7A 2CKFB 3CIYA 2Z7XA 3UN9A 2P1PB 2GXFA 2V70A 4R9LA 1H6UA 1GYBA 3MHEA 3FGYA 2Q4GW 3F14A 4Q3GA 5G2GA 4Q53A 4L3AA 2YFJB 4RCWA 4ARRA 3W3GA 3RGRA 1XCDA 4QBZA 3G39A 4GLPA 1XECA 3RIZA 3ULUA 4BSRA 2XRXB 3RGXA 5BXQA 1OGQA 3LYGA 4XB5A 4QC0A 4U09A 3GZBA 3GZYB 4LSAA 3LZAA 5GS2B 4CP6A 5D3IA 2ELLA 1O6VA 1EG9B 4UFRA 2BMQB 5IF6A 3ZYOA 5GQRK 3KE7A 1NWWA 1EA2A 2BNGA 1OH0A 5AIIA 3FF0A 3EBYA 2CA6A 1ZO2A 3SOAA 4Q62A 1P8VA 3MG2A 2JQ5A 5AI1A 3REZA 1JKGA 2V9TB 3WPCA 1E3RA 3C6NB 4P8SA 2OMVA 2HMJB 1Z7XW 2BMRB 4L7KA 4FCJA 3G3AA 1ULJB 3CPOA 4K1VA 1WWLA 3RFEA 4ECNA 4GB5A 1M10B 1O7NB 4BV4R 4OVMA 2P1OB 3IPTA 1O7MB 4NKGA 4FMZA 4TZHA 5IJDA 3ULAA 1CQSA 3F9SA 2A0ZA 4NKHA 3NV0A 3ZYIA 3OWUA 5IEPA 3RFJA 5CMPA 1A2KA 4HQ1A 4RZMA 1SJWA 1OGXA 3C6OB 1QMAA 4AY9X 3G04C 2W2CA 2UX0A 4PERA 3DZEA 5EVHA 3RGAA 4HZBB 3E2JA 3NUVA 5IEOA 1Q40B 4HM0B 2QIYA 3VSYA 4K17A 4WWUC 1GS3A 3GZXB 4IM6A 3F7SA 2Z81A 5FW5A 2OMTA 4CNMA 4R9KA 3I0YA 4HM5B 4XDWA 1BUQA 4BSUA 3WPDA 1QYYA 2ID5A 3G16A 5HGRA 3HK4A 1VZZA 4X2OA 5GMGA 3WPIA 1XKUA 3GWRA 4PKIG 1JB4A 3DZLA 2ASTB 1OPYA 2HMMB 2RFRA 3CIGA 4RCAB 3UL7A 3NXJA 2GEXA 4WYKA 5AZ5A 3O53A 2JE1A 4LMIA 2BNHA 2V9SA 2HMNB 1JB5A 3F8HA 1IDPA 5STDA 1NU3A 4FDWA 4MN8B 5FTTB 2GBWB 2IFGA 2I9WA 2Y5QA 3NM2A 4U7LA 4FCMA 4J9AA 4U08A 4LI1A 4R6FA 4L3FA 5CMNA 5IG5A 3FLJA 3MSOA 1A9NA 4R1KA 1JB2A 4U06A 1TUHA 4H3UA 4R6JA 4I4KA 4ECOA 1XEUA 5LFNA 1S5AA 5AWAA 4PEJA 4CC4A 4OQTA 4J0MA 4XGOA 3WPGA 2OMXA 3G0KA 5TGNA 4KXFB 2WQXA 4H09A 3A76A 3ZYJA 4Z79A 4CILA 3DM8A 4HM8B 3GOZA 3ULVA 3EN1B 1K5GC 5KP1A 3SEDA 4YEBB 1WQLB 2IMJA 1UUVB 2Z62A 1OTMA 2B1XB 4XSQA 2OMZA 1FQVA 2WFHA 4R5CA 5DRVA 2Z64A 3RGZA 4PQ8A 3K7CA 4R07A 5IG4A 1DMNA 1OTNA 3SB4A 4P91A 1M0ZA 4L8OA 3W3LA 5IG0A 2XWTC 3MG1A 2Z63A 3WPEA 2XSOB 5D82A 4J8TA 3S5CA 4LXRA 3EX9A 3OX9A 3RW7A 3BZ5A 3FZWA 4M7EA 4LEHA 1Q42A 4R08A 3O6NA 3GRDA 4WP6A 1W02A 1JN5B 3RFSA 4STDA 5IENA 3BLZA 1E3VA 2K54A 3WPFA 4MQWX 4FHOA 3OV4A 1XWDC 5CF1A 5D83A 3B8LA 4WP5A 2STDA 2O6RA 2P1MB 5IERA 3F40A 4FD0A 5AWBA 4ARNA 4R5DA 1GY7A 4C2AB 1W01A 4PSJA 4LSXA 3OJAB 4HM2B 5GMHA 3WPHA 2OWPA 4U13A 1DCEA 2OMWA 3CNXA 1OZNA 4CC4C 3T8UA 2UZYA 3JUMA 1OUNA 1DMQA 3C6PB 4HM4B 1FT8A 1AR0A 1O7HB 3VGNA 2XOTA 2RA8A 4AW4A 1JL5A 3G3BA 3JB9j 3CU3A 1GWBA 3E6JA 1A4YA 5IG3A 3UJMA 2BMOB 3GZRA 3EJVA 6STDA 5B4PA 3EHCA 3G06A 3TSRE 1KOOA 4V2CA 4XBXA 5CXOA 3W3NA 4OUQA 1GY6A 3M8CA 3KZTA 4N3VA 5JPUA 3CVRA 1ASKA 4M7EC 1OF5B 2RCDA 2HMLB 5D81A 3HX8A 4G8AA 3B7CA 1PGVA 3HZPA 3OWYA 3OGLB 4B8CD 3KSPA 2Z66A 2WQWA 1TP6A 3P72A 3W3JA 4XBTA 5AEWB 2Z7XB 4HKVB 4LI2A 3MG3A 4FCGA 3DXOA 5GS0A 1M9SA 1HKXA 4K1UA 1DFJI 3B4OA 1K41A 5AIFA 4L8PA 5BVBA 1P8TA 3SOYA 4X2HA 2R4IA 2R9UA 5DREA 5CLKA 3JUNA 3CNMA 3JUOA 1ULIB 2RR6A 3A79B 4KT1A 4Y61B 3D9RA 4CDLA 2F98A 1OHPA 4HM3B 4J4LA 3JUQA 3W3KA 3E99A 3PMHG 1O7PB 3WPBA 2Z82A 2RGQA 2HMKB 3EBTA 3EN8A 4XDVA 4HVNA 3H3HA 3OWSA 3KKGA 8CHOA 2YFIB 3M18A 3NBRA 3B4PA 1D0BA 2Z65A 5B0TA 3UL8A 1OHSA 3FKAA 1DMMA 3T8NA 5IJCA 3FSDA 3E3ZA 3FH1A 1W6YA 3H51A 1JKGB 1O6SA 1O7WB 1W8AA 4Q3IA 4V2DA 3DMCA 3EQQB 1O6TA 5IYXC 2F99A 4V2EA 1Z1SA 4R58A 1STDA 2F86B 1FO1A 5AIGA 1ZX2A 3WN4A 1SQ0B 1OTOA 3DUKA 4HM7B 3M19A 2O6SA 2WQUA 1H6TA 2Z77A 3UL9A 2ASSB 5AWCA 5KP3A 3OGKB 2B24B 2OMYA 2GEYA 3BB9A 4LSCA 4RWTC 3VQ1A 4IIAA 1YRGA 1OGZA 3NV0B 1KOHA 3E4GA 2BEXA 3VQ2A 3ZYNA 1U0ND 3RW6A 4LGQA 4KVHA 4HM6B 3OGMB 4R6AA 3K0ZA 3MYTA 2XSHB 3Q90A 5AEUB 1QJGA 2INXA 5CK6A 3EC9A 1JN5A 4GT6A 3F8XA 2PZVA 2HMOB 2CHCA 4XOSA 4XM4A 2Z7AA 7STDA 3MKIA 4LXSA 3JUPA 5GMFA 1GY5A 1C7HA 2QGUA 4PEQB 3W3MA 4BSSA 1OHOA 5CF2A 2YFLB 2A15A 4I6JB 5IJBA 4Z94G 1LTXA 3OJAA 3STDA 3F7XA 1E97A 4QXEA 1U5OA 4ORLA 3ER7A 4R0AA 4HZ9B 4XBYA 1G9UA 1Q40A 4CNCA 4WYKB 2P1QB 4C2BB 4R6GA 1OOKG 4HJLB 2JQDA
chains in the Genus database with same CATH superfamily
3CCE3 1M9LA 5AWDA 1F8NA 5HZLB 3AMOB 5KP4A 2WQVA 2E2TA 2GBXB 4KFDA 2IY2A 2O3OA 1DS9A 1W00A 2F5WA 2ZHXB 1FGQA 3X3XA 4EZGA 3OXAA 2JE0A 2P1NB 1OF5A 1RGEA 1K5DC 1RHLA 2Z76A 3RJ0A 3DGOA 3WMDA 4N6NB 4Z64C 4JF8A 2W6JH 2P1PB 2GXFA 2W56A 3FGYA 1I3FA 4L3AA 1KD14 4ARRA 1TU5A 3CCM3 4MMYB 3G39A 1DVCA 3RIZA 4RNYA 3LYGA 2CFGA 4BL3A 1X1XA 1RN1A 3HIGA 3LZAA 3AHSA 1OH0A 1QALA 3FF0A 3EBYA 2CA6A 1P8VA 3IMAB 3REZA 1GOUA 1E3RA 1U8CB 3C6NB 4P8SA 1Z7XW 2BMRB 5BU4A 2P38A 3G3AA 1ULJB 2SARA 3CPOA 4K1VA 3RFEA 1I2FA 4BV4R 1RGKA 1TJDA 4TZHA 2L4VA 4EXRA 3ULAA 4FCZA 1CQSA 3NM7A 4NKHA 4O02B 1RGHA 8RNTA 3RFJA 1VQ93 1PYLA 3LTAA 2KCDA 2XH9A 1QMAA 4AY9X 3G6E3 1TRPA 1BNIA 2W2CA 5EVHA 3I563 1L5GB 1ZGXA 5IEOA 1BSAA 3UL6A 2XFTA 4IM6A 3F7SA 2L1SA 4R9KA 3I0YA 3EB8A 3MWZA 3PGBA 3ZG0A 2OTJ3 3HK4A 3WPIA 1XKUA 4PKIG 1JB4A 1BRSA 2RFRA 3NXJA 2GEXA 5AZ5A 3BNDA 1JB5A 2H0IA 1IDPA 5FTTB 1TIJA 2IUKA 5CMNA 5IG5A 4R1KA 4U06A 1UCJA 4R6JA 1XEUA 1I2GA 2OTL3 1I2EA 5AWAA 4J0MA 1N5PA 4XGOA 2UUGC 2OMXA 3G0KA 1TFOA 2WQXA 3A76A 1JBTA 3DM8A 4HM8B 1FGOA 3ULVA 3EN1B 2C10A 2OMZA 4BTWA 2WFHA 4R5CA 2Z64A 3RGZA 3K7CA 4N6TA 1OTNA 3A5EA 1W2ZA 1V74A 2XWTC 3KFQC 3MG1A 3KN4A 4J8TA 1TTOA 3BZ5A 4M7EA 3O6NA 1CH0A 3GRDA 1BOXA 1M9GA 1E3VA 2IA7A 5JBSA 3WPFA 1VQK3 2WOHA 1XWDC 4WP5A 4ZM8A 4C2AB 1W01A 3CXC2 3PCRA 2Q07A 2OWPA 3T8UA 3DH2A 1FT8A 1O7HB 1LOVA 3BNEA 4EW5A 4AW4A 3G3BA 1IT8A 4I5QA 3G06A 1BRGA 1EKMA 1VQQA 1GY6A 1GD4A 1OF5B 3WDGB 7RNTA 1R4CA 3HZPA 4B8CD 2WQWA 4BU4A 4FCGA 4MMXB 3LTBA 2W56B 1D6YA 1P8TA 2R4IA 2R9UA 3ZFZA 3A79B 3V99A 4CDLA 1OHPA 3JUQA 2JDIH 2Z82A 2HMKB 1RGLA 3EN8A 4XDVA 1UCKA 3KKGA 1PFPA 5A0OB 1UCIA 3UL8A 2KF4A 1OHSA 1W6YA 1O6SA 5GSPA 4Q3IA 3EQQB 4CJNA 2GU3A 4R58A 3G4S3 5AIGA 3LTDA 1SQ0B 3DUKA 4N6UA 1JBSA 3UL9A 2ASSB 5KP3A 1AVLA 3OGKB 1BAOA 1KOHA 2CWVA 4LGQA 1Q824 4R6AA 5HOHA 3Q90A 2P0XA 1QJGA 5CK6A 2AAEA 4GT6A 3F8XA 2PZVA 4CPKA 4XOSA 7STDA 2WGOA 1GY5A 3W3MA 5ELUA 1OHOA 1LTXA 1LVNA 3SYUA 1E97A 1RLSA 4ORLA 4HZ9B 2JQDA 3Q2PA 1X1WA 4MJDA 1ZIWA 5JPPA 1FS2A 2FT3A 3ROBA 2Z6BA 4BTYA 1LXEA 1VQP3 1BRJA 1B2SA 4EBGA 1OCVA 2H0GA 3HOHA 3UL5A 3CME3 1UUWB 3CPW2 5HDHA 2QA43 1Y4KA 1O7GB 4LSXC 2YX9A 2WGQA 1P9AG 3ECFA 2UZXA 2D42A 2KF5A 1N8QA 1ROAA 2ZA4A 3F14A 5AYSC 4Q53A 2F4YA 1K8A4 1UGIA 2YFJB 3W3GA 1XCDA 4QBZA 1XECA 2CG0A 3CMA3 2OQEC 4N6MA 5BXQA 1OGQA 4QC0A 2KAAA 3GAXA 5GS2B 1WTHA 1BRHA 2BMQB 3ZYOA 3DGLA 3KE7A 1EA2A 2BNGA 3CCJ3 2UGIA 1ZO2A 3SOAA 1NO3A 3LH4A 3RDEA 5G1KA 4FCJA 1UGHI 1IVWA 1YI23 4GB5A 1VQ43 1M10B 3G713 1O7NB 1JZOA 1RSNA 1IV7A 3SVAA 2A0ZA 3V92A 3OWUA 5IEPA 1SJWA 3NX0A 5G1LA 2UX0A 3DZEA 3CCU3 3E2JA 1N9JA 4EV5A 2QEX3 4HM0B 2KXGA 2P05A 3WHOA 2Z81A 5FW5A 4XDWA 1BUQA 4BSUA 1QYYA 1VZZA 4X2OA 2CWUA 2LYXA 3GWRA 5FGOA 1OPYA 1US1A 2HMMB 4RCAB 3UL7A 3O53A 4AEQA 2BNHA 4GHOA 2HMNB 3DGMA 1NU3A 4MN8B 1M1K4 2IFGA 1YIT3 1BSBA 3FG1A 4U7LA 4FCMA 2RSXA 1LQMB 1GMRA 1JZDA 2WOFA 2BIRA 1B21A 1TUHA 2HOHA 4H3UA 1QVG2 4ECOA 4TX4A 3AHWA 3S67A 3WPGA 4KXFB 4H09A 3ZYJA 4Z79A 5KP1A 1WQLB 1MNLA 1GOVA 1OTMA 1FGTA 3SB4A 1DMNA 1CYVA 5BIRA 1M0ZA 2Z63A 1RRLA 2XSOB 3S5CA 3OX9A 1YJW3 3FZWA 4R08A 4FMAA 4WP6A 4STDA 4NPBA 1VQN3 1MGWA 1SIIA 4FHOA 3DGYA 5CF1A 3B8LA 4FD0A 2OOVC 3NQYA 3LMLA 4PSJA 1RNTA 3NQZA 3CCQ3 4CCVA 4U13A 1DCEA 2OMWA 3WA3A 2Y73A 3CNXA 4K61A 1OZNA 3L0RA 4LYLB 2UZYA 3CCL3 3JUMA 3C6PB 4NZTM 3BNBA 3VGNA 2KF6A 2XOTA 3N54B 2RA8A 1JL5A 2SBLA 1TFKA 3S28A 3E6JA 3RNTA 2CFDA 3UJMA 6STDA 1LOXA 3TSRE 5EEOA 4XBXA 5CXOA 4BTXA 1STFI 5M18A 3J7Yd 4M7EC 2RCDA 1PGVA 1QAKA 3OGLB 2ZDJA 2Z66A 2BHMA 3K9MC 3P72A 4XBTA 3WODG 5AEWB 3DXOA 4K1UA 1DFJI 2D1WA 5AIFA 5BVBA 1VQ73 3CCS3 3JUNA 3CNMA 3JUOA 4KT1A 4Y61B 4RNTA 4EYCA 2F98A 4HM3B 3W3KA 3S29A 1FA3A 2RGQA 4HVNA 3OWSA 2YFIB 3NBBA 1FW7A 4WHAA 5B0TA 3HI7A 2P09A 3CD63 1RMSA 5M1AA 4FR9A 3CC23 2F86B 3M19A 2Z77A 5AWCA 1DVDA 1VQ53 4LSCA 4RWTC 4IIAA 1OGZA 3FG4A 4KZ1A 2FNQA 1YJ93 1BNSA 1T2IA 3PXMA 1MOLA 2E2UA 1D6UA 3K5TA 1JN5A 4XM4A 1A90A 3MKIA 5GMFA 1B3SA 3OW22 1UUGB 2QGUA 1IVVA 3LT9A 2YFLB 1BSEA 2A15A 4I6JB 5IJBA 1BANA 3F7XA 4HYZA 2CW9A 1U5OA 2CFKA 4R0AA 4XBYA 1CEWI 1G9UA 1D6ZA 2P1QB 1YIJ3 1SIHA 1OOKG 4UFRA 3FXIA 3EF8A 3URPA 1YJN3 4AKYA 1NDOB 3FF2A 3X42A 3NHXA 1IO0A 1HZ1A 2XR8B 5AIHA 4KNGA 4R80A 3X41A 1RCLA 4HM1B 4R09A 1FGMA 2CX0A 1UCLA 1BVIA 6RNTA 1I0VA 1RGGA 3KJ4A 4FS7A 2CKFB 3CIYA 2Z7XA 3UN9A 2XEPA 1Q864 2CWTA 4EV2A 1WMOA 1I70A 3MHEA 2Q4GW 4RCWA 3RGRA 1RJOA 2LQVA 4GLPA 2M7OA 2XRXB 1W6CA 1RGCA 4XB5A 4KT3B 4U09A 3GZBA 3GZYB 3D5IA 1IYYA 1BU4A 1LNHA 2ELLA 4RNZA 4H61A 4N6LA 1ZS7A 1NWWA 4LSOA 3SXXA 5AIIA 3FG3A 4Q62A 3MG2A 2JQ5A 1JKGA 2OMVA 2HMJB 1GD3A 3HIIA 3CCR3 2P1OB 4AKZA 3IPTA 4NKGA 4FMZA 3DY5A 2ML6A 3D5GA 3ZYIA 3NV0A 4RZMA 3C6OB 1NJI4 4PERA 1IVXA 1MGRA 4HZBB 3NUVA 1RNBA 1SPUA 2QIYA 1KSIA 1YGWA 4K17A 1GS3A 3GZXB 1JJ22 4CNMA 3PZWA 4HM5B 1BRNL 3WPDA 5HGRA 3CCV3 5GMGA 1PY3A 4BL2A 3DZLA 3CIGA 1N8R4 4WYKA 1LOWA 4LMIA 2V9SA 1HU9A 3MPHA 3LXUX 4HBRA 4FDWA 2GBWB 2I9WA 4LI1A 1T3BA 4N6V0 4L3FA 4RBNA 3FLJA 1A9NA 3FCSB 4I4KA 1OACA 1S5AA 4O2HA 4PEJA 4CC4A 1C54A 1G96A 1NB5I 2Z62A 2B1XB 4XSQA 3IJEB 1FQVA 1RDSA 3K63A 5DRVA 1HYFA 4PQ8A 3PCSA 4R07A 4P91A 4BIRA 5IG0A 2OCTA 4LXRA 3RW7A 1GMPA 1IQ8A 3ALAA 4LEHA 1BNFA 1W02A 1JN5B 1VQO3 5M19A 3RFSA 3BLZA 2K54A 3DGNA 4IPBA 4MQWX 4O8SA 3OV4A 1IV9A 1AV4A 1EUIC 2O6RA 2P1MB 2GU1A 5AWBA 1A2VA 4ARNA 3U97A 1AQZA 1GY7A 4LSXA 4HM2B 2RNTA 2V1LA 3EE1A 2GSPA 1DMQA 3S27A 1BRKA 1IT7A 1K734 4OK0A 1A4YA 5IG3A 3LT8A 2BMOB 3GZRA 3EJVA 3U1WA 5B4PA 1BNJA 3LTCA 1BRIA 2BU4A 1KOOA 1RKYA 4V2CA 3W3NA 1JBRA 2F5MA 1ASKA 3B7CA 3KSPA 1RTUA 4LZIA 5EQLA 1T5YA 1I3IA 1RGFA 1YGEA 1DYUA 2Z7XB 4HOHA 2AADA 1QAFA 4HKVB 1JRQA 1M9SA 1HKXA 3WOEB 4NREA 3X3YA 1K41A 1NB3I 4L8PA 3SOYA 2FGTA 2W0QA 1LNIA 5CLKA 1N9EA 3D9RA 1SARA 1A67A 3X40A 4J4LA 3E99A 3PMHG 1O7PB 3N9HA 1GOYA 2F56A 8CHOA 3NBRA 5AYRB 1KWIA 1BSDA 2Z65A 2P0MA 1DMMA 3E3ZA 1JKGB 2XGNA 2C4BA 1O7WB 4V2DA 2E2VA 2F99A 4JRFA 1UW1A 1Z1SA 1FO1A 1ZX2A 4WFOA 2W9QA 2O6SA 2WQUA 1H6TA 2B24B 4MMZB 2GEYA 3NV0B 3E4GA 2BEXA 3VQ2A 4NZRM 1MWRA 2W9PA 3N8BA 4HM6B 1X1UA 1W7CA 3V98A 1IQYA 2XF3A 2INXA 3EC9A 4G1MB 1T2HA 2MC8A 2HMOB 4KFFA 4LXSA 1PU4A 1QVF2 1M1XB 1NNVA 2K3DA 1IK3A 4PEQB 4BSSA 1ROVA 5CF2A 4Z94G 4EC6A 3OJAA 3ER7A 3Q1CA 1G0TA 4WYKB 4R6GA 1KC84 1RCKA 1BGSA 4J5KA 1J2BA 5A5CA 1K28A 1Q7HA 2OMUA 1YVBI 1FYSA 4KFEA 4DKIA 1W2B2 1ISKA 4Z61C 3G8ZA 2O6QA 4N6OB 5B0NA 1UI7A 4Z8GA 3UNLA 1Q814 1MWSA 2V70A 4R9LA 1H6UA 1GYBA 2OOVA 1TRQA 3WOFB 2ZL8A 1S723 5G2GA 4Q3GA 3CC43 1IVUA 3JVCA 3ULUA 4BSRA 2IUJA 3RGXA 4LSAA 1IU7A 1R4YA 1BSCA 4CP6A 5D3IA 2KF3A 1FUTA 3KSED 1EG9B 3ZG5A 1O6VA 5IF6A 3PS8A 3GSPA 5GQRK 3SLUA 5ELJA 1A2PA 5AI1A 2W03A 2V9TB 3WPCA 4L7KA 1WWLA 4ECNA 4J5GA 6GSPA 2W04A 4OVMA 1VQL3 1O7MB 1AY7A 3AGNA 4R4KA 1VQM3 2WO0A 5IJDA 1VQ83 3F9SA 2BO9B 5CMPA 4FMCA 1A2KA 4QWTA 3WA2X 1JV2B 4HQ1A 1OGXA 3G04C 1BIRA 3BU4A 1DETA 3RGAA 2KRTA 2CG1A 1Q40B 2K0MA 3VSYA 1CYUA 5IW9A 4WWUC 1FUSA 2OMTA 4GL6A 1YVSA 3KCHA 3PYJA 2ID5A 3G16A 5I97A 3D3LA 1JNQA 1W4NA 2ASTB 3O8YA 4HAAA 2JE1A 2H0HA 1B2MA 3D4AA 2CX1A 3AMOA 3F8HA 5STDA 1Q7Y4 2Y5QA 3NM2A 1X1YA 4FMBA 4J9AA 4U08A 1B27A 3TDGA 4R6FA 3QRDA 4FMDA 3VF1A 3MSOA 1JB2A 5LFNA 4OQTA 2IYJA 1Q9EA 2CH9A 5TGNA 3WR2A 1B2ZA 4CILA 1GSPA 3GOZA 3X3ZA 1K5GC 4YEBB 3SEDA 2IMJA 1UUVB 2O9UX 2FXTA 2CIUA 1V58A 5IG4A 4K90B 1UDII 4L8OA 3W3LA 9RNTA 1BNRA 3WPEA 1SQWA 1W5ZA 5D82A 1FUWA 2MF7A 3EX9A 2CC3A 1LQGC 1Q42A 1MWTA 3AGOA 5IENA 5D83A 1YHQ3 1M904 1KQS2 2STDA 5IERA 3F40A 1W6GA 1LRAA 4R5DA 1FGRA 3OJAB 5GMHA 3WPHA 4CC4C 3T0UA 1OUNA 5LC6A 1IQXA 3NBJA 2CK3H 4HM4B 1AR0A 3JB9j 3CU3A 3I553 1GWBA 4IT7A 2PNCA 3EHCA 3UB1A 4OUQA 1VQ63 3M8CA 3KZTA 2BT3A 1BUJA 4N3VA 5JPUA 3CVRA 2HMLB 5D81A 3HX8A 4G8AA 1FZUA 3OWYA 1YNVX 4NHFA 1B2UA 1WMNA 4GSPA 1TP6A 1EQKA 3W3JA 4LI2A 3MG3A 5GS0A 4ILFA 1I8VA 1V57A 3B4OA 2CFWA 3LOYA 2C11A 4X2HA 5LC7A 1K9M4 2CFLA 5DREA 1ULIB 2RR6A 1WMPA 1BNGA 1B20A 3WPBA 1AVKA 3EBTA 3QK9A 3H3HA 3M18A 3B4PA 3D79A 1D0BA 3CC73 4O3VA 3FKAA 3T8NA 5IJCA 3FSDA 1DE3A 3FH1A 3H51A 1W8AA 1N5HA 3DMCA 1O6TA 5IYXC 4V2EA 2Y74A 1STDA 3WN4A 1OTOA 4HM7B 1G02A 2R41A 2ML5A 1GMQA 1EEJA 1LOYA 1RRHA 2RBIA 2OMYA 3BB9A 3VQ1A 1YRGA 3RW6A 3ZYNA 1U0ND 1RN7A 3BIRA 4KVHA 3OGMB 3K0ZA 3MYTA 2XSHB 1WNHA 5AEUB 1BNEA 3SX1A 2J8XB 4MEIA 2CHCA 2Z7AA 3JUPA 1C7HA 1UI8A 1MWUA 1RN4A 1I0XA 3BNCA 2XGLA 1RGAA 1B2XA 5RNTA 3STDA 4QXEA 7GSPA 2XFSA 4C2BB 2OQEA 3Q3FA 1Q40A 4CNCA 3KIIA 4HJLB
chains in the Genus database with same CATH topology
3CCE3 3Q2PA 1M9LA 3FXIA 4MJDA 1ZIWA 5JPPA 5AWDA 1F8NA 1FS2A 3EF8A 5HZLB 3AMOB 5KP4A 1J2BA 2FT3A 2WQVA 5A5CA 3ROBA 2Z6BA 4BTYA 1LXEA 1K28A 1VQP3 2E2TA 1YJN3 4AKYA 2GBXB 4EBGA 4KFDA 1OCVA 1NDOB 3FF2A 2O3OA 2OMUA 3X42A 1DS9A 1YVBI 3UL5A 3NHXA 1IO0A 1W00A 3CME3 1UUWB 2XR8B 5AIHA 4R80A 3CPW2 4KNGA 4KFEA 5HDHA 1FGQA 3X3XA 3X41A 4EZGA 1W2B2 1ISKA 2QA43 4Z61C 1Y4KA 3OXAA 2JE0A 3G8ZA 2P1NB 4HM1B 4R09A 1FGMA 1O7GB 4LSXC 2YX9A 2WGQA 1OF5A 1P9AG 1K5DC 2Z76A 2O6QA 3RJ0A 3DGOA 3ECFA 2UZXA 3WMDA 4N6NB 2D42A 4N6OB 5B0NA 4Z64C 1UI7A 4Z8GA 3UNLA 3KJ4A 4FS7A 2CKFB 3CIYA 1N8QA 4JF8A 2Z7XA 2W6JH 1ROAA 3UN9A 2P1PB 2XEPA 1Q814 2GXFA 2W56A 2V70A 4R9LA 2CWTA 4EV2A 1Q864 3KIIA 1WMOA 1H6UA 1GYBA 2OOVA 3MHEA 3FGYA 2Q4GW 3WOFB 3F14A 2ZL8A 5AYSC 5G2GA 4Q53A 1S723 3CC43 4L3AA 4Q3GA 1K8A4 2YFJB 1KD14 4RCWA 4ARRA 3W3GA 3RGRA 1RJOA 1XCDA 1IVUA 1TU5A 3CCM3 4MMYB 2LQVA 3JVCA 3G39A 4GLPA 4QBZA 1DVCA 1XECA 3RIZA 3ULUA 2CG0A 4BSRA 2IUJA 3CMA3 2OQEC 2M7OA 2XRXB 4N6MA 3RGXA 4RNYA 1W6CA 5BXQA 1OGQA 3LYGA 2CFGA 4XB5A 4QC0A 4U09A 3GZBA 3GZYB 4LSAA 3HIGA 1IU7A 3GAXA 3LZAA 5GS2B 4CP6A 5D3IA 1LNHA 1WTHA 2ELLA 4RNZA 3KSED 1EG9B 1O6VA 4UFRA 4H61A 2BMQB 5IF6A 3ZYOA 3PS8A 5GQRK 4N6LA 3DGLA 3SLUA 3KE7A 5ELJA 1NWWA 1EA2A 2BNGA 4LSOA 3SXXA 1OH0A 1QALA 5AIIA 3CCJ3 3FF0A 3EBYA 2CA6A 1ZO2A 3FG3A 3SOAA 1NO3A 1P8VA 4Q62A 3MG2A 2JQ5A 3IMAB 5AI1A 3REZA 1JKGA 2W03A 1U8CB 1E3RA 3LH4A 3RDEA 2V9TB 3C6NB 2OMVA 4P8SA 3WPCA 2HMJB 1Z7XW 2BMRB 4L7KA 2P38A 4FCJA 3G3AA 1ULJB 1IVWA 3CPOA 4K1VA 1WWLA 3RFEA 4ECNA 1GD3A 3HIIA 1YI23 4GB5A 1VQ43 2W04A 1M10B 3G713 1O7NB 4BV4R 3CCR3 4OVMA 4AKZA 2P1OB 1VQL3 3IPTA 1O7MB 4NKGA 4R4KA 4FMZA 3DY5A 4TZHA 1IV7A 2WO0A 2L4VA 2ML6A 4EXRA 1VQM3 1VQ83 5IJDA 3ULAA 4FCZA 1CQSA 3NM7A 3F9SA 3SVAA 2A0ZA 3V92A 2BO9B 4NKHA 3NV0A 4O02B 3OWUA 3ZYIA 5IEPA 3RFJA 5CMPA 4FMCA 1A2KA 4QWTA 4RZMA 1JV2B 3WA2X 1VQ93 4HQ1A 1SJWA 1OGXA 3LTAA 3NX0A 1NJI4 2KCDA 2XH9A 1QMAA 3C6OB 4AY9X 3G6E3 3G04C 2W2CA 2UX0A 4PERA 3DZEA 5EVHA 3I563 3CCU3 1L5GB 3RGAA 1IVXA 4HZBB 3E2JA 3NUVA 2KRTA 1N9JA 2CG1A 5IEOA 4EV5A 2QEX3 1Q40B 2K0MA 3UL6A 1SPUA 2QIYA 2XFTA 1KSIA 2KXGA 4HM0B 3VSYA 1CYUA 5IW9A 2P05A 4K17A 4WWUC 1GS3A 3GZXB 4IM6A 1JJ22 3F7SA 2Z81A 5FW5A 2OMTA 4CNMA 3PZWA 4R9KA 3I0YA 4GL6A 3EB8A 3MWZA 4HM5B 3PGBA 4XDWA 3PYJA 2OTJ3 1BUQA 4BSUA 3WPDA 1QYYA 2ID5A 3G16A 5HGRA 3HK4A 1VZZA 4X2OA 5I97A 2CWUA 2LYXA 3D3LA 3CCV3 3WPIA 5GMGA 1JNQA 1W4NA 1XKUA 3GWRA 4PKIG 5FGOA 1JB4A 3DZLA 2ASTB 1OPYA 1US1A 2HMMB 2RFRA 3CIGA 3O8YA 4RCAB 3UL7A 1N8R4 3NXJA 2GEXA 4WYKA 5AZ5A 3O53A 2JE1A 4LMIA 4AEQA 2BNHA 1HU9A 2V9SA 2HMNB 3BNDA 3MPHA 3LXUX 1JB5A 3DGMA 4HBRA 3AMOA 1IDPA 3F8HA 5STDA 1Q7Y4 1NU3A 4FDWA 4MN8B 5FTTB 2GBWB 1M1K4 2IFGA 2I9WA 1YIT3 2Y5QA 3NM2A 3FG1A 4U7LA 1TIJA 4FCMA 4FMBA 4J9AA 4U08A 2RSXA 4LI1A 3TDGA 2IUKA 4N6V0 3QRDA 4FMDA 4L3FA 4R6FA 3VF1A 5IG5A 5CMNA 2WOFA 4RBNA 3FLJA 3MSOA 1A9NA 4R1KA 1JB2A 4U06A 1TUHA 3FCSB 4H3UA 4R6JA 4I4KA 1QVG2 4ECOA 1XEUA 5LFNA 4TX4A 2OTL3 1OACA 1S5AA 4O2HA 5AWAA 4PEJA 4CC4A 3S67A 4OQTA 4R6GA 4J0MA 1N5PA 4XGOA 3WPGA 2OMXA 3G0KA 2CH9A 5TGNA 1TFOA 4KXFB 1G96A 2WQXA 1NB5I 4H09A 3A76A 3ZYJA 4Z79A 4CILA 3DM8A 4HM8B 1FGOA 3GOZA 3EN1B 3ULVA 3X3ZA 1K5GC 5KP1A 3SEDA 4YEBB 1WQLB 2C10A 1MNLA 1UUVB 2IMJA 2O9UX 1OTMA 2Z62A 2B1XB 4XSQA 2OMZA 1FGTA 4BTWA 3IJEB 2FXTA 1FQVA 2WFHA 4R5CA 3K63A 5DRVA 2Z64A 3RGZA 4PQ8A 2CIUA 3K7CA 3PCSA 4N6TA 4R07A 5IG4A 1DMNA 1OTNA 4K90B 4P91A 1CYVA 1M0ZA 3SB4A 1W2ZA 4L8OA 3W3LA 1V74A 5IG0A 2XWTC 3KFQC 3MG1A 2Z63A 3KN4A 1RRLA 3WPEA 1SQWA 2XSOB 1W5ZA 2OCTA 5D82A 1FUWA 2MF7A 4J8TA 3S5CA 4LXRA 3EX9A 3OX9A 2CC3A 3RW7A 1YJW3 3BZ5A 3FZWA 4M7EA 1IQ8A 3ALAA 4LEHA 1Q42A 4R08A 3O6NA 3GRDA 4FMAA 4WP6A 1W02A 1JN5B 1VQO3 3RFSA 4STDA 5IENA 3BLZA 1VQN3 1M9GA 1E3VA 2K54A 3DGNA 2IA7A 4IPBA 5JBSA 3WPFA 1SIIA 1VQK3 4MQWX 4O8SA 4FHOA 3OV4A 1IV9A 2WOHA 1XWDC 5CF1A 5D83A 1AV4A 3B8LA 4WP5A 1YHQ3 2STDA 1M904 4ZM8A 2GU1A 3F40A 5IERA 1W6GA 1KQS2 2OOVC 2O6RA 2P1MB 4FD0A 5AWBA 1A2VA 4R5DA 4ARNA 3U97A 1GY7A 4C2AB 1W01A 3CXC2 3NQYA 3LMLA 4PSJA 4LSXA 3PCRA 1FGRA 3OJAB 3NQZA 4HM2B 3CCQ3 2Q07A 5GMHA 4CCVA 2OWPA 4U13A 3WPHA 1DCEA 2OMWA 3WA3A 2Y73A 3CNXA 4K61A 1OZNA 4CC4C 3T8UA 3L0RA 2V1LA 2UZYA 3T0UA 3CCL3 3EE1A 1OUNA 1DMQA 3JUMA 5LC6A 3S27A 1IQXA 3NBJA 2CK3H 4HM4B 1FT8A 3BNBA 3C6PB 1IT7A 1K734 1AR0A 1O7HB 4OK0A 3VGNA 3N54B 3BNEA 2XOTA 2RA8A 4AW4A 1JL5A 2SBLA 3G3BA 3JB9j 1TFKA 3CU3A 3S28A 3I553 1GWBA 3E6JA 1A4YA 4IT7A 5IG3A 2CFDA 3UJMA 1IT8A 3LT8A 2BMOB 3RW6A 2PNCA 3EJVA 3GZRA 3U1WA 6STDA 5B4PA 3EHCA 3UB1A 3G06A 3LTCA 1LOXA 3TSRE 5EEOA 1RKYA 1KOOA 4V2CA 4XBXA 5CXOA 3W3NA 1EKMA 4OUQA 1VQ63 1GY6A 3M8CA 3KZTA 4BTXA 2BT3A 4N3VA 5JPUA 1STFI 1GD4A 3J7Yd 3CVRA 1ASKA 4M7EC 1OF5B 2RCDA 2HMLB 5D81A 3WDGB 3HX8A 4G8AA 3B7CA 1PGVA 1QAKA 1R4CA 3HZPA 3OWYA 3OGLB 4B8CD 4NHFA 3KSPA 1WMNA 2ZDJA 2Z66A 4LZIA 5EQLA 1T5YA 2WQWA 2BHMA 1TP6A 3K9MC 1EQKA 1YGEA 3P72A 1DYUA 4XBTA 3WODG 5AEWB 2Z7XB 3W3JA 1QAFA 4HKVB 3MG3A 4LI2A 4FCGA 3DXOA 4MMXB 1JRQA 3LTBA 1M9SA 5GS0A 1HKXA 2W56B 4K1UA 1D6YA 1DFJI 2D1WA 3WOEB 3B4OA 4NREA 3X3YA 1K41A 5AIFA 2CFWA 1NB3I 3LOYA 4L8PA 5BVBA 1P8TA 2C11A 3SOYA 1VQ73 4X2HA 2R4IA 2R9UA 2FGTA 5LC7A 2W0QA 1K9M4 2CFLA 3CCS3 5DREA 5CLKA 3JUNA 1N9EA 3CNMA 1ULIB 3JUOA 2RR6A 3V99A 3A79B 3D9RA 4KT1A 4EYCA 4Y61B 1A67A 4CDLA 2F98A 3X40A 1OHPA 1WMPA 4HM3B 3JUQA 4J4LA 3W3KA 3S29A 1FA3A 3E99A 3PMHG 1O7PB 3N9HA 2JDIH 3WPBA 2Z82A 2RGQA 2HMKB 1AVKA 3EBTA 3EN8A 4XDVA 3QK9A 4HVNA 3H3HA 3OWSA 3KKGA 8CHOA 2YFIB 3M18A 3NBBA 3NBRA 5AYRB 1PFPA 3B4PA 1KWIA 4WHAA 5A0OB 1D0BA 3CC73 2Z65A 5B0TA 3HI7A 3UL8A 2P0MA 1OHSA 4O3VA 2P09A 3FKAA 1DMMA 3CD63 3T8NA 5IJCA 3FSDA 3E3ZA 3FH1A 1W6YA 3H51A 1JKGB 2XGNA 1O6SA 4FR9A 1O7WB 1W8AA 4Q3IA 4V2DA 1N5HA 3DMCA 3EQQB 1O6TA 2E2VA 5IYXC 2F99A 4JRFA 4V2EA 2Y74A 3CC23 2GU3A 1UW1A 1Z1SA 1STDA 2F86B 3G4S3 1FO1A 5AIGA 1ZX2A 3LTDA 4R58A 3WN4A 1SQ0B 4WFOA 3DUKA 4HM7B 4N6UA 1OTOA 3M19A 2W9QA 2O6SA 2WQUA 1H6TA 2ML5A 2Z77A 2ASSB 3UL9A 5KP3A 5AWCA 1AVLA 1RRHA 2B24B 3OGKB 4MMZB 2OMYA 1DVDA 2GEYA 3BB9A 1VQ53 4LSCA 4RWTC 3VQ1A 4IIAA 1YRGA 1OGZA 3NV0B 3FG4A 4KZ1A 1KOHA 2FNQA 2BEXA 1U0ND 3E4GA 3VQ2A 3ZYNA 2CWVA 2W9PA 4LGQA 1RN7A 4KVHA 1YJ93 1Q824 3N8BA 4HM6B 1W7CA 3OGMB 4R6AA 3K0ZA 3MYTA 3PXMA 2XSHB 1MOLA 3V98A 1IQYA 2P0XA 2E2UA 1WNHA 2XF3A 1QJGA 2INXA 3Q90A 5CK6A 3SX1A 5AEUB 1D6UA 3EC9A 3K5TA 4G1MB 1JN5A 4GT6A 3F8XA 2PZVA 2MC8A 4MEIA 2HMOB 2CHCA 4XOSA 4XM4A 4KFFA 2Z7AA 1A90A 7STDA 3MKIA 4LXSA 2WGOA 3JUPA 1PU4A 5GMFA 1GY5A 1C7HA 3OW22 1QVF2 1M1XB 1UI8A 2QGUA 1IVVA 1IK3A 4PEQB 5ELUA 3W3MA 4BSSA 1OHOA 3LT9A 1ROVA 5CF2A 2YFLB 2A15A 4I6JB 5IJBA 3BNCA 2XGLA 4Z94G 4EC6A 1LTXA 1LVNA 3OJAA 3STDA 3F7XA 4HYZA 1E97A 4QXEA 2CW9A 1U5OA 2XFSA 4C2BB 4ORLA 3ER7A 3Q1CA 2OQEA 4R0AA 4HZ9B 4XBYA 1CEWI 1Q40A 1G9UA 4CNCA 4WYKB 1D6ZA 2P1QB 1YIJ3 2CFKA 1SIHA 1OOKG 4HJLB 2JQDA 1KC84
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9L A;  3FXI A;  4MJD A;  1ZIW A;  5JPP A;  5AWD A;  5HZL B;  1FS2 A;  3EF8 A;  2WQV A;  5KP4 A;  2FT3 A;  5A5C A;  3ROB A;  2GBX B;  1OCV A;  1NDO B;  3FF2 A;  2OMU A;  1DS9 A;  3NHX A;  1IO0 A;  1W00 A;  1UUW B;  2XR8 B;  5AIH A;  4KNG A;  5HDH A;  4EZG A;  1ISK A;  4Z61 C;  3OXA A;  2JE0 A;  3G8Z A;  2P1N B;  4HM1 B;  4R09 A;  1O7G B;  4LSX C;  1OF5 A;  1P9A G;  1K5D C;  2Z76 A;  2O6Q A;  3RJ0 A;  3ECF A;  2UZX A;  3WMD A;  5B0N A;  4Z64 C;  4Z8G A;  3UNL A;  3KJ4 A;  4FS7 A;  2CKF B;  3CIY A;  2Z7X A;  3UN9 A;  2P1P B;  2GXF A;  2V70 A;  4R9L A;  1H6U A;  1GYB A;  3MHE A;  3FGY A;  2Q4G W;  3F14 A;  4Q3G A;  5G2G A;  4Q53 A;  4L3A A;  2YFJ B;  4RCW A;  4ARR A;  3W3G A;  3RGR A;  1XCD A;  4QBZ A;  3G39 A;  4GLP A;  1XEC A;  3RIZ A;  3ULU A;  4BSR A;  2XRX B;  3RGX A;  5BXQ A;  1OGQ A;  3LYG A;  4XB5 A;  4QC0 A;  4U09 A;  3GZB A;  3GZY B;  4LSA A;  3LZA A;  5GS2 B;  4CP6 A;  5D3I A;  2ELL A;  1O6V A;  1EG9 B;  4UFR A;  2BMQ B;  5IF6 A;  3ZYO A;  5GQR K;  3KE7 A;  1NWW A;  1EA2 A;  2BNG A;  1OH0 A;  5AII A;  3FF0 A;  3EBY A;  2CA6 A;  1ZO2 A;  3SOA A;  4Q62 A;  1P8V A;  3MG2 A;  2JQ5 A;  5AI1 A;  3REZ A;  1JKG A;  2V9T B;  3WPC A;  1E3R A;  3C6N B;  4P8S A;  2OMV A;  2HMJ B;  1Z7X W;  2BMR B;  4L7K A;  4FCJ A;  3G3A A;  1ULJ B;  3CPO A;  4K1V A;  1WWL A;  3RFE A;  4ECN A;  4GB5 A;  1M10 B;  1O7N B;  4BV4 R;  4OVM A;  2P1O B;  3IPT A;  1O7M B;  4NKG A;  4FMZ A;  4TZH A;  5IJD A;  3ULA A;  1CQS A;  3F9S A;  2A0Z A;  4NKH A;  3NV0 A;  3ZYI A;  3OWU A;  5IEP A;  3RFJ A;  5CMP A;  1A2K A;  4HQ1 A;  4RZM A;  1SJW A;  1OGX A;  3C6O B;  1QMA A;  4AY9 X;  3G04 C;  2W2C A;  2UX0 A;  4PER A;  3DZE A;  5EVH A;  3RGA A;  4HZB B;  3E2J A;  3NUV A;  5IEO A;  1Q40 B;  4HM0 B;  2QIY A;  3VSY A;  4K17 A;  4WWU C;  1GS3 A;  3GZX B;  4IM6 A;  3F7S A;  2Z81 A;  5FW5 A;  2OMT A;  4CNM A;  4R9K A;  3I0Y A;  4HM5 B;  4XDW A;  1BUQ A;  4BSU A;  3WPD A;  1QYY A;  2ID5 A;  3G16 A;  5HGR A;  3HK4 A;  1VZZ A;  4X2O A;  5GMG A;  3WPI A;  1XKU A;  3GWR A;  4PKI G;  1JB4 A;  3DZL A;  2AST B;  1OPY A;  2HMM B;  2RFR A;  3CIG A;  4RCA B;  3UL7 A;  3NXJ A;  2GEX A;  4WYK A;  5AZ5 A;  3O53 A;  2JE1 A;  4LMI A;  2BNH A;  2V9S A;  2HMN B;  1JB5 A;  3F8H A;  1IDP A;  5STD A;  1NU3 A;  4FDW A;  4MN8 B;  5FTT B;  2GBW B;  2IFG A;  2I9W A;  2Y5Q A;  3NM2 A;  4U7L A;  4FCM A;  4J9A A;  4U08 A;  4LI1 A;  4R6F A;  4L3F A;  5CMN A;  5IG5 A;  3FLJ A;  3MSO A;  1A9N A;  4R1K A;  1JB2 A;  4U06 A;  1TUH A;  4H3U A;  4R6J A;  4I4K A;  4ECO A;  1XEU A;  5LFN A;  1S5A A;  5AWA A;  4PEJ A;  4CC4 A;  4OQT A;  4J0M A;  4XGO A;  3WPG A;  2OMX A;  3G0K A;  5TGN A;  4KXF B;  2WQX A;  4H09 A;  3A76 A;  3ZYJ A;  4Z79 A;  4CIL A;  3DM8 A;  4HM8 B;  3GOZ A;  3ULV A;  3EN1 B;  1K5G C;  5KP1 A;  3SED A;  4YEB B;  1WQL B;  2IMJ A;  1UUV B;  2Z62 A;  1OTM A;  2B1X B;  4XSQ A;  2OMZ A;  1FQV A;  2WFH A;  4R5C A;  5DRV A;  2Z64 A;  3RGZ A;  4PQ8 A;  3K7C A;  4R07 A;  5IG4 A;  1DMN A;  1OTN A;  3SB4 A;  4P91 A;  1M0Z A;  4L8O A;  3W3L A;  5IG0 A;  2XWT C;  3MG1 A;  2Z63 A;  3WPE A;  2XSO B;  5D82 A;  4J8T A;  3S5C A;  4LXR A;  3EX9 A;  3OX9 A;  3RW7 A;  3BZ5 A;  3FZW A;  4M7E A;  4LEH A;  1Q42 A;  4R08 A;  3O6N A;  3GRD A;  4WP6 A;  1W02 A;  1JN5 B;  3RFS A;  4STD A;  5IEN A;  3BLZ A;  1E3V A;  2K54 A;  3WPF A;  4MQW X;  4FHO A;  3OV4 A;  1XWD C;  5CF1 A;  5D83 A;  3B8L A;  4WP5 A;  2STD A;  2O6R A;  2P1M B;  5IER A;  3F40 A;  4FD0 A;  5AWB A;  4ARN A;  4R5D A;  1GY7 A;  4C2A B;  1W01 A;  4PSJ A;  4LSX A;  3OJA B;  4HM2 B;  5GMH A;  3WPH A;  2OWP A;  4U13 A;  1DCE A;  2OMW A;  3CNX A;  1OZN A;  4CC4 C;  3T8U A;  2UZY A;  3JUM A;  1OUN A;  1DMQ A;  3C6P B;  4HM4 B;  1FT8 A;  1AR0 A;  1O7H B;  3VGN A;  2XOT A;  2RA8 A;  4AW4 A;  1JL5 A;  3G3B A;  3JB9 j;  3CU3 A;  1GWB A;  3E6J A;  1A4Y A;  5IG3 A;  3UJM A;  2BMO B;  3GZR A;  3EJV A;  6STD A;  5B4P A;  3EHC A;  3G06 A;  3TSR E;  1KOO A;  4V2C A;  4XBX A;  5CXO A;  3W3N A;  4OUQ A;  1GY6 A;  3M8C A;  3KZT A;  4N3V A;  5JPU A;  3CVR A;  1ASK A;  4M7E C;  1OF5 B;  2RCD A;  2HML B;  5D81 A;  3HX8 A;  4G8A A;  3B7C A;  1PGV A;  3HZP A;  3OWY A;  3OGL B;  4B8C D;  3KSP A;  2Z66 A;  2WQW A;  1TP6 A;  3P72 A;  3W3J A;  4XBT A;  5AEW B;  2Z7X B;  4HKV B;  4LI2 A;  3MG3 A;  4FCG A;  3DXO A;  5GS0 A;  1M9S A;  1HKX A;  4K1U A;  1DFJ I;  3B4O A;  1K41 A;  5AIF A;  4L8P A;  5BVB A;  1P8T A;  3SOY A;  4X2H A;  2R4I A;  2R9U A;  5DRE A;  5CLK A;  3JUN A;  3CNM A;  3JUO A;  1ULI B;  2RR6 A;  3A79 B;  4KT1 A;  4Y61 B;  3D9R A;  4CDL A;  2F98 A;  1OHP A;  4HM3 B;  4J4L A;  3JUQ A;  3W3K A;  3E99 A;  3PMH G;  1O7P B;  3WPB A;  2Z82 A;  2RGQ A;  2HMK B;  3EBT A;  3EN8 A;  4XDV A;  4HVN A;  3H3H A;  3OWS A;  3KKG A;  8CHO A;  2YFI B;  3M18 A;  3NBR A;  3B4P A;  1D0B A;  2Z65 A;  5B0T A;  3UL8 A;  1OHS A;  3FKA A;  1DMM A;  3T8N A;  5IJC A;  3FSD A;  3E3Z A;  3FH1 A;  1W6Y A;  3H51 A;  1JKG B;  1O6S A;  1O7W B;  1W8A A;  4Q3I A;  4V2D A;  3DMC A;  3EQQ B;  1O6T A;  5IYX C;  2F99 A;  4V2E A;  1Z1S A;  4R58 A;  1STD A;  2F86 B;  1FO1 A;  5AIG A;  1ZX2 A;  3WN4 A;  1SQ0 B;  1OTO A;  3DUK A;  4HM7 B;  3M19 A;  2O6S A;  2WQU A;  1H6T A;  2Z77 A;  3UL9 A;  2ASS B;  5AWC A;  5KP3 A;  3OGK B;  2B24 B;  2OMY A;  2GEY A;  3BB9 A;  4LSC A;  4RWT C;  3VQ1 A;  4IIA A;  1YRG A;  1OGZ A;  3NV0 B;  1KOH A;  3E4G A;  2BEX A;  3VQ2 A;  3ZYN A;  1U0N D;  3RW6 A;  4LGQ A;  4KVH A;  4HM6 B;  3OGM B;  4R6A A;  3K0Z A;  3MYT A;  2XSH B;  3Q90 A;  5AEU B;  1QJG A;  2INX A;  5CK6 A;  3EC9 A;  1JN5 A;  4GT6 A;  3F8X A;  2PZV A;  2HMO B;  2CHC A;  4XOS A;  4XM4 A;  2Z7A A;  7STD A;  3MKI A;  4LXS A;  3JUP A;  5GMF A;  1GY5 A;  1C7H A;  2QGU A;  4PEQ B;  3W3M A;  4BSS A;  1OHO A;  5CF2 A;  2YFL B;  2A15 A;  4I6J B;  5IJB A;  4Z94 G;  1LTX A;  3OJA A;  3STD A;  3F7X A;  1E97 A;  4QXE A;  1U5O A;  4ORL A;  3ER7 A;  4R0A A;  4HZ9 B;  4XBY A;  1G9U A;  1Q40 A;  4CNC A;  4WYK B;  2P1Q B;  4C2B B;  4R6G A;  1OOK G;  4HJL B;  2JQD A; 
#chains in the Genus database with same CATH topology
 3CCE 3;  1M9L A;  5AWD A;  1F8N A;  5HZL B;  3AMO B;  5KP4 A;  2WQV A;  2E2T A;  2GBX B;  4KFD A;  2IY2 A;  2O3O A;  1DS9 A;  1W00 A;  2F5W A;  2ZHX B;  1FGQ A;  3X3X A;  4EZG A;  3OXA A;  2JE0 A;  2P1N B;  1OF5 A;  1RGE A;  1K5D C;  1RHL A;  2Z76 A;  3RJ0 A;  3DGO A;  3WMD A;  4N6N B;  4Z64 C;  4JF8 A;  2W6J H;  2P1P B;  2GXF A;  2W56 A;  3FGY A;  1I3F A;  4L3A A;  1KD1 4;  4ARR A;  1TU5 A;  3CCM 3;  4MMY B;  3G39 A;  1DVC A;  3RIZ A;  4RNY A;  3LYG A;  2CFG A;  4BL3 A;  1X1X A;  1RN1 A;  3HIG A;  3LZA A;  3AHS A;  1OH0 A;  1QAL A;  3FF0 A;  3EBY A;  2CA6 A;  1P8V A;  3IMA B;  3REZ A;  1GOU A;  1E3R A;  1U8C B;  3C6N B;  4P8S A;  1Z7X W;  2BMR B;  5BU4 A;  2P38 A;  3G3A A;  1ULJ B;  2SAR A;  3CPO A;  4K1V A;  3RFE A;  1I2F A;  4BV4 R;  1RGK A;  1TJD A;  4TZH A;  2L4V A;  4EXR A;  3ULA A;  4FCZ A;  1CQS A;  3NM7 A;  4NKH A;  4O02 B;  1RGH A;  8RNT A;  3RFJ A;  1VQ9 3;  1PYL A;  3LTA A;  2KCD A;  2XH9 A;  1QMA A;  4AY9 X;  3G6E 3;  1TRP A;  1BNI A;  2W2C A;  5EVH A;  3I56 3;  1L5G B;  1ZGX A;  5IEO A;  1BSA A;  3UL6 A;  2XFT A;  4IM6 A;  3F7S A;  2L1S A;  4R9K A;  3I0Y A;  3EB8 A;  3MWZ A;  3PGB A;  3ZG0 A;  2OTJ 3;  3HK4 A;  3WPI A;  1XKU A;  4PKI G;  1JB4 A;  1BRS A;  2RFR A;  3NXJ A;  2GEX A;  5AZ5 A;  3BND A;  1JB5 A;  2H0I A;  1IDP A;  5FTT B;  1TIJ A;  2IUK A;  5CMN A;  5IG5 A;  4R1K A;  4U06 A;  1UCJ A;  4R6J A;  1XEU A;  1I2G A;  2OTL 3;  1I2E A;  5AWA A;  4J0M A;  1N5P A;  4XGO A;  2UUG C;  2OMX A;  3G0K A;  1TFO A;  2WQX A;  3A76 A;  1JBT A;  3DM8 A;  4HM8 B;  1FGO A;  3ULV A;  3EN1 B;  2C10 A;  2OMZ A;  4BTW A;  2WFH A;  4R5C A;  2Z64 A;  3RGZ A;  3K7C A;  4N6T A;  1OTN A;  3A5E A;  1W2Z A;  1V74 A;  2XWT C;  3KFQ C;  3MG1 A;  3KN4 A;  4J8T A;  1TTO A;  3BZ5 A;  4M7E A;  3O6N A;  1CH0 A;  3GRD A;  1BOX A;  1M9G A;  1E3V A;  2IA7 A;  5JBS A;  3WPF A;  1VQK 3;  2WOH A;  1XWD C;  4WP5 A;  4ZM8 A;  4C2A B;  1W01 A;  3CXC 2;  3PCR A;  2Q07 A;  2OWP A;  3T8U A;  3DH2 A;  1FT8 A;  1O7H B;  1LOV A;  3BNE A;  4EW5 A;  4AW4 A;  3G3B A;  1IT8 A;  4I5Q A;  3G06 A;  1BRG A;  1EKM A;  1VQQ A;  1GY6 A;  1GD4 A;  1OF5 B;  3WDG B;  7RNT A;  1R4C A;  3HZP A;  4B8C D;  2WQW A;  4BU4 A;  4FCG A;  4MMX B;  3LTB A;  2W56 B;  1D6Y A;  1P8T A;  2R4I A;  2R9U A;  3ZFZ A;  3A79 B;  3V99 A;  4CDL A;  1OHP A;  3JUQ A;  2JDI H;  2Z82 A;  2HMK B;  1RGL A;  3EN8 A;  4XDV A;  1UCK A;  3KKG A;  1PFP A;  5A0O B;  1UCI A;  3UL8 A;  2KF4 A;  1OHS A;  1W6Y A;  1O6S A;  5GSP A;  4Q3I A;  3EQQ B;  4CJN A;  2GU3 A;  4R58 A;  3G4S 3;  5AIG A;  3LTD A;  1SQ0 B;  3DUK A;  4N6U A;  1JBS A;  3UL9 A;  2ASS B;  5KP3 A;  1AVL A;  3OGK B;  1BAO A;  1KOH A;  2CWV A;  4LGQ A;  1Q82 4;  4R6A A;  5HOH A;  3Q90 A;  2P0X A;  1QJG A;  5CK6 A;  2AAE A;  4GT6 A;  3F8X A;  2PZV A;  4CPK A;  4XOS A;  7STD A;  2WGO A;  1GY5 A;  3W3M A;  5ELU A;  1OHO A;  1LTX A;  1LVN A;  3SYU A;  1E97 A;  1RLS A;  4ORL A;  4HZ9 B;  2JQD A;  3Q2P A;  1X1W A;  4MJD A;  1ZIW A;  5JPP A;  1FS2 A;  2FT3 A;  3ROB A;  2Z6B A;  4BTY A;  1LXE A;  1VQP 3;  1BRJ A;  1B2S A;  4EBG A;  1OCV A;  2H0G A;  3HOH A;  3UL5 A;  3CME 3;  1UUW B;  3CPW 2;  5HDH A;  2QA4 3;  1Y4K A;  1O7G B;  4LSX C;  2YX9 A;  2WGQ A;  1P9A G;  3ECF A;  2UZX A;  2D42 A;  2KF5 A;  1N8Q A;  1ROA A;  2ZA4 A;  3F14 A;  5AYS C;  4Q53 A;  2F4Y A;  1K8A 4;  1UGI A;  2YFJ B;  3W3G A;  1XCD A;  4QBZ A;  1XEC A;  2CG0 A;  3CMA 3;  2OQE C;  4N6M A;  5BXQ A;  1OGQ A;  4QC0 A;  2KAA A;  3GAX A;  5GS2 B;  1WTH A;  1BRH A;  2BMQ B;  3ZYO A;  3DGL A;  3KE7 A;  1EA2 A;  2BNG A;  3CCJ 3;  2UGI A;  1ZO2 A;  3SOA A;  1NO3 A;  3LH4 A;  3RDE A;  5G1K A;  4FCJ A;  1UGH I;  1IVW A;  1YI2 3;  4GB5 A;  1VQ4 3;  1M10 B;  3G71 3;  1O7N B;  1JZO A;  1RSN A;  1IV7 A;  3SVA A;  2A0Z A;  3V92 A;  3OWU A;  5IEP A;  1SJW A;  3NX0 A;  5G1L A;  2UX0 A;  3DZE A;  3CCU 3;  3E2J A;  1N9J A;  4EV5 A;  2QEX 3;  4HM0 B;  2KXG A;  2P05 A;  3WHO A;  2Z81 A;  5FW5 A;  4XDW A;  1BUQ A;  4BSU A;  1QYY A;  1VZZ A;  4X2O A;  2CWU A;  2LYX A;  3GWR A;  5FGO A;  1OPY A;  1US1 A;  2HMM B;  4RCA B;  3UL7 A;  3O53 A;  4AEQ A;  2BNH A;  4GHO A;  2HMN B;  3DGM A;  1NU3 A;  4MN8 B;  1M1K 4;  2IFG A;  1YIT 3;  1BSB A;  3FG1 A;  4U7L A;  4FCM A;  2RSX A;  1LQM B;  1GMR A;  1JZD A;  2WOF A;  2BIR A;  1B21 A;  1TUH A;  2HOH A;  4H3U A;  1QVG 2;  4ECO A;  4TX4 A;  3AHW A;  3S67 A;  3WPG A;  4KXF B;  4H09 A;  3ZYJ A;  4Z79 A;  5KP1 A;  1WQL B;  1MNL A;  1GOV A;  1OTM A;  1FGT A;  3SB4 A;  1DMN A;  1CYV A;  5BIR A;  1M0Z A;  2Z63 A;  1RRL A;  2XSO B;  3S5C A;  3OX9 A;  1YJW 3;  3FZW A;  4R08 A;  4FMA A;  4WP6 A;  4STD A;  4NPB A;  1VQN 3;  1MGW A;  1SII A;  4FHO A;  3DGY A;  5CF1 A;  3B8L A;  4FD0 A;  2OOV C;  3NQY A;  3LML A;  4PSJ A;  1RNT A;  3NQZ A;  3CCQ 3;  4CCV A;  4U13 A;  1DCE A;  2OMW A;  3WA3 A;  2Y73 A;  3CNX A;  4K61 A;  1OZN A;  3L0R A;  4LYL B;  2UZY A;  3CCL 3;  3JUM A;  3C6P B;  4NZT M;  3BNB A;  3VGN A;  2KF6 A;  2XOT A;  3N54 B;  2RA8 A;  1JL5 A;  2SBL A;  1TFK A;  3S28 A;  3E6J A;  3RNT A;  2CFD A;  3UJM A;  6STD A;  1LOX A;  3TSR E;  5EEO A;  4XBX A;  5CXO A;  4BTX A;  1STF I;  5M18 A;  3J7Y d;  4M7E C;  2RCD A;  1PGV A;  1QAK A;  3OGL B;  2ZDJ A;  2Z66 A;  2BHM A;  3K9M C;  3P72 A;  4XBT A;  3WOD G;  5AEW B;  3DXO A;  4K1U A;  1DFJ I;  2D1W A;  5AIF A;  5BVB A;  1VQ7 3;  3CCS 3;  3JUN A;  3CNM A;  3JUO A;  4KT1 A;  4Y61 B;  4RNT A;  4EYC A;  2F98 A;  4HM3 B;  3W3K A;  3S29 A;  1FA3 A;  2RGQ A;  4HVN A;  3OWS A;  2YFI B;  3NBB A;  1FW7 A;  4WHA A;  5B0T A;  3HI7 A;  2P09 A;  3CD6 3;  1RMS A;  5M1A A;  4FR9 A;  3CC2 3;  2F86 B;  3M19 A;  2Z77 A;  5AWC A;  1DVD A;  1VQ5 3;  4LSC A;  4RWT C;  4IIA A;  1OGZ A;  3FG4 A;  4KZ1 A;  2FNQ A;  1YJ9 3;  1BNS A;  1T2I A;  3PXM A;  1MOL A;  2E2U A;  1D6U A;  3K5T A;  1JN5 A;  4XM4 A;  1A90 A;  3MKI A;  5GMF A;  1B3S A;  3OW2 2;  1UUG B;  2QGU A;  1IVV A;  3LT9 A;  2YFL B;  1BSE A;  2A15 A;  4I6J B;  5IJB A;  1BAN A;  3F7X A;  4HYZ A;  2CW9 A;  1U5O A;  2CFK A;  4R0A A;  4XBY A;  1CEW I;  1G9U A;  1D6Z A;  2P1Q B;  1YIJ 3;  1SIH A;  1OOK G;  4UFR A;  3FXI A;  3EF8 A;  3URP A;  1YJN 3;  4AKY A;  1NDO B;  3FF2 A;  3X42 A;  3NHX A;  1IO0 A;  1HZ1 A;  2XR8 B;  5AIH A;  4KNG A;  4R80 A;  3X41 A;  1RCL A;  4HM1 B;  4R09 A;  1FGM A;  2CX0 A;  1UCL A;  1BVI A;  6RNT A;  1I0V A;  1RGG A;  3KJ4 A;  4FS7 A;  2CKF B;  3CIY A;  2Z7X A;  3UN9 A;  2XEP A;  1Q86 4;  2CWT A;  4EV2 A;  1WMO A;  1I70 A;  3MHE A;  2Q4G W;  4RCW A;  3RGR A;  1RJO A;  2LQV A;  4GLP A;  2M7O A;  2XRX B;  1W6C A;  1RGC A;  4XB5 A;  4KT3 B;  4U09 A;  3GZB A;  3GZY B;  3D5I A;  1IYY A;  1BU4 A;  1LNH A;  2ELL A;  4RNZ A;  4H61 A;  4N6L A;  1ZS7 A;  1NWW A;  4LSO A;  3SXX A;  5AII A;  3FG3 A;  4Q62 A;  3MG2 A;  2JQ5 A;  1JKG A;  2OMV A;  2HMJ B;  1GD3 A;  3HII A;  3CCR 3;  2P1O B;  4AKZ A;  3IPT A;  4NKG A;  4FMZ A;  3DY5 A;  2ML6 A;  3D5G A;  3ZYI A;  3NV0 A;  4RZM A;  3C6O B;  1NJI 4;  4PER A;  1IVX A;  1MGR A;  4HZB B;  3NUV A;  1RNB A;  1SPU A;  2QIY A;  1KSI A;  1YGW A;  4K17 A;  1GS3 A;  3GZX B;  1JJ2 2;  4CNM A;  3PZW A;  4HM5 B;  1BRN L;  3WPD A;  5HGR A;  3CCV 3;  5GMG A;  1PY3 A;  4BL2 A;  3DZL A;  3CIG A;  1N8R 4;  4WYK A;  1LOW A;  4LMI A;  2V9S A;  1HU9 A;  3MPH A;  3LXU X;  4HBR A;  4FDW A;  2GBW B;  2I9W A;  4LI1 A;  1T3B A;  4N6V 0;  4L3F A;  4RBN A;  3FLJ A;  1A9N A;  3FCS B;  4I4K A;  1OAC A;  1S5A A;  4O2H A;  4PEJ A;  4CC4 A;  1C54 A;  1G96 A;  1NB5 I;  2Z62 A;  2B1X B;  4XSQ A;  3IJE B;  1FQV A;  1RDS A;  3K63 A;  5DRV A;  1HYF A;  4PQ8 A;  3PCS A;  4R07 A;  4P91 A;  4BIR A;  5IG0 A;  2OCT A;  4LXR A;  3RW7 A;  1GMP A;  1IQ8 A;  3ALA A;  4LEH A;  1BNF A;  1W02 A;  1JN5 B;  1VQO 3;  5M19 A;  3RFS A;  3BLZ A;  2K54 A;  3DGN A;  4IPB A;  4MQW X;  4O8S A;  3OV4 A;  1IV9 A;  1AV4 A;  1EUI C;  2O6R A;  2P1M B;  2GU1 A;  5AWB A;  1A2V A;  4ARN A;  3U97 A;  1AQZ A;  1GY7 A;  4LSX A;  4HM2 B;  2RNT A;  2V1L A;  3EE1 A;  2GSP A;  1DMQ A;  3S27 A;  1BRK A;  1IT7 A;  1K73 4;  4OK0 A;  1A4Y A;  5IG3 A;  3LT8 A;  2BMO B;  3GZR A;  3EJV A;  3U1W A;  5B4P A;  1BNJ A;  3LTC A;  1BRI A;  2BU4 A;  1KOO A;  1RKY A;  4V2C A;  3W3N A;  1JBR A;  2F5M A;  1ASK A;  3B7C A;  3KSP A;  1RTU A;  4LZI A;  5EQL A;  1T5Y A;  1I3I A;  1RGF A;  1YGE A;  1DYU A;  2Z7X B;  4HOH A;  2AAD A;  1QAF A;  4HKV B;  1JRQ A;  1M9S A;  1HKX A;  3WOE B;  4NRE A;  3X3Y A;  1K41 A;  1NB3 I;  4L8P A;  3SOY A;  2FGT A;  2W0Q A;  1LNI A;  5CLK A;  1N9E A;  3D9R A;  1SAR A;  1A67 A;  3X40 A;  4J4L A;  3E99 A;  3PMH G;  1O7P B;  3N9H A;  1GOY A;  2F56 A;  8CHO A;  3NBR A;  5AYR B;  1KWI A;  1BSD A;  2Z65 A;  2P0M A;  1DMM A;  3E3Z A;  1JKG B;  2XGN A;  2C4B A;  1O7W B;  4V2D A;  2E2V A;  2F99 A;  4JRF A;  1UW1 A;  1Z1S A;  1FO1 A;  1ZX2 A;  4WFO A;  2W9Q A;  2O6S A;  2WQU A;  1H6T A;  2B24 B;  4MMZ B;  2GEY A;  3NV0 B;  3E4G A;  2BEX A;  3VQ2 A;  4NZR M;  1MWR A;  2W9P A;  3N8B A;  4HM6 B;  1X1U A;  1W7C A;  3V98 A;  1IQY A;  2XF3 A;  2INX A;  3EC9 A;  4G1M B;  1T2H A;  2MC8 A;  2HMO B;  4KFF A;  4LXS A;  1PU4 A;  1QVF 2;  1M1X B;  1NNV A;  2K3D A;  1IK3 A;  4PEQ B;  4BSS A;  1ROV A;  5CF2 A;  4Z94 G;  4EC6 A;  3OJA A;  3ER7 A;  3Q1C A;  1G0T A;  4WYK B;  4R6G A;  1KC8 4;  1RCK A;  1BGS A;  4J5K A;  1J2B A;  5A5C A;  1K28 A;  1Q7H A;  2OMU A;  1YVB I;  1FYS A;  4KFE A;  4DKI A;  1W2B 2;  1ISK A;  4Z61 C;  3G8Z A;  2O6Q A;  4N6O B;  5B0N A;  1UI7 A;  4Z8G A;  3UNL A;  1Q81 4;  1MWS A;  2V70 A;  4R9L A;  1H6U A;  1GYB A;  2OOV A;  1TRQ A;  3WOF B;  2ZL8 A;  1S72 3;  5G2G A;  4Q3G A;  3CC4 3;  1IVU A;  3JVC A;  3ULU A;  4BSR A;  2IUJ A;  3RGX A;  4LSA A;  1IU7 A;  1R4Y A;  1BSC A;  4CP6 A;  5D3I A;  2KF3 A;  1FUT A;  3KSE D;  1EG9 B;  3ZG5 A;  1O6V A;  5IF6 A;  3PS8 A;  3GSP A;  5GQR K;  3SLU A;  5ELJ A;  1A2P A;  5AI1 A;  2W03 A;  2V9T B;  3WPC A;  4L7K A;  1WWL A;  4ECN A;  4J5G A;  6GSP A;  2W04 A;  4OVM A;  1VQL 3;  1O7M B;  1AY7 A;  3AGN A;  4R4K A;  1VQM 3;  2WO0 A;  5IJD A;  1VQ8 3;  3F9S A;  2BO9 B;  5CMP A;  4FMC A;  1A2K A;  4QWT A;  3WA2 X;  1JV2 B;  4HQ1 A;  1OGX A;  3G04 C;  1BIR A;  3BU4 A;  1DET A;  3RGA A;  2KRT A;  2CG1 A;  1Q40 B;  2K0M A;  3VSY A;  1CYU A;  5IW9 A;  4WWU C;  1FUS A;  2OMT A;  4GL6 A;  1YVS A;  3KCH A;  3PYJ A;  2ID5 A;  3G16 A;  5I97 A;  3D3L A;  1JNQ A;  1W4N A;  2AST B;  3O8Y A;  4HAA A;  2JE1 A;  2H0H A;  1B2M A;  3D4A A;  2CX1 A;  3AMO A;  3F8H A;  5STD A;  1Q7Y 4;  2Y5Q A;  3NM2 A;  1X1Y A;  4FMB A;  4J9A A;  4U08 A;  1B27 A;  3TDG A;  4R6F A;  3QRD A;  4FMD A;  3VF1 A;  3MSO A;  1JB2 A;  5LFN A;  4OQT A;  2IYJ A;  1Q9E A;  2CH9 A;  5TGN A;  3WR2 A;  1B2Z A;  4CIL A;  1GSP A;  3GOZ A;  3X3Z A;  1K5G C;  4YEB B;  3SED A;  2IMJ A;  1UUV B;  2O9U X;  2FXT A;  2CIU A;  1V58 A;  5IG4 A;  4K90 B;  1UDI I;  4L8O A;  3W3L A;  9RNT A;  1BNR A;  3WPE A;  1SQW A;  1W5Z A;  5D82 A;  1FUW A;  2MF7 A;  3EX9 A;  2CC3 A;  1LQG C;  1Q42 A;  1MWT A;  3AGO A;  5IEN A;  5D83 A;  1YHQ 3;  1M90 4;  1KQS 2;  2STD A;  5IER A;  3F40 A;  1W6G A;  1LRA A;  4R5D A;  1FGR A;  3OJA B;  5GMH A;  3WPH A;  4CC4 C;  3T0U A;  1OUN A;  5LC6 A;  1IQX A;  3NBJ A;  2CK3 H;  4HM4 B;  1AR0 A;  3JB9 j;  3CU3 A;  3I55 3;  1GWB A;  4IT7 A;  2PNC A;  3EHC A;  3UB1 A;  4OUQ A;  1VQ6 3;  3M8C A;  3KZT A;  2BT3 A;  1BUJ A;  4N3V A;  5JPU A;  3CVR A;  2HML B;  5D81 A;  3HX8 A;  4G8A A;  1FZU A;  3OWY A;  1YNV X;  4NHF A;  1B2U A;  1WMN A;  4GSP A;  1TP6 A;  1EQK A;  3W3J A;  4LI2 A;  3MG3 A;  5GS0 A;  4ILF A;  1I8V A;  1V57 A;  3B4O A;  2CFW A;  3LOY A;  2C11 A;  4X2H A;  5LC7 A;  1K9M 4;  2CFL A;  5DRE A;  1ULI B;  2RR6 A;  1WMP A;  1BNG A;  1B20 A;  3WPB A;  1AVK A;  3EBT A;  3QK9 A;  3H3H A;  3M18 A;  3B4P A;  3D79 A;  1D0B A;  3CC7 3;  4O3V A;  3FKA A;  3T8N A;  5IJC A;  3FSD A;  1DE3 A;  3FH1 A;  3H51 A;  1W8A A;  1N5H A;  3DMC A;  1O6T A;  5IYX C;  4V2E A;  2Y74 A;  1STD A;  3WN4 A;  1OTO A;  4HM7 B;  1G02 A;  2R41 A;  2ML5 A;  1GMQ A;  1EEJ A;  1LOY A;  1RRH A;  2RBI A;  2OMY A;  3BB9 A;  3VQ1 A;  1YRG A;  3RW6 A;  3ZYN A;  1U0N D;  1RN7 A;  3BIR A;  4KVH A;  3OGM B;  3K0Z A;  3MYT A;  2XSH B;  1WNH A;  5AEU B;  1BNE A;  3SX1 A;  2J8X B;  4MEI A;  2CHC A;  2Z7A A;  3JUP A;  1C7H A;  1UI8 A;  1MWU A;  1RN4 A;  1I0X A;  3BNC A;  2XGL A;  1RGA A;  1B2X A;  5RNT A;  3STD A;  4QXE A;  7GSP A;  2XFS A;  4C2B B;  2OQE A;  3Q3F A;  1Q40 A;  4CNC A;  3KII A;  4HJL B; 
#chains in the Genus database with same CATH homology
 3CCE 3;  3Q2P A;  1M9L A;  3FXI A;  4MJD A;  1ZIW A;  5JPP A;  5AWD A;  1F8N A;  1FS2 A;  3EF8 A;  5HZL B;  3AMO B;  5KP4 A;  1J2B A;  2FT3 A;  2WQV A;  5A5C A;  3ROB A;  2Z6B A;  4BTY A;  1LXE A;  1K28 A;  1VQP 3;  2E2T A;  1YJN 3;  4AKY A;  2GBX B;  4EBG A;  4KFD A;  1OCV A;  1NDO B;  3FF2 A;  2O3O A;  2OMU A;  3X42 A;  1DS9 A;  1YVB I;  3UL5 A;  3NHX A;  1IO0 A;  1W00 A;  3CME 3;  1UUW B;  2XR8 B;  5AIH A;  4R80 A;  3CPW 2;  4KNG A;  4KFE A;  5HDH A;  1FGQ A;  3X3X A;  3X41 A;  4EZG A;  1W2B 2;  1ISK A;  2QA4 3;  4Z61 C;  1Y4K A;  3OXA A;  2JE0 A;  3G8Z A;  2P1N B;  4HM1 B;  4R09 A;  1FGM A;  1O7G B;  4LSX C;  2YX9 A;  2WGQ A;  1OF5 A;  1P9A G;  1K5D C;  2Z76 A;  2O6Q A;  3RJ0 A;  3DGO A;  3ECF A;  2UZX A;  3WMD A;  4N6N B;  2D42 A;  4N6O B;  5B0N A;  4Z64 C;  1UI7 A;  4Z8G A;  3UNL A;  3KJ4 A;  4FS7 A;  2CKF B;  3CIY A;  1N8Q A;  4JF8 A;  2Z7X A;  2W6J H;  1ROA A;  3UN9 A;  2P1P B;  2XEP A;  1Q81 4;  2GXF A;  2W56 A;  2V70 A;  4R9L A;  2CWT A;  4EV2 A;  1Q86 4;  3KII A;  1WMO A;  1H6U A;  1GYB A;  2OOV A;  3MHE A;  3FGY A;  2Q4G W;  3WOF B;  3F14 A;  2ZL8 A;  5AYS C;  5G2G A;  4Q53 A;  1S72 3;  3CC4 3;  4L3A A;  4Q3G A;  1K8A 4;  2YFJ B;  1KD1 4;  4RCW A;  4ARR A;  3W3G A;  3RGR A;  1RJO A;  1XCD A;  1IVU A;  1TU5 A;  3CCM 3;  4MMY B;  2LQV A;  3JVC A;  3G39 A;  4GLP A;  4QBZ A;  1DVC A;  1XEC A;  3RIZ A;  3ULU A;  2CG0 A;  4BSR A;  2IUJ A;  3CMA 3;  2OQE C;  2M7O A;  2XRX B;  4N6M A;  3RGX A;  4RNY A;  1W6C A;  5BXQ A;  1OGQ A;  3LYG A;  2CFG A;  4XB5 A;  4QC0 A;  4U09 A;  3GZB A;  3GZY B;  4LSA A;  3HIG A;  1IU7 A;  3GAX A;  3LZA A;  5GS2 B;  4CP6 A;  5D3I A;  1LNH A;  1WTH A;  2ELL A;  4RNZ A;  3KSE D;  1EG9 B;  1O6V A;  4UFR A;  4H61 A;  2BMQ B;  5IF6 A;  3ZYO A;  3PS8 A;  5GQR K;  4N6L A;  3DGL A;  3SLU A;  3KE7 A;  5ELJ A;  1NWW A;  1EA2 A;  2BNG A;  4LSO A;  3SXX A;  1OH0 A;  1QAL A;  5AII A;  3CCJ 3;  3FF0 A;  3EBY A;  2CA6 A;  1ZO2 A;  3FG3 A;  3SOA A;  1NO3 A;  1P8V A;  4Q62 A;  3MG2 A;  2JQ5 A;  3IMA B;  5AI1 A;  3REZ A;  1JKG A;  2W03 A;  1U8C B;  1E3R A;  3LH4 A;  3RDE A;  2V9T B;  3C6N B;  2OMV A;  4P8S A;  3WPC A;  2HMJ B;  1Z7X W;  2BMR B;  4L7K A;  2P38 A;  4FCJ A;  3G3A A;  1ULJ B;  1IVW A;  3CPO A;  4K1V A;  1WWL A;  3RFE A;  4ECN A;  1GD3 A;  3HII A;  1YI2 3;  4GB5 A;  1VQ4 3;  2W04 A;  1M10 B;  3G71 3;  1O7N B;  4BV4 R;  3CCR 3;  4OVM A;  4AKZ A;  2P1O B;  1VQL 3;  3IPT A;  1O7M B;  4NKG A;  4R4K A;  4FMZ A;  3DY5 A;  4TZH A;  1IV7 A;  2WO0 A;  2L4V A;  2ML6 A;  4EXR A;  1VQM 3;  1VQ8 3;  5IJD A;  3ULA A;  4FCZ A;  1CQS A;  3NM7 A;  3F9S A;  3SVA A;  2A0Z A;  3V92 A;  2BO9 B;  4NKH A;  3NV0 A;  4O02 B;  3OWU A;  3ZYI A;  5IEP A;  3RFJ A;  5CMP A;  4FMC A;  1A2K A;  4QWT A;  4RZM A;  1JV2 B;  3WA2 X;  1VQ9 3;  4HQ1 A;  1SJW A;  1OGX A;  3LTA A;  3NX0 A;  1NJI 4;  2KCD A;  2XH9 A;  1QMA A;  3C6O B;  4AY9 X;  3G6E 3;  3G04 C;  2W2C A;  2UX0 A;  4PER A;  3DZE A;  5EVH A;  3I56 3;  3CCU 3;  1L5G B;  3RGA A;  1IVX A;  4HZB B;  3E2J A;  3NUV A;  2KRT A;  1N9J A;  2CG1 A;  5IEO A;  4EV5 A;  2QEX 3;  1Q40 B;  2K0M A;  3UL6 A;  1SPU A;  2QIY A;  2XFT A;  1KSI A;  2KXG A;  4HM0 B;  3VSY A;  1CYU A;  5IW9 A;  2P05 A;  4K17 A;  4WWU C;  1GS3 A;  3GZX B;  4IM6 A;  1JJ2 2;  3F7S A;  2Z81 A;  5FW5 A;  2OMT A;  4CNM A;  3PZW A;  4R9K A;  3I0Y A;  4GL6 A;  3EB8 A;  3MWZ A;  4HM5 B;  3PGB A;  4XDW A;  3PYJ A;  2OTJ 3;  1BUQ A;  4BSU A;  3WPD A;  1QYY A;  2ID5 A;  3G16 A;  5HGR A;  3HK4 A;  1VZZ A;  4X2O A;  5I97 A;  2CWU A;  2LYX A;  3D3L A;  3CCV 3;  3WPI A;  5GMG A;  1JNQ A;  1W4N A;  1XKU A;  3GWR A;  4PKI G;  5FGO A;  1JB4 A;  3DZL A;  2AST B;  1OPY A;  1US1 A;  2HMM B;  2RFR A;  3CIG A;  3O8Y A;  4RCA B;  3UL7 A;  1N8R 4;  3NXJ A;  2GEX A;  4WYK A;  5AZ5 A;  3O53 A;  2JE1 A;  4LMI A;  4AEQ A;  2BNH A;  1HU9 A;  2V9S A;  2HMN B;  3BND A;  3MPH A;  3LXU X;  1JB5 A;  3DGM A;  4HBR A;  3AMO A;  1IDP A;  3F8H A;  5STD A;  1Q7Y 4;  1NU3 A;  4FDW A;  4MN8 B;  5FTT B;  2GBW B;  1M1K 4;  2IFG A;  2I9W A;  1YIT 3;  2Y5Q A;  3NM2 A;  3FG1 A;  4U7L A;  1TIJ A;  4FCM A;  4FMB A;  4J9A A;  4U08 A;  2RSX A;  4LI1 A;  3TDG A;  2IUK A;  4N6V 0;  3QRD A;  4FMD A;  4L3F A;  4R6F A;  3VF1 A;  5IG5 A;  5CMN A;  2WOF A;  4RBN A;  3FLJ A;  3MSO A;  1A9N A;  4R1K A;  1JB2 A;  4U06 A;  1TUH A;  3FCS B;  4H3U A;  4R6J A;  4I4K A;  1QVG 2;  4ECO A;  1XEU A;  5LFN A;  4TX4 A;  2OTL 3;  1OAC A;  1S5A A;  4O2H A;  5AWA A;  4PEJ A;  4CC4 A;  3S67 A;  4OQT A;  4R6G A;  4J0M A;  1N5P A;  4XGO A;  3WPG A;  2OMX A;  3G0K A;  2CH9 A;  5TGN A;  1TFO A;  4KXF B;  1G96 A;  2WQX A;  1NB5 I;  4H09 A;  3A76 A;  3ZYJ A;  4Z79 A;  4CIL A;  3DM8 A;  4HM8 B;  1FGO A;  3GOZ A;  3EN1 B;  3ULV A;  3X3Z A;  1K5G C;  5KP1 A;  3SED A;  4YEB B;  1WQL B;  2C10 A;  1MNL A;  1UUV B;  2IMJ A;  2O9U X;  1OTM A;  2Z62 A;  2B1X B;  4XSQ A;  2OMZ A;  1FGT A;  4BTW A;  3IJE B;  2FXT A;  1FQV A;  2WFH A;  4R5C A;  3K63 A;  5DRV A;  2Z64 A;  3RGZ A;  4PQ8 A;  2CIU A;  3K7C A;  3PCS A;  4N6T A;  4R07 A;  5IG4 A;  1DMN A;  1OTN A;  4K90 B;  4P91 A;  1CYV A;  1M0Z A;  3SB4 A;  1W2Z A;  4L8O A;  3W3L A;  1V74 A;  5IG0 A;  2XWT C;  3KFQ C;  3MG1 A;  2Z63 A;  3KN4 A;  1RRL A;  3WPE A;  1SQW A;  2XSO B;  1W5Z A;  2OCT A;  5D82 A;  1FUW A;  2MF7 A;  4J8T A;  3S5C A;  4LXR A;  3EX9 A;  3OX9 A;  2CC3 A;  3RW7 A;  1YJW 3;  3BZ5 A;  3FZW A;  4M7E A;  1IQ8 A;  3ALA A;  4LEH A;  1Q42 A;  4R08 A;  3O6N A;  3GRD A;  4FMA A;  4WP6 A;  1W02 A;  1JN5 B;  1VQO 3;  3RFS A;  4STD A;  5IEN A;  3BLZ A;  1VQN 3;  1M9G A;  1E3V A;  2K54 A;  3DGN A;  2IA7 A;  4IPB A;  5JBS A;  3WPF A;  1SII A;  1VQK 3;  4MQW X;  4O8S A;  4FHO A;  3OV4 A;  1IV9 A;  2WOH A;  1XWD C;  5CF1 A;  5D83 A;  1AV4 A;  3B8L A;  4WP5 A;  1YHQ 3;  2STD A;  1M90 4;  4ZM8 A;  2GU1 A;  3F40 A;  5IER A;  1W6G A;  1KQS 2;  2OOV C;  2O6R A;  2P1M B;  4FD0 A;  5AWB A;  1A2V A;  4R5D A;  4ARN A;  3U97 A;  1GY7 A;  4C2A B;  1W01 A;  3CXC 2;  3NQY A;  3LML A;  4PSJ A;  4LSX A;  3PCR A;  1FGR A;  3OJA B;  3NQZ A;  4HM2 B;  3CCQ 3;  2Q07 A;  5GMH A;  4CCV A;  2OWP A;  4U13 A;  3WPH A;  1DCE A;  2OMW A;  3WA3 A;  2Y73 A;  3CNX A;  4K61 A;  1OZN A;  4CC4 C;  3T8U A;  3L0R A;  2V1L A;  2UZY A;  3T0U A;  3CCL 3;  3EE1 A;  1OUN A;  1DMQ A;  3JUM A;  5LC6 A;  3S27 A;  1IQX A;  3NBJ A;  2CK3 H;  4HM4 B;  1FT8 A;  3BNB A;  3C6P B;  1IT7 A;  1K73 4;  1AR0 A;  1O7H B;  4OK0 A;  3VGN A;  3N54 B;  3BNE A;  2XOT A;  2RA8 A;  4AW4 A;  1JL5 A;  2SBL A;  3G3B A;  3JB9 j;  1TFK A;  3CU3 A;  3S28 A;  3I55 3;  1GWB A;  3E6J A;  1A4Y A;  4IT7 A;  5IG3 A;  2CFD A;  3UJM A;  1IT8 A;  3LT8 A;  2BMO B;  3RW6 A;  2PNC A;  3EJV A;  3GZR A;  3U1W A;  6STD A;  5B4P A;  3EHC A;  3UB1 A;  3G06 A;  3LTC A;  1LOX A;  3TSR E;  5EEO A;  1RKY A;  1KOO A;  4V2C A;  4XBX A;  5CXO A;  3W3N A;  1EKM A;  4OUQ A;  1VQ6 3;  1GY6 A;  3M8C A;  3KZT A;  4BTX A;  2BT3 A;  4N3V A;  5JPU A;  1STF I;  1GD4 A;  3J7Y d;  3CVR A;  1ASK A;  4M7E C;  1OF5 B;  2RCD A;  2HML B;  5D81 A;  3WDG B;  3HX8 A;  4G8A A;  3B7C A;  1PGV A;  1QAK A;  1R4C A;  3HZP A;  3OWY A;  3OGL B;  4B8C D;  4NHF A;  3KSP A;  1WMN A;  2ZDJ A;  2Z66 A;  4LZI A;  5EQL A;  1T5Y A;  2WQW A;  2BHM A;  1TP6 A;  3K9M C;  1EQK A;  1YGE A;  3P72 A;  1DYU A;  4XBT A;  3WOD G;  5AEW B;  2Z7X B;  3W3J A;  1QAF A;  4HKV B;  3MG3 A;  4LI2 A;  4FCG A;  3DXO A;  4MMX B;  1JRQ A;  3LTB A;  1M9S A;  5GS0 A;  1HKX A;  2W56 B;  4K1U A;  1D6Y A;  1DFJ I;  2D1W A;  3WOE B;  3B4O A;  4NRE A;  3X3Y A;  1K41 A;  5AIF A;  2CFW A;  1NB3 I;  3LOY A;  4L8P A;  5BVB A;  1P8T A;  2C11 A;  3SOY A;  1VQ7 3;  4X2H A;  2R4I A;  2R9U A;  2FGT A;  5LC7 A;  2W0Q A;  1K9M 4;  2CFL A;  3CCS 3;  5DRE A;  5CLK A;  3JUN A;  1N9E A;  3CNM A;  1ULI B;  3JUO A;  2RR6 A;  3V99 A;  3A79 B;  3D9R A;  4KT1 A;  4EYC A;  4Y61 B;  1A67 A;  4CDL A;  2F98 A;  3X40 A;  1OHP A;  1WMP A;  4HM3 B;  3JUQ A;  4J4L A;  3W3K A;  3S29 A;  1FA3 A;  3E99 A;  3PMH G;  1O7P B;  3N9H A;  2JDI H;  3WPB A;  2Z82 A;  2RGQ A;  2HMK B;  1AVK A;  3EBT A;  3EN8 A;  4XDV A;  3QK9 A;  4HVN A;  3H3H A;  3OWS A;  3KKG A;  8CHO A;  2YFI B;  3M18 A;  3NBB A;  3NBR A;  5AYR B;  1PFP A;  3B4P A;  1KWI A;  4WHA A;  5A0O B;  1D0B A;  3CC7 3;  2Z65 A;  5B0T A;  3HI7 A;  3UL8 A;  2P0M A;  1OHS A;  4O3V A;  2P09 A;  3FKA A;  1DMM A;  3CD6 3;  3T8N A;  5IJC A;  3FSD A;  3E3Z A;  3FH1 A;  1W6Y A;  3H51 A;  1JKG B;  2XGN A;  1O6S A;  4FR9 A;  1O7W B;  1W8A A;  4Q3I A;  4V2D A;  1N5H A;  3DMC A;  3EQQ B;  1O6T A;  2E2V A;  5IYX C;  2F99 A;  4JRF A;  4V2E A;  2Y74 A;  3CC2 3;  2GU3 A;  1UW1 A;  1Z1S A;  1STD A;  2F86 B;  3G4S 3;  1FO1 A;  5AIG A;  1ZX2 A;  3LTD A;  4R58 A;  3WN4 A;  1SQ0 B;  4WFO A;  3DUK A;  4HM7 B;  4N6U A;  1OTO A;  3M19 A;  2W9Q A;  2O6S A;  2WQU A;  1H6T A;  2ML5 A;  2Z77 A;  2ASS B;  3UL9 A;  5KP3 A;  5AWC A;  1AVL A;  1RRH A;  2B24 B;  3OGK B;  4MMZ B;  2OMY A;  1DVD A;  2GEY A;  3BB9 A;  1VQ5 3;  4LSC A;  4RWT C;  3VQ1 A;  4IIA A;  1YRG A;  1OGZ A;  3NV0 B;  3FG4 A;  4KZ1 A;  1KOH A;  2FNQ A;  2BEX A;  1U0N D;  3E4G A;  3VQ2 A;  3ZYN A;  2CWV A;  2W9P A;  4LGQ A;  1RN7 A;  4KVH A;  1YJ9 3;  1Q82 4;  3N8B A;  4HM6 B;  1W7C A;  3OGM B;  4R6A A;  3K0Z A;  3MYT A;  3PXM A;  2XSH B;  1MOL A;  3V98 A;  1IQY A;  2P0X A;  2E2U A;  1WNH A;  2XF3 A;  1QJG A;  2INX A;  3Q90 A;  5CK6 A;  3SX1 A;  5AEU B;  1D6U A;  3EC9 A;  3K5T A;  4G1M B;  1JN5 A;  4GT6 A;  3F8X A;  2PZV A;  2MC8 A;  4MEI A;  2HMO B;  2CHC A;  4XOS A;  4XM4 A;  4KFF A;  2Z7A A;  1A90 A;  7STD A;  3MKI A;  4LXS A;  2WGO A;  3JUP A;  1PU4 A;  5GMF A;  1GY5 A;  1C7H A;  3OW2 2;  1QVF 2;  1M1X B;  1UI8 A;  2QGU A;  1IVV A;  1IK3 A;  4PEQ B;  5ELU A;  3W3M A;  4BSS A;  1OHO A;  3LT9 A;  1ROV A;  5CF2 A;  2YFL B;  2A15 A;  4I6J B;  5IJB A;  3BNC A;  2XGL A;  4Z94 G;  4EC6 A;  1LTX A;  1LVN A;  3OJA A;  3STD A;  3F7X A;  4HYZ A;  1E97 A;  4QXE A;  2CW9 A;  1U5O A;  2XFS A;  4C2B B;  4ORL A;  3ER7 A;  3Q1C A;  2OQE A;  4R0A A;  4HZ9 B;  4XBY A;  1CEW I;  1Q40 A;  1G9U A;  4CNC A;  4WYK B;  1D6Z A;  2P1Q B;  1YIJ 3;  2CFK A;  1SIH A;  1OOK G;  4HJL B;  2JQD A;  1KC8 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...