4WYKA

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
344
Chain Sequence
ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nuclear RNA export factor 1
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 344
sequence length 347
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4wykA01
2RFRA 5AEUB 3M8CA 1EA2A 1H6TA 4R6GA 5IF6A 2P1PB 3GZBA 3MYTA 5DREA 4AY9X 4Z79A 5CLKA 5AWDA 3DXOA 5IG4A 2OWPA 1OF5B 3FKAA 3E6JA 2YFLB 2F98A 4R07A 1DMNA 1TP6A 2K54A 1O6TA 3BB9A 3SOYA 4I4KA 3KJ4A 3M19A 2F99A 3LYGA 5IJCA 5IJDA 3FZWA 2JQDA 5D83A 4X2OA 4U08A 2OMVA 1OH0A 1O7HB 2A15A 4P91A 1OCVA 3OWSA 3H51A 3JUQA 3T8NA 1JKGB 1XWDC 4ECNA 4LI2A 4XOSA 1XEUA 3ULUA 4C2BB 1XCDA 2ASSB 1E3VA 1ISKA 4RZMA 4FCGA 5D82A 2XWTC 3GZYB 3WMDA 3VSYA 2JE0A 3JUNA 4L8OA 4UFRA 3OGMB 4WYKA 5AIIA 3NUVA 1P9AG 5HZLB 2O6RA 2P1NB 3DZLA 4Y61B 4BSUA 2HMJB 1STDA 3CIYA 3B7CA 1OZNA 3ER7A 1KOOA 4XBTA 1JN5A 1Z7XW 2P1QB 1FS2A 3CVRA 2Q4GW 3W3GA 5LFNA 4HM5B 4BSSA 3I0YA 2OMXA 2BNGA 4K17A 3REZA 1ZIWA 3W3MA 2F86B 1GYBA 2Z82A 3GZXB 4J4LA 3ECFA 1K5DC 2Z77A 1YRGA 4LSAA 3KKGA 4PEQB 3FXIA 4MJDA 4HZ9B 3HX8A 5BXQA 4HZBB 2O6QA 1DCEA 3WPCA 1XKUA 2OMZA 3F8HA 1A4YA 4LGQA 1UUVB 1BUQA 1QJGA 3IPTA 4OQTA 4IM6A 1ZO2A 2Z65A 4KXFB 1JB2A 4FS7A 5JPUA 2GBWB 1G9UA 1Z1SA 3E2JA 3WPEA 3WPIA 1PGVA 3ZYNA 1U5OA 5CMNA 1P8TA 2Z76A 5IYXC 1OUNA 2B24B 2YFIB 4R6FA 4Z8GA 3C6OB 4PEJA 1Q40B 4R58A 2O6SA 3MG1A 4YEBB 3E4GA 4XDVA 4NKHA 2WQWA 3BZ5A 3UNLA 4CNMA 2HMOB 1OGQA 4ECOA 4LMIA 3C6PB 2BMQB 1Q40A 5B0NA 2XSHB 4WP5A 3GOZA 3MG3A 5KP3A 3UL8A 4U13A 3RIZA 2JQ5A 1ULIB 2BNHA 4XBYA 4ARNA 2Z64A 4R6AA 4FCJA 3WPDA 3G04C 3P72A 1OTMA 5CK6A 3RGZA 1OGZA 2P1MB 4KT1A 1O7NB 7STDA 1U0ND 4GT6A 1HKXA 5TGNA 3FF0A 1DMMA 4PERA 4HM1B 3KE7A 4BSRA 3HZPA 1JL5A 4IIAA 3JUOA 3RGAA 4PSJA 1OF5A 4LXRA 4XSQA 4HVNA 4J8TA 2BMOB 4HM3B 2QIYA 3GRDA 1ASKA 4GB5A 4M7EC 3FH1A 3F7XA 3F40A 3HK4A 1DS9A 4FHOA 4V2CA 3OXAA 1SQ0B 4PKIG 4R09A 5FW5A 2OMYA 5IEOA 1H6UA 1C7HA 1FT8A 1W02A 4MQWX 3A79B 4R1KA 4NKGA 4XBXA 5D81A 3RW7A 4M7EA 3F14A 1JB5A 1OOKG 4N3VA 4HM4B 4U7LA 3RFJA 4U09A 4CNCA 1JKGA 3OX9A 1W8AA 5AZ5A 2RGQA 3K7CA 3CNMA 3JUPA 3NXJA 3RFEA 3F9SA 3OV4A 5AIFA 2XRXB 3G3AA 3OWUA 2CHCA 2B1XB 5BVBA 2UZYA 3K0ZA 3FSDA 4L8PA 1OHPA 1W00A 3NHXA 4HM2B 5EVHA 1LTXA 1QYYA 4LEHA 3ZYJA 5IG3A 1QMAA 3DZEA 2IMJA 3WPGA 4KVHA 4QBZA 4K1VA 4QXEA 3VGNA 3RJ0A 2RCDA 4L7KA 2Z7AA 5AIGA 5IG0A 3F8XA 1JB4A 4Q3IA 4AW4A 5IENA 3OJAB 1O7MB 3DUKA 3OGKB 2BMRB 2GBXB 5B4PA 3EX9A 2R4IA 3W3LA 3EC9A 4XGOA 3PMHG 5CMPA 5DRVA 4HM7B 2WQVA 2CKFB 4I6JB 4TZHA 3OJAA 4XB5A 2Z7XB 4FDWA 2Z63A 3EF8A 3FLJA 4ARRA 1UUWB 3EBYA 2RA8A 1M0ZA 3WN4A 3OWYA 4RCWA 5GMFA 2Z7XA 5B0TA 5AEWB 5GMGA 2WFHA 4Q53A 1NDOB 2HMKB 5GMHA 5CF1A 2JE1A 3UL7A 3E99A 4R5CA 1NU3A 3B8LA 1ULJB 4R9KA 5AIHA 1KOHA 4LSXC 4J0MA 3BLZA 3CPOA 3B4OA 3ULVA 3Q90A 1O7GB 1M10B 3UN9A 4CDLA 1DFJI 1OHSA 4HJLB 2HMNB 3SOAA 2R9UA 2BEXA 1GWBA 3E3ZA 2OMUA 2Z81A 5A5CA 3A76A 1XECA 4FMZA 4HM8B 2QGUA 4MN8B 1Q42A 2RR6A 4CP6A 3KZTA 1AR0A 1M9SA 2V9TB 1K41A 1A9NA 5KP1A 1E3RA 4H3UA 3EBTA 3G06A 1FO1A 3UL9A 1OHOA 5FTTB 3WPBA 2WQXA 1GY6A 3SB4A 1S5AA 2Z66A 3B4PA 1GS3A 1WQLB 3EN8A 4FD0A 2YFJB 2Z62A 5D3IA 4OVMA 5JPPA 3FF2A 3M18A 3MSOA 3JUMA 3G8ZA 4LSCA 5AWBA 3VQ1A 3JB9j 1M9LA 4HM6B 3O53A 4Z61C 3DM8A 2HMLB 2PZVA 6STDA 4L3AA 1GY7A 3W3JA 3EJVA 3C6NB 1WWLA 3LZAA 2W2CA 1OTNA 3GWRA 3ZYIA 1O7PB 2XR8B 4QC0A 3RFSA 3WPFA 4HKVB 4CILA 5G2GA 2FT3A 3ZYOA 4WYKB 2WQUA 4V2DA 1A2KA 1NWWA 2GEXA 5GS2B 4Q3GA 3NM2A 5HGRA 1EG9B 3G3BA 1VZZA 3G39A 4LI1A 4R08A 1E97A 4C2AB 2I9WA 4Z94G 1JN5B 3KSPA 2P1OB 3G0KA 3FGYA 5GS0A 1IDPA 2HMMB 4HQ1A 4ORLA 3S5CA 4L3FA 4V2EA 1GY5A 2ASTB 5AWCA 3T8UA 4GLPA 1O6VA 4XM4A 4CC4C 3W3NA 5IERA 1W6YA 4XDWA 2XOTA 3STDA 5AI1A 2V70A 4H09A 3WPHA 2OMTA 3CNXA 3O6NA 1W01A 3VQ2A 1IO0A 3W3KA 1D0BA 4RCAB 1P8VA 3MG2A 3MHEA 5CF2A 2INXA 2IFGA 2GXFA 4CC4A 4LXSA 2Y5QA 1DMQA 3CU3A 3F7SA 5IG5A 4G8AA 8CHOA 5HDHA 3SEDA 4R9LA 4Z64C 4WP6A 1O6SA 5KP4A 2A0ZA 3ULAA 4KNGA 3H3HA 5AWAA 2STDA 3OGLB 4P8SA 5STDA 1K5GC 5CXOA 5GQRK 3EQQB 3TSRE 3MKIA 4HM0B 3ROBA 4OUQA 4R0AA 4K1UA 4RWTC 3RGXA 1OGXA 3CIGA 4WWUC 4B8CD 1TUHA 4Q62A 2ELLA 1FQVA 2GEYA 1OTOA 1O7WB 4EZGA 5IJBA 3NV0B 3EHCA 4BV4R 2XSOB 3RW6A 3DMCA 2UZXA 4R5DA 2OMWA 3EN1B 1OPYA 2UX0A 4LSXA 1ZX2A 4U06A 4STDA 4R6JA 4FCMA 3NV0A 3G16A 3UJMA 1CQSA 3GZRA 4J9AA 3D9RA 1SJWA 2V9SA 3NBRA 4PQ8A 5IEPA 2CA6A 2ID5A 4X2HA 3RGRA
chains in the Genus database with same CATH superfamily
3LTCA 5IF6A 3PXMA 1BRIA 4AY9X 4KT3B 1D6UA 1I2EA 1VQ43 2CFWA 1OF5B 4K90B 1O6TA 5IJCA 2OMVA 1OH0A 3T8NA 1BNGA 4ECNA 3CC73 1XCDA 1ISKA 5D82A 1UW1A 5I97A 1W6GA 1BNSA 1K8A4 3VSYA 1NJI4 3K63A 4AEQA 2O6RA 2HMJB 2WGQA 3I553 1Z7XW 1QAFA 2GSPA 1US1A 5LFNA 2D1WA 2V1LA 3I0YA 2BNGA 2UGIA 1GYBA 2CFDA 2KXGA 4CJNA 1ZGXA 1B2MA 2J8XB 3KKGA 1V57A 4HZ9B 3HX8A 2O6QA 2O3OA 1XKUA 3LOYA 4LGQA 1QJGA 1FGOA 1B2ZA 2Z65A 1JB2A 1VQQA 2P09A 1G9UA 3E2JA 2D42A 5CMNA 2Z76A 1QALA 4KFEA 1YJ93 3ZG5A 4JF8A 4NKHA 3UNLA 1BIRA 2XF3A 1HYFA 3WHOA 3GOZA 5KP3A 4U13A 2BNHA 4FCJA 1BU4A 3P72A 1OTMA 1ROAA 1OGZA 1YNVX 2P1MB 1IV7A 1BRSA 1W2B2 4R4KA 1MGRA 1JRQA 1K28A 3UL6A 4BSRA 3CCM3 2OTL3 1JL5A 3JUOA 3RGAA 2R41A 1IVXA 4XSQA 4HVNA 4HM3B 3FH1A 2WOFA 1CYUA 4V2CA 3OXAA 1SQ0B 4R09A 1G02A 5IEOA 1H6UA 1RCKA 4R80A 1VQ73 4M7EA 3AMOA 1OOKG 4U7LA 1BNEA 4BTXA 1W8AA 3K7CA 3WOFB 3RFEA 3F9SA 3NM7A 2FXTA 3G3AA 4CPKA 4L8PA 3NHXA 1QYYA 3X42A 1QMAA 3DZEA 1GOYA 4KVHA 4EV2A 4QXEA 1LOWA 3RJ0A 4L7KA 3Q1CA 5AIGA 3CD63 5IENA 4BTWA 1O7MB 3OGKB 2BMRB 2GBXB 3EC9A 2WQVA 1WMNA 2CKFB 1W7CA 4FDWA 3O8YA 1N9JA 3EBYA 2RA8A 3CCS3 1KC84 3CCR3 4RNYA 5B0TA 2WFHA 1HU9A 1LNIA 1BSBA 3UL7A 3KSED 4R5CA 1TU5A 3B8LA 3L0RA 1KOHA 3EE1A 1BRGA 3B4OA 1O7GB 1W6CA 1RGKA 1M10B 2E2UA 2YX9A 1GMRA 1DFJI 1RGCA 3CCU3 1GWBA 4AKZA 2Z81A 4NPBA 1M1XB 3A76A 4HM8B 2JDIH 3KZTA 1AR0A 3BU4A 3KFQC 2XGLA 2WQXA 4N6LA 3LT8A 2Z66A 1WQLB 5A0OB 1I0VA 5D3IA 3WODG 1YJN3 3G8ZA 2MC8A 5AWBA 3D5IA 1UGHI 3FG3A 4HM6B 4Z61C 1I2FA 1C54A 2H0IA 4MMZB 1VQ53 1UI8A 2P0XA 1RCLA 2CK3H 2W2CA 1WTHA 3ZYIA 1O7PB 3QK9A 4BU4A 3RFSA 4O02B 2FT3A 1FGTA 3ZYOA 4WYKB 4V2DA 1NWWA 1HZ1A 1E97A 4C2AB 2I9WA 1IDPA 1WMPA 3LMLA 1GSPA 4ILFA 1IQYA 3S5CA 1S723 1GY5A 2ASTB 1NB3I 1VQ63 1GD4A 4CC4C 1T5YA 1RDSA 1W6YA 4EXRA 2OMTA 2CWVA 3NX0A 1W01A 2SARA 3MG2A 5CF2A 1LQGC 1W5ZA 4LXSA 4G8AA 2K0MA 3SEDA 4WP6A 5KP4A 2A0ZA 4KNGA 3H3HA 5AWAA 2STDA 1TFKA 1K5GC 3OW22 4O8SA 3MKIA 4HM0B 4OUQA 3ROBA 2Y73A 3V98A 3RGXA 4RWTC 4WWUC 3AHSA 1FQVA 1FYSA 2GEYA 4EZGA 2QEX3 2XSOB 4R5DA 1IVWA 1ZX2A 4U06A 1T2HA 2E2TA 1CQSA 4J9AA 3N54B 3LT9A 2ID5A 1TRQA 1BSCA 4N6OB 1JJ22 4FCZA 2C4BA 1H6TA 3X3XA 2P05A 4R6GA 2IA7A 1W2ZA 1YIT3 3GZBA 3MYTA 3DXOA 1QVG2 1VQK3 1RMSA 1IVUA 3FKAA 2YFLB 4R07A 1DMNA 3BB9A 3KJ4A 3LYGA 2IYJA 5IJDA 5LC6A 3LXUX 3FZWA 2JQDA 4EC6A 3HIGA 5D83A 1IV9A 4X2OA 4U08A 3KN4A 3FG4A 4NHFA 1FGQA 3N9HA 1O7HB 2A15A 4P91A 1OCVA 4LYLB 3OWSA 1VQP3 1BNFA 1Q814 2ASSB 4BL2A 4O2HA 3GZYB 1IYYA 2M7OA 2CG1A 3WMDA 2Y74A 3JUNA 3OGMB 3FG1A 3DZLA 4BSUA 2KRTA 1STDA 1BNJA 1TRPA 3ER7A 5IW9A 1FS2A 3CVRA 4J5GA 3W3GA 2KAAA 4HM5B 2WO0A 2KF6A 1AVLA 2F86B 3WA2X 3GZXB 5AYSC 3ECFA 2Z77A 1YRGA 1JZDA 2XFSA 7RNTA 5ELJA 1A4YA 4OQTA 1Q9EA 3SYUA 1ZO2A 1QAKA 3PCSA 2GBWB 2W03A 3WPEA 1PGVA 4ZM8A 1P8TA 5IYXC 3D3LA 1ZS7A 1EQKA 3C6OB 4R58A 4K61A 2O6SA 3MG1A 4YEBB 3E4GA 4XDVA 1X1UA 2CX0A 3BZ5A 3SXXA 1X1YA 1G0TA 3BNEA 3DGNA 4LMIA 2BMQB 3HOHA 2XSHB 3SVAA 3UL8A 1BUJA 4FMCA 1MGWA 2JQ5A 4XBYA 9RNTA 1FGRA 3WPDA 2CW9A 5CK6A 1BSDA 3WOEB 1VQM3 7STDA 1U0ND 1AVKA 4GT6A 3V99A 2OOVA 3Q3FA 3HZPA 4IIAA 1OF5A 3A5EA 3GRDA 4M7EC 1PY3A 2OTJ3 1C7HA 1BNIA 4MQWX 1IVVA 4NKGA 3F14A 2BHMA 1JB5A 4N3VA 6RNTA 3KIIA 4HM4B 3CPW2 3CCE3 1Q7Y4 5AZ5A 2RGQA 5EQLA 5AIFA 2XRXB 3OWUA 3CCJ3 2KF4A 2CFKA 3K0ZA 1L5GB 3FSDA 1RJOA 1OHPA 2ZA4A 1W00A 5EVHA 3ZYJA 5IG3A 2CFLA 2W0QA 2IUJA 1IU7A 2RCDA 3T0UA 1RGGA 5EEOA 3OJAB 5B4PA 2R4IA 1FGMA 5DRVA 4HM7B 4I6JB 1RGAA 3OJAA 4TZHA 1BRHA 7GSPA 4ARRA 1DETA 1UUWB 1RTUA 2LYXA 5GMGA 4HBRA 1LRAA 3S28A 3D79A 1RRHA 1N5PA 2JE1A 3DGMA 1BGSA 3E99A 1B27A 1ULJB 4LSXC 3ULVA 1GMQA 2KF3A 4CDLA 1LXEA 1OHSA 3ZG0A 2W9PA 3NQYA 1OACA 2HMNB 3SOAA 1JZOA 1JBSA 3KCHA 1MWRA 2OMUA 4N6V0 1T2IA 4MN8B 1Q42A 3X3YA 2V9TB 1K41A 4H3UA 2RBIA 3G06A 3UL9A 1UGIA 2FNQA 3B4PA 4FD0A 3S27A 2YFJB 3CXC2 1SIIA 2W6JH 1W4NA 1RSNA 3M18A 3MSOA 4X2HA 4LSCA 3JB9j 3O53A 1IK3A 3X40A 4L3AA 1GY7A 4BTYA 4FMDA 3LZAA 1LOXA 1OTNA 2XR8B 4QC0A 3GAXA 4CILA 2GEXA 5GS2B 3MPHA 1YVBI 3G3BA 3G39A 3CME3 1FUWA 3X3ZA 4NZTM 1JN5B 2E2VA 3KSPA 2P1OB 4HQ1A 4V2EA 1EKMA 1MWTA 4GLPA 2BU4A 2XOTA 3STDA 4HAAA 3U97A 3WPHA 1GOVA 3VQ2A 4H61A 3W3KA 3HIIA 1P8VA 3MHEA 3BNCA 4GHOA 3LTBA 4GL6A 1BRNL 3LTDA 3IMAB 5IG5A 8CHOA 5HDHA 4Z64C 1O6SA 4KFDA 1N8R4 4OK0A 5GQRK 5CXOA 3EQQB 1OGXA 1NNVA 2RSXA 4B8CD 1MOLA 2GU3A 1OTOA 3NV0B 3RW6A 3DMCA 1STFI 1F8NA 1YVSA 4LSXA 2PNCA 3DY5A 1QVF2 1NB5I 1UUGB 4R6JA 3NV0A 1B2XA 2XEPA 3GZRA 1SJWA 2V9SA 4PQ8A 2CX1A 1LOVA 5AEUB 1Y4KA 3M8CA 1RLSA 4DKIA 2P1PB 5CLKA 5RNTA 5JBSA 3X41A 1BSEA 1KWIA 4AKYA 1B20A 1BOXA 3JUQA 1JKGB 1XWDC 4XOSA 1XEUA 2BO9B 3ULUA 4RZMA 1TFOA 2C11A 2WGOA 3UB1A 4FMBA 1IQ8A 2GU1A 4WYKA 5HZLB 3NUVA 1YHQ3 2P1NB 4Y61B 3CIYA 1A90A 4XBTA 2P1QB 3CCV3 2Q4GW 1CEWI 1FA3A 2OMXA 4K17A 4I5QA 3REZA 1ZIWA 3W3MA 2KCDA 4J4LA 1K5DC 2MF7A 4MMXB 4EW5A 1A67A 2QA43 4LSAA 4N6UA 3FXIA 4MJDA 2CWUA 4HZBB 2HOHA 3NBJA 2RNTA 3IPTA 1AQZA 4KXFB 4FS7A 5JPUA 1Z1SA 2CG0A 1JV2B 2B24B 2YFIB 4R6FA 4Z8GA 4PEJA 1LQMB 1I8VA 3WR2A 2WQWA 4LSOA 3D4AA 1OGQA 4ECOA 4J5KA 4WP5A 1D6YA 3MG3A 4EV5A 3RIZA 3BIRA 5HOHA 2Z64A 3G04C 2OOVC 4RNZA 3QRDA 1RRLA 1Q824 1FUTA 1HKXA 1X1WA 5TGNA 4NZRM 3FF0A 1DMMA 4PERA 2F5WA 4HM1B 1FW7A 1AV4A 1MWUA 1ROVA 4J8TA 1PYLA 1ASKA 3F7XA 3F40A 1DS9A 2IUKA 1EUIC 5FW5A 1FT8A 1W02A 4HYZA 1RN7A 2WOHA 4R1KA 4XBXA 5D81A 3RW7A 1X1XA 1CYVA 2OCTA 4CNCA 3OX9A 1NO3A 3JUPA 3OV4A 5BVBA 2UZYA 1T3BA 4BL3A 1JBTA 4HM2B 4LEHA 3VF1A 4FR9A 3HI7A 5IG0A 3F8XA 1JB4A 1WMOA 4NREA 1TIJA 4AW4A 1RNTA 1V58A 1DVCA 2Z6BA 3LH4A 5M1AA 3DH2A 3EX9A 3PZWA 3W3LA 5LC7A 4WFOA 2FGTA 1BRKA 5CMPA 4XB5A 2Z63A 4N6MA 3FLJA 3WA3A 2W56B 1M0ZA 3OWYA 4RCWA 5GMFA 5AEWB 1JNQA 1NDOB 2HMKB 1AY7A 1LVNA 4N6NB 5GMHA 5CF1A 5FGOA 1I2GA 1FUSA 4FMAA 5AYRB 4R9KA 5AIHA 4J0MA 3Q90A 3GSPA 1LOYA 1TTOA 3UN9A 3S67A 4HJLB 2BEXA 1YIJ3 1UCKA 3I563 3E3ZA 4RBNA 4FMZA 2QGUA 4CP6A 2F5MA 3DGOA 5KP1A 1E3RA 1FO1A 5GSPA 1GY6A 3SB4A 2W04A 1S5AA 5ELUA 3PGBA 5M18A 4OVMA 5JPPA 1R4YA 4O3VA 3VQ1A 4LZIA 3DM8A 3BNDA 2PZVA 1RGLA 6STDA 3LTAA 3EJVA 3UL5A 1J2BA 2F56A 3G4S3 1UI7A 3CCQ3 3WPFA 5G2GA 2WQUA 1EG9B 1U8CB 3ALAA 1VZZA 4R08A 3JVCA 4Z94G 2CIUA 3G0KA 3FGYA 5GS0A 2HMMB 4ORLA 4L3FA 3T8UA 5G1LA 5IERA 4XDWA 5AI1A 2ZL8A 3CNXA 2ZHXB 3O6NA 1IO0A 2BT3A 4IT7A 4RCAB 3Q2PA 2IFGA 1A2VA 3URPA 1DMQA 3F7SA 1B3SA 3OGLB 1V74A 4P8SA 1RN4A 5STDA 1I3IA 3TSRE 4R0AA 4K1UA 3CIGA 1PU4A 1TUHA 1VQ83 1O7WB 5IJBA 1R4CA 2OQEA 1K734 1GD3A 3EN1B 1OPYA 5M19A 2UX0A 2C10A 4STDA 3WDGB 3G16A 3D9RA 3NBRA 2RFRA 3IJEB 1EA2A 1IT8A 5DREA 4Z79A 5AWDA 5IG4A 2OWPA 1RKYA 4N6TA 3E6JA 2F98A 2K54A 1TP6A 4CCVA 3SOYA 4I4KA 3M19A 2F99A 4HOHA 3AMOB 3H51A 4LI2A 4C2BB 6GSPA 1E3VA 2XWTC 3J7Yd 2H0HA 1BVIA 2JE0A 1EEJA 4L8OA 4UFRA 1M1K4 5AIIA 1P9AG 1IQXA 1SQWA 1SPUA 1DYUA 1BNRA 3B7CA 1VQN3 1OZNA 2XGNA 1KOOA 1JN5A 1UCLA 4BSSA 2CWTA 2Z82A 4QWTA 1KSIA 4PEQB 5BXQA 4JRFA 1DCEA 3WPCA 2OMZA 3F8HA 1UUVB 1BUQA 4IM6A 3AHWA 1SIHA 1M904 1UCIA 1FZUA 2F4YA 3WPIA 3ZYNA 3TDGA 1U5OA 1RGHA 1OUNA 2AADA 1I70A 2UUGC 1Q40B 3AGNA 2IY2A 3AGOA 1KQS2 4CNMA 4RNTA 2HMOB 3C6PB 1Q40A 5B0NA 3SLUA 3G6E3 3NQZA 3D5GA 3FCSB 1ULIB 1I0XA 4ARNA 1B2SA 4R6AA 2CFGA 2ZDJA 3RGZA 4KT1A 1O7NB 1DVDA 1RGEA 1PFPA 1B21A 3KE7A 4PSJA 5BU4A 4LXRA 2BMOB 2QIYA 1YJW3 4GB5A 3HK4A 1CH0A 1LNHA 4FHOA 2BIRA 4EYCA 3K5TA 4PKIG 4IPBA 2Q07A 2OMYA 3A79B 3CC23 1RN1A 3RFJA 1A2PA 4U09A 1N5HA 1JKGA 1RHLA 5G1KA 1KD14 3CNMA 3NXJA 5BIRA 1BAOA 2CHCA 2B1XB 1WNHA 1UDII 1LTXA 2IMJA 3WPGA 4QBZA 4K1VA 3MWZA 3VGNA 4TX4A 4WHAA 2Z7AA 8RNTA 1VQL3 4Q3IA 2L4VA 4MMYB 4BIRA 3DUKA 1TJDA 3NBBA 1RNBA 3BNBA 4XGOA 3PMHG 3N8BA 2Z7XB 3EF8A 2W9QA 1N8QA 2L1SA 3RDEA 1YI23 3CMA3 1JBRA 1DE3A 3WN4A 1MNLA 2Z7XA 1BANA 4GSPA 4Q53A 4KFFA 3RNTA 1NU3A 3BLZA 3CPOA 1IT7A 1MWSA 2R9UA 1SARA 2H0GA 1D6ZA 5A5CA 3G713 1BRJA 1XECA 3DGYA 2RR6A 1M9SA 1A9NA 3EBTA 3S29A 1OHOA 2ML6A 5FTTB 3WPBA 1GS3A 3EN8A 2Z62A 2P0MA 1BSAA 1I3FA 1VQ93 3CC43 2ML5A 3FF2A 3JUMA 3PS8A 1M9LA 2HMLB 1B2UA 2KF5A 3W3JA 2XFTA 3C6NB 1WWLA 2XH9A 3GWRA 3U1WA 4HKVB 1A2KA 1YGWA 1GOUA 4Q3GA 3NM2A 5HGRA 1N9EA 4LI1A 3SX1A 1Q864 5AWCA 2LQVA 1O6VA 4XM4A 3W3NA 1M9GA 1RGFA 2V70A 4H09A 2CC3A 1D0BA 2INXA 4CC4A 2GXFA 3CCL3 1VQO3 2Y5QA 3CU3A 2SBLA 2AAEA 4R9LA 3ULAA 1K9M4 4KZ1A 1Q7HA 2CH9A 2P38A 2W56A 2OQEC 4Q62A 2ELLA 2K3DA 4MEIA 4BV4R 3EHCA 3V92A 1G96A 1UCJA 3PYJA 2UZXA 2O9UX 3EB8A 3ZFZA 4EBGA 2OMWA 1GMPA 4FCMA 3DGLA 3UJMA 4G1MB 3PCRA 3K9MC 5IEPA 2CA6A 4FCGA 1YGEA 3RGRA
chains in the Genus database with same CATH topology
1JJ22 2RFRA 5AEUB 3IJEB 4FCZA 1Y4KA 3M8CA 3LTCA 1EA2A 1H6TA 3X3XA 2P05A 4R6GA 2IA7A 5IF6A 3PXMA 1W2ZA 1YIT3 2P1PB 1IT8A 3GZBA 3MYTA 5DREA 4AY9X 1D6UA 5CLKA 4Z79A 3DXOA 5IG4A 1VQ43 1QVG2 2CFWA 5AWDA 2OWPA 1RKYA 1VQK3 1OF5B 1IVUA 3FKAA 4N6TA 4K90B 5JBSA 3E6JA 2YFLB 3X41A 2F98A 4R07A 1DMNA 1TP6A 2K54A 4CCVA 1O6TA 3BB9A 3SOYA 4I4KA 3KJ4A 3M19A 2F99A 3LYGA 1KWIA 5IJCA 5IJDA 5LC6A 3LXUX 3FZWA 2JQDA 4EC6A 3HIGA 5D83A 1IV9A 4X2OA 4AKYA 4U08A 3KN4A 3FG4A 4NHFA 1FGQA 2OMVA 3AMOB 1OH0A 1O7HB 2A15A 3N9HA 4P91A 1OCVA 3OWSA 1VQP3 3H51A 3JUQA 3T8NA 1JKGB 1XWDC 4ECNA 4LI2A 3CC73 4XOSA 1XEUA 2BO9B 3ULUA 4C2BB 1Q814 1XCDA 2ASSB 1E3VA 1ISKA 4RZMA 4FCGA 1TFOA 4O2HA 5D82A 2XWTC 3J7Yd 1UW1A 5I97A 3GZYB 1W6GA 2M7OA 2CG1A 2C11A 3WMDA 1K8A4 2WGOA 2Y74A 4FMBA 3UB1A 3VSYA 3JUNA 2JE0A 1NJI4 1IQ8A 4L8OA 2GU1A 3K63A 1M1K4 4WYKA 5AIIA 3NUVA 4AEQA 1YHQ3 1P9AG 3OGMB 5HZLB 1IQXA 2O6RA 3FG1A 1SQWA 3DZLA 2P1NB 4Y61B 2KRTA 4BSUA 1SPUA 2HMJB 1DYUA 1STDA 2WGQA 3B7CA 3I553 1VQN3 1A90A 3CIYA 1OZNA 3ER7A 2XGNA 4XBTA 1JN5A 5IW9A 1KOOA 1FS2A 1Z7XW 1QAFA 2P1QB 3CCV3 3CVRA 2Q4GW 3W3GA 1CEWI 1US1A 5LFNA 2D1WA 2V1LA 4HM5B 2WO0A 1FA3A 4BSSA 3I0YA 2OMXA 2BNGA 4K17A 1AVLA 3REZA 1ZIWA 3W3MA 2F86B 1GYBA 2CWTA 2KCDA 3GZXB 5AYSC 3ECFA 3WA2X 2CFDA 1K5DC 2MF7A 4MMXB 2KXGA 4QWTA 1KSIA 1A67A 2Z77A 2QA43 1YRGA 4LSAA 2XFSA 3KKGA 4PEQB 4N6UA 3FXIA 4MJDA 4HZ9B 2CWUA 3HX8A 5BXQA 4HZBB 2O6QA 4JRFA 5ELJA 1DCEA 2O3OA 3WPCA 1XKUA 3LOYA 2OMZA 3F8HA 3NBJA 4LGQA 1UUVB 1BUQA 1A4YA 1QJGA 1FGOA 3IPTA 4OQTA 4IM6A 1ZO2A 1M904 1SIHA 2Z65A 1QAKA 4KXFB 1JB2A 3PCSA 5JPUA 2Z82A 4FS7A 2P09A 2GBWB 1G9UA 1Z1SA 2CG0A 2W03A 3E2JA 4UFRA 3WPEA 3WPIA 1PGVA 3TDGA 2D42A 1U5OA 3ZYNA 5CMNA 4ZM8A 1JV2B 2Z76A 1P8TA 1QALA 3D3LA 4KFEA 1YJ93 5IYXC 1OUNA 2B24B 1EQKA 2YFIB 4R6FA 4Z8GA 3C6OB 4PEJA 1Q40B 4R58A 4K61A 2O6SA 3MG1A 4YEBB 3E4GA 4JF8A 4XDVA 1KQS2 4NKHA 2WQWA 3BZ5A 3SXXA 3UNLA 4LSOA 4CNMA 2HMOB 1OGQA 3BNEA 3DGNA 4LMIA 4ECOA 3C6PB 2BMQB 1Q40A 5B0NA 2XSHB 3SLUA 2XF3A 4WP5A 3G6E3 3GOZA 3SVAA 1D6YA 3MG3A 3NQZA 5KP3A 4EV5A 3UL8A 4U13A 4FMCA 3RIZA 3FCSB 2JQ5A 1ULIB 2BNHA 4XBYA 4ARNA 1FGRA 2Z64A 4R6AA 4FCJA 2CFGA 3WPDA 3G04C 2OOVC 2CW9A 3P72A 1OTMA 2ZDJA 4RNZA 5CK6A 1ROAA 3RGZA 1OGZA 2P1MB 4KT1A 1IV7A 1O7NB 3QRDA 1RRLA 1DVDA 3WOEB 1VQM3 7STDA 1W2B2 1U0ND 1AVKA 1Q824 4GT6A 1HKXA 4R4KA 3V99A 5TGNA 1PFPA 1JRQA 1DMMA 1K28A 3FF0A 2OOVA 4PERA 4HM1B 3KE7A 3UL6A 4BSRA 3HZPA 1AV4A 3CCM3 2OTL3 1JL5A 4IIAA 3JUOA 3RGAA 4PSJA 1OF5A 1ROVA 4LXRA 1IVXA 4XSQA 4HVNA 4J8TA 2BMOB 4HM3B 2QIYA 3GRDA 1ASKA 4GB5A 1YJW3 4M7EC 3FH1A 3F7XA 3F40A 3HK4A 2WOFA 1LNHA 1DS9A 4FHOA 1CYUA 4EYCA 4V2CA 3K5TA 2IUKA 3OXAA 1SQ0B 4PKIG 2OTJ3 4R09A 5FW5A 4IPBA 2Q07A 2OMYA 5IEOA 1H6UA 1C7HA 1FT8A 1W02A 4HYZA 1RN7A 4MQWX 1IVVA 2WOHA 4R1KA 4R80A 1VQ73 3A79B 4XBXA 5D81A 3CC23 4NKGA 3RW7A 4M7EA 3F14A 2BHMA 3AMOA 1JB5A 1OOKG 1CYVA 4N3VA 3KIIA 4HM4B 4U7LA 2OCTA 3RFJA 4U09A 4CNCA 1N5HA 3CPW2 3CCE3 1JKGA 4BTXA 3OX9A 1W8AA 1Q7Y4 5AZ5A 2RGQA 5EQLA 1NO3A 1KD14 3K7CA 3WOFB 3CNMA 3JUPA 3NXJA 3RFEA 3F9SA 3NM7A 3OV4A 2FXTA 5AIFA 2XRXB 3G3AA 3OWUA 3CCJ3 4J4LA 2CHCA 2B1XB 5BVBA 2UZYA 2CFKA 3K0ZA 1L5GB 3FSDA 1RJOA 4L8PA 1OHPA 1WNHA 1W00A 3NHXA 4HM2B 5EVHA 1LTXA 1QYYA 4LEHA 3X42A 3ZYJA 5IG3A 1QMAA 3DZEA 3VF1A 2IMJA 2CFLA 3WPGA 2W0QA 4FR9A 4KVHA 4EV2A 2IUJA 1IU7A 4QBZA 4K1VA 4QXEA 3MWZA 3VGNA 3RJ0A 2RCDA 4L7KA 3Q1CA 3HI7A 4TX4A 4WHAA 2Z7AA 5AIGA 5IG0A 3T0UA 3CD63 3F8XA 1JB4A 1WMOA 4NREA 1VQL3 4Q3IA 2L4VA 5EEOA 4MMYB 1TIJA 4AW4A 5IENA 4BTWA 3OJAB 1O7MB 3DUKA 1DVCA 3OGKB 2BMRB 2GBXB 3NBBA 5B4PA 2Z6BA 3LH4A 3EX9A 3BNBA 2R4IA 1FGMA 3PZWA 3EC9A 5LC7A 4WFOA 2FGTA 4XGOA 3PMHG 3W3LA 5CMPA 5DRVA 4HM7B 1WMNA 2CKFB 2WQVA 4I6JB 4TZHA 3OJAA 1W7CA 4XB5A 3N8BA 2Z7XB 4FDWA 2Z63A 4N6MA 3EF8A 2W9QA 1N8QA 3FLJA 3WA3A 4ARRA 3RDEA 1YI23 3CMA3 3O8YA 1N9JA 1UUWB 3EBYA 2W56B 2RA8A 1M0ZA 3WN4A 3CCS3 3OWYA 2LYXA 1MNLA 1KC84 3CCR3 4RNYA 4RCWA 2Z7XA 5GMFA 5B0TA 5AEWB 1JNQA 5GMGA 2WFHA 4Q53A 1NDOB 2HMKB 4HBRA 1LVNA 4N6NB 3S28A 4KFFA 5GMHA 1RRHA 1N5PA 1HU9A 5CF1A 2JE1A 3DGMA 5FGOA 3UL7A 3E99A 3KSED 4R5CA 4FMAA 5AYRB 1NU3A 1TU5A 3B8LA 1ULJB 3L0RA 4R9KA 5AIHA 1KOHA 4LSXC 3BLZA 3EE1A 4J0MA 3CPOA 3B4OA 3ULVA 3Q90A 1O7GB 1W6CA 1IT7A 1M10B 2E2UA 2YX9A 3UN9A 4CDLA 1DFJI 3S67A 1LXEA 1OHSA 2W9PA 3NQYA 1OACA 2HMNB 4HJLB 3SOAA 3CCU3 2R9UA 2BEXA 1YIJ3 1GWBA 3I563 4AKZA 1D6ZA 2OMUA 2Z81A 4N6V0 3E3ZA 5A5CA 3G713 4RBNA 1M1XB 3A76A 1XECA 4FMZA 4HM8B 2QGUA 4MN8B 1Q42A 2RR6A 2JDIH 3KZTA 4CP6A 1AR0A 3X3YA 1M9SA 2V9TB 3DGOA 1K41A 1A9NA 5KP1A 1E3RA 4H3UA 3EBTA 3G06A 1FO1A 3UL9A 3KFQC 2XGLA 3S29A 1OHOA 2ML6A 5FTTB 3WPBA 2WQXA 1GY6A 3SB4A 2W04A 2FNQA 1S5AA 4N6LA 3LT8A 2Z66A 5ELUA 3B4PA 1GS3A 1WQLB 3EN8A 3PGBA 5A0OB 4FD0A 3S27A 2YFJB 2Z62A 3CXC2 5D3IA 2P0MA 1SIIA 4OVMA 5JPPA 2W6JH 1VQ93 3CC43 3WODG 1W4NA 2ML5A 3FF2A 3M18A 3MSOA 3JUMA 1YJN3 3G8ZA 4LSCA 3PS8A 2MC8A 5AWBA 4O3VA 3VQ1A 3JB9j 1M9LA 3FG3A 4HM6B 4LZIA 1IK3A 3O53A 4Z61C 3DM8A 3BNDA 2HMLB 2PZVA 3X40A 6STDA 4L3AA 1GY7A 3LTAA 3W3JA 2XFTA 4MMZB 3EJVA 1VQ53 1UI8A 1WWLA 3C6NB 4BTYA 4FMDA 2XH9A 3LZAA 2P0XA 3UL5A 1J2BA 2CK3H 3G4S3 2W2CA 1LOXA 1WTHA 1OTNA 1UI7A 3GWRA 3ZYIA 1O7PB 2XR8B 3QK9A 4QC0A 3GAXA 3U1WA 4O02B 3CCQ3 3RFSA 3WPFA 4HKVB 4CILA 5G2GA 2FT3A 1FGTA 3ZYOA 4WYKB 2WQUA 4V2DA 1A2KA 1NWWA 2GEXA 5GS2B 4Q3GA 3NM2A 3MPHA 1YVBI 1EG9B 1U8CB 3ALAA 1N9EA 5HGRA 1VZZA 3G3BA 3G39A 4LI1A 3CME3 4R08A 1E97A 1FUWA 3X3ZA 3JVCA 2I9WA 4C2AB 4Z94G 1JN5B 3SX1A 2E2VA 3KSPA 2P1OB 2CIUA 3G0KA 3FGYA 5GS0A 1IDPA 1WMPA 3LMLA 2HMMB 1Q864 4ORLA 4HQ1A 1IQYA 3S5CA 4L3FA 4V2EA 1S723 1EKMA 1GY5A 2ASTB 1NB3I 1VQ63 1GD4A 5AWCA 2LQVA 3T8UA 4GLPA 1O6VA 4XM4A 4CC4C 1T5YA 3W3NA 5IERA 1M9GA 1W6YA 4XDWA 2XOTA 3STDA 5AI1A 3U97A 2V70A 4H09A 2CC3A 3WPHA 4EXRA 2OMTA 2ZL8A 3CNXA 2CWVA 3NX0A 3O6NA 1W01A 4H61A 3VQ2A 1IO0A 2BT3A 3W3KA 4IT7A 1D0BA 3Q2PA 3HIIA 1P8VA 4RCAB 3MG2A 3BNCA 3MHEA 5CF2A 2INXA 2IFGA 2GXFA 1A2VA 4CC4A 3LTBA 1W5ZA 4GL6A 3CCL3 1VQO3 2Y5QA 4LXSA 3LTDA 1DMQA 3CU3A 3IMAB 3F7SA 5IG5A 4G8AA 2K0MA 8CHOA 3SEDA 5HDHA 2SBLA 4R9LA 4Z64C 4WP6A 1O6SA 5KP4A 2A0ZA 3ULAA 4KFDA 4KNGA 1K9M4 3H3HA 5AWAA 4KZ1A 2STDA 1N8R4 4OK0A 2CH9A 3OGLB 1V74A 4P8SA 2P38A 1TFKA 5STDA 1K5GC 5CXOA 3OW22 4O8SA 5GQRK 3EQQB 3TSRE 2W56A 2OQEC 3MKIA 4HM0B 4OUQA 3ROBA 2Y73A 3V98A 4K1UA 4RWTC 4R0AA 1OGXA 3CIGA 1PU4A 3RGXA 2RSXA 4WWUC 4B8CD 1MOLA 1TUHA 4Q62A 2ELLA 1VQ83 1FQVA 2GEYA 2GU3A 4MEIA 1OTOA 1O7WB 2QEX3 4EZGA 5IJBA 3NV0B 3EHCA 3V92A 4BV4R 1G96A 1R4CA 2XSOB 3RW6A 3DMCA 3PYJA 2O9UX 1STFI 3EB8A 2OQEA 4EBGA 1K734 2OMWA 1GD3A 2UZXA 1F8NA 4R5DA 3EN1B 1OPYA 1IVWA 2UX0A 2C10A 4LSXA 1ZX2A 4U06A 2PNCA 3DY5A 1QVF2 4STDA 1NB5I 3WDGB 4R6JA 4FCMA 3DGLA 3NV0A 2E2TA 3G16A 3UJMA 1CQSA 4G1MB 2XEPA 3PCRA 3GZRA 4J9AA 3N54B 3D9RA 1SJWA 3LT9A 3NBRA 3K9MC 5IEPA 2V9SA 4PQ8A 2CA6A 2ID5A 4X2HA 1YGEA 4N6OB 3RGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFR A;  5AEU B;  3M8C A;  1EA2 A;  1H6T A;  4R6G A;  5IF6 A;  2P1P B;  3GZB A;  3MYT A;  5DRE A;  4AY9 X;  4Z79 A;  5CLK A;  5AWD A;  3DXO A;  5IG4 A;  2OWP A;  1OF5 B;  3FKA A;  3E6J A;  2YFL B;  2F98 A;  4R07 A;  1DMN A;  1TP6 A;  2K54 A;  1O6T A;  3BB9 A;  3SOY A;  4I4K A;  3KJ4 A;  3M19 A;  2F99 A;  3LYG A;  5IJC A;  5IJD A;  3FZW A;  2JQD A;  5D83 A;  4X2O A;  4U08 A;  2OMV A;  1OH0 A;  1O7H B;  2A15 A;  4P91 A;  1OCV A;  3OWS A;  3H51 A;  3JUQ A;  3T8N A;  1JKG B;  1XWD C;  4ECN A;  4LI2 A;  4XOS A;  1XEU A;  3ULU A;  4C2B B;  1XCD A;  2ASS B;  1E3V A;  1ISK A;  4RZM A;  4FCG A;  5D82 A;  2XWT C;  3GZY B;  3WMD A;  3VSY A;  2JE0 A;  3JUN A;  4L8O A;  4UFR A;  3OGM B;  4WYK A;  5AII A;  3NUV A;  1P9A G;  5HZL B;  2O6R A;  2P1N B;  3DZL A;  4Y61 B;  4BSU A;  2HMJ B;  1STD A;  3CIY A;  3B7C A;  1OZN A;  3ER7 A;  1KOO A;  4XBT A;  1JN5 A;  1Z7X W;  2P1Q B;  1FS2 A;  3CVR A;  2Q4G W;  3W3G A;  5LFN A;  4HM5 B;  4BSS A;  3I0Y A;  2OMX A;  2BNG A;  4K17 A;  3REZ A;  1ZIW A;  3W3M A;  2F86 B;  1GYB A;  2Z82 A;  3GZX B;  4J4L A;  3ECF A;  1K5D C;  2Z77 A;  1YRG A;  4LSA A;  3KKG A;  4PEQ B;  3FXI A;  4MJD A;  4HZ9 B;  3HX8 A;  5BXQ A;  4HZB B;  2O6Q A;  1DCE A;  3WPC A;  1XKU A;  2OMZ A;  3F8H A;  1A4Y A;  4LGQ A;  1UUV B;  1BUQ A;  1QJG A;  3IPT A;  4OQT A;  4IM6 A;  1ZO2 A;  2Z65 A;  4KXF B;  1JB2 A;  4FS7 A;  5JPU A;  2GBW B;  1G9U A;  1Z1S A;  3E2J A;  3WPE A;  3WPI A;  1PGV A;  3ZYN A;  1U5O A;  5CMN A;  1P8T A;  2Z76 A;  5IYX C;  1OUN A;  2B24 B;  2YFI B;  4R6F A;  4Z8G A;  3C6O B;  4PEJ A;  1Q40 B;  4R58 A;  2O6S A;  3MG1 A;  4YEB B;  3E4G A;  4XDV A;  4NKH A;  2WQW A;  3BZ5 A;  3UNL A;  4CNM A;  2HMO B;  1OGQ A;  4ECO A;  4LMI A;  3C6P B;  2BMQ B;  1Q40 A;  5B0N A;  2XSH B;  4WP5 A;  3GOZ A;  3MG3 A;  5KP3 A;  3UL8 A;  4U13 A;  3RIZ A;  2JQ5 A;  1ULI B;  2BNH A;  4XBY A;  4ARN A;  2Z64 A;  4R6A A;  4FCJ A;  3WPD A;  3G04 C;  3P72 A;  1OTM A;  5CK6 A;  3RGZ A;  1OGZ A;  2P1M B;  4KT1 A;  1O7N B;  7STD A;  1U0N D;  4GT6 A;  1HKX A;  5TGN A;  3FF0 A;  1DMM A;  4PER A;  4HM1 B;  3KE7 A;  4BSR A;  3HZP A;  1JL5 A;  4IIA A;  3JUO A;  3RGA A;  4PSJ A;  1OF5 A;  4LXR A;  4XSQ A;  4HVN A;  4J8T A;  2BMO B;  4HM3 B;  2QIY A;  3GRD A;  1ASK A;  4GB5 A;  4M7E C;  3FH1 A;  3F7X A;  3F40 A;  3HK4 A;  1DS9 A;  4FHO A;  4V2C A;  3OXA A;  1SQ0 B;  4PKI G;  4R09 A;  5FW5 A;  2OMY A;  5IEO A;  1H6U A;  1C7H A;  1FT8 A;  1W02 A;  4MQW X;  3A79 B;  4R1K A;  4NKG A;  4XBX A;  5D81 A;  3RW7 A;  4M7E A;  3F14 A;  1JB5 A;  1OOK G;  4N3V A;  4HM4 B;  4U7L A;  3RFJ A;  4U09 A;  4CNC A;  1JKG A;  3OX9 A;  1W8A A;  5AZ5 A;  2RGQ A;  3K7C A;  3CNM A;  3JUP A;  3NXJ A;  3RFE A;  3F9S A;  3OV4 A;  5AIF A;  2XRX B;  3G3A A;  3OWU A;  2CHC A;  2B1X B;  5BVB A;  2UZY A;  3K0Z A;  3FSD A;  4L8P A;  1OHP A;  1W00 A;  3NHX A;  4HM2 B;  5EVH A;  1LTX A;  1QYY A;  4LEH A;  3ZYJ A;  5IG3 A;  1QMA A;  3DZE A;  2IMJ A;  3WPG A;  4KVH A;  4QBZ A;  4K1V A;  4QXE A;  3VGN A;  3RJ0 A;  2RCD A;  4L7K A;  2Z7A A;  5AIG A;  5IG0 A;  3F8X A;  1JB4 A;  4Q3I A;  4AW4 A;  5IEN A;  3OJA B;  1O7M B;  3DUK A;  3OGK B;  2BMR B;  2GBX B;  5B4P A;  3EX9 A;  2R4I A;  3W3L A;  3EC9 A;  4XGO A;  3PMH G;  5CMP A;  5DRV A;  4HM7 B;  2WQV A;  2CKF B;  4I6J B;  4TZH A;  3OJA A;  4XB5 A;  2Z7X B;  4FDW A;  2Z63 A;  3EF8 A;  3FLJ A;  4ARR A;  1UUW B;  3EBY A;  2RA8 A;  1M0Z A;  3WN4 A;  3OWY A;  4RCW A;  5GMF A;  2Z7X A;  5B0T A;  5AEW B;  5GMG A;  2WFH A;  4Q53 A;  1NDO B;  2HMK B;  5GMH A;  5CF1 A;  2JE1 A;  3UL7 A;  3E99 A;  4R5C A;  1NU3 A;  3B8L A;  1ULJ B;  4R9K A;  5AIH A;  1KOH A;  4LSX C;  4J0M A;  3BLZ A;  3CPO A;  3B4O A;  3ULV A;  3Q90 A;  1O7G B;  1M10 B;  3UN9 A;  4CDL A;  1DFJ I;  1OHS A;  4HJL B;  2HMN B;  3SOA A;  2R9U A;  2BEX A;  1GWB A;  3E3Z A;  2OMU A;  2Z81 A;  5A5C A;  3A76 A;  1XEC A;  4FMZ A;  4HM8 B;  2QGU A;  4MN8 B;  1Q42 A;  2RR6 A;  4CP6 A;  3KZT A;  1AR0 A;  1M9S A;  2V9T B;  1K41 A;  1A9N A;  5KP1 A;  1E3R A;  4H3U A;  3EBT A;  3G06 A;  1FO1 A;  3UL9 A;  1OHO A;  5FTT B;  3WPB A;  2WQX A;  1GY6 A;  3SB4 A;  1S5A A;  2Z66 A;  3B4P A;  1GS3 A;  1WQL B;  3EN8 A;  4FD0 A;  2YFJ B;  2Z62 A;  5D3I A;  4OVM A;  5JPP A;  3FF2 A;  3M18 A;  3MSO A;  3JUM A;  3G8Z A;  4LSC A;  5AWB A;  3VQ1 A;  3JB9 j;  1M9L A;  4HM6 B;  3O53 A;  4Z61 C;  3DM8 A;  2HML B;  2PZV A;  6STD A;  4L3A A;  1GY7 A;  3W3J A;  3EJV A;  3C6N B;  1WWL A;  3LZA A;  2W2C A;  1OTN A;  3GWR A;  3ZYI A;  1O7P B;  2XR8 B;  4QC0 A;  3RFS A;  3WPF A;  4HKV B;  4CIL A;  5G2G A;  2FT3 A;  3ZYO A;  4WYK B;  2WQU A;  4V2D A;  1A2K A;  1NWW A;  2GEX A;  5GS2 B;  4Q3G A;  3NM2 A;  5HGR A;  1EG9 B;  3G3B A;  1VZZ A;  3G39 A;  4LI1 A;  4R08 A;  1E97 A;  4C2A B;  2I9W A;  4Z94 G;  1JN5 B;  3KSP A;  2P1O B;  3G0K A;  3FGY A;  5GS0 A;  1IDP A;  2HMM B;  4HQ1 A;  4ORL A;  3S5C A;  4L3F A;  4V2E A;  1GY5 A;  2AST B;  5AWC A;  3T8U A;  4GLP A;  1O6V A;  4XM4 A;  4CC4 C;  3W3N A;  5IER A;  1W6Y A;  4XDW A;  2XOT A;  3STD A;  5AI1 A;  2V70 A;  4H09 A;  3WPH A;  2OMT A;  3CNX A;  3O6N A;  1W01 A;  3VQ2 A;  1IO0 A;  3W3K A;  1D0B A;  4RCA B;  1P8V A;  3MG2 A;  3MHE A;  5CF2 A;  2INX A;  2IFG A;  2GXF A;  4CC4 A;  4LXS A;  2Y5Q A;  1DMQ A;  3CU3 A;  3F7S A;  5IG5 A;  4G8A A;  8CHO A;  5HDH A;  3SED A;  4R9L A;  4Z64 C;  4WP6 A;  1O6S A;  5KP4 A;  2A0Z A;  3ULA A;  4KNG A;  3H3H A;  5AWA A;  2STD A;  3OGL B;  4P8S A;  5STD A;  1K5G C;  5CXO A;  5GQR K;  3EQQ B;  3TSR E;  3MKI A;  4HM0 B;  3ROB A;  4OUQ A;  4R0A A;  4K1U A;  4RWT C;  3RGX A;  1OGX A;  3CIG A;  4WWU C;  4B8C D;  1TUH A;  4Q62 A;  2ELL A;  1FQV A;  2GEY A;  1OTO A;  1O7W B;  4EZG A;  5IJB A;  3NV0 B;  3EHC A;  4BV4 R;  2XSO B;  3RW6 A;  3DMC A;  2UZX A;  4R5D A;  2OMW A;  3EN1 B;  1OPY A;  2UX0 A;  4LSX A;  1ZX2 A;  4U06 A;  4STD A;  4R6J A;  4FCM A;  3NV0 A;  3G16 A;  3UJM A;  1CQS A;  3GZR A;  4J9A A;  3D9R A;  1SJW A;  2V9S A;  3NBR A;  4PQ8 A;  5IEP A;  2CA6 A;  2ID5 A;  4X2H A;  3RGR A; 
#chains in the Genus database with same CATH topology
 3LTC A;  5IF6 A;  3PXM A;  1BRI A;  4AY9 X;  4KT3 B;  1D6U A;  1I2E A;  1VQ4 3;  2CFW A;  1OF5 B;  4K90 B;  1O6T A;  5IJC A;  2OMV A;  1OH0 A;  3T8N A;  1BNG A;  4ECN A;  3CC7 3;  1XCD A;  1ISK A;  5D82 A;  1UW1 A;  5I97 A;  1W6G A;  1BNS A;  1K8A 4;  3VSY A;  1NJI 4;  3K63 A;  4AEQ A;  2O6R A;  2HMJ B;  2WGQ A;  3I55 3;  1Z7X W;  1QAF A;  2GSP A;  1US1 A;  5LFN A;  2D1W A;  2V1L A;  3I0Y A;  2BNG A;  2UGI A;  1GYB A;  2CFD A;  2KXG A;  4CJN A;  1ZGX A;  1B2M A;  2J8X B;  3KKG A;  1V57 A;  4HZ9 B;  3HX8 A;  2O6Q A;  2O3O A;  1XKU A;  3LOY A;  4LGQ A;  1QJG A;  1FGO A;  1B2Z A;  2Z65 A;  1JB2 A;  1VQQ A;  2P09 A;  1G9U A;  3E2J A;  2D42 A;  5CMN A;  2Z76 A;  1QAL A;  4KFE A;  1YJ9 3;  3ZG5 A;  4JF8 A;  4NKH A;  3UNL A;  1BIR A;  2XF3 A;  1HYF A;  3WHO A;  3GOZ A;  5KP3 A;  4U13 A;  2BNH A;  4FCJ A;  1BU4 A;  3P72 A;  1OTM A;  1ROA A;  1OGZ A;  1YNV X;  2P1M B;  1IV7 A;  1BRS A;  1W2B 2;  4R4K A;  1MGR A;  1JRQ A;  1K28 A;  3UL6 A;  4BSR A;  3CCM 3;  2OTL 3;  1JL5 A;  3JUO A;  3RGA A;  2R41 A;  1IVX A;  4XSQ A;  4HVN A;  4HM3 B;  3FH1 A;  2WOF A;  1CYU A;  4V2C A;  3OXA A;  1SQ0 B;  4R09 A;  1G02 A;  5IEO A;  1H6U A;  1RCK A;  4R80 A;  1VQ7 3;  4M7E A;  3AMO A;  1OOK G;  4U7L A;  1BNE A;  4BTX A;  1W8A A;  3K7C A;  3WOF B;  3RFE A;  3F9S A;  3NM7 A;  2FXT A;  3G3A A;  4CPK A;  4L8P A;  3NHX A;  1QYY A;  3X42 A;  1QMA A;  3DZE A;  1GOY A;  4KVH A;  4EV2 A;  4QXE A;  1LOW A;  3RJ0 A;  4L7K A;  3Q1C A;  5AIG A;  3CD6 3;  5IEN A;  4BTW A;  1O7M B;  3OGK B;  2BMR B;  2GBX B;  3EC9 A;  2WQV A;  1WMN A;  2CKF B;  1W7C A;  4FDW A;  3O8Y A;  1N9J A;  3EBY A;  2RA8 A;  3CCS 3;  1KC8 4;  3CCR 3;  4RNY A;  5B0T A;  2WFH A;  1HU9 A;  1LNI A;  1BSB A;  3UL7 A;  3KSE D;  4R5C A;  1TU5 A;  3B8L A;  3L0R A;  1KOH A;  3EE1 A;  1BRG A;  3B4O A;  1O7G B;  1W6C A;  1RGK A;  1M10 B;  2E2U A;  2YX9 A;  1GMR A;  1DFJ I;  1RGC A;  3CCU 3;  1GWB A;  4AKZ A;  2Z81 A;  4NPB A;  1M1X B;  3A76 A;  4HM8 B;  2JDI H;  3KZT A;  1AR0 A;  3BU4 A;  3KFQ C;  2XGL A;  2WQX A;  4N6L A;  3LT8 A;  2Z66 A;  1WQL B;  5A0O B;  1I0V A;  5D3I A;  3WOD G;  1YJN 3;  3G8Z A;  2MC8 A;  5AWB A;  3D5I A;  1UGH I;  3FG3 A;  4HM6 B;  4Z61 C;  1I2F A;  1C54 A;  2H0I A;  4MMZ B;  1VQ5 3;  1UI8 A;  2P0X A;  1RCL A;  2CK3 H;  2W2C A;  1WTH A;  3ZYI A;  1O7P B;  3QK9 A;  4BU4 A;  3RFS A;  4O02 B;  2FT3 A;  1FGT A;  3ZYO A;  4WYK B;  4V2D A;  1NWW A;  1HZ1 A;  1E97 A;  4C2A B;  2I9W A;  1IDP A;  1WMP A;  3LML A;  1GSP A;  4ILF A;  1IQY A;  3S5C A;  1S72 3;  1GY5 A;  2AST B;  1NB3 I;  1VQ6 3;  1GD4 A;  4CC4 C;  1T5Y A;  1RDS A;  1W6Y A;  4EXR A;  2OMT A;  2CWV A;  3NX0 A;  1W01 A;  2SAR A;  3MG2 A;  5CF2 A;  1LQG C;  1W5Z A;  4LXS A;  4G8A A;  2K0M A;  3SED A;  4WP6 A;  5KP4 A;  2A0Z A;  4KNG A;  3H3H A;  5AWA A;  2STD A;  1TFK A;  1K5G C;  3OW2 2;  4O8S A;  3MKI A;  4HM0 B;  4OUQ A;  3ROB A;  2Y73 A;  3V98 A;  3RGX A;  4RWT C;  4WWU C;  3AHS A;  1FQV A;  1FYS A;  2GEY A;  4EZG A;  2QEX 3;  2XSO B;  4R5D A;  1IVW A;  1ZX2 A;  4U06 A;  1T2H A;  2E2T A;  1CQS A;  4J9A A;  3N54 B;  3LT9 A;  2ID5 A;  1TRQ A;  1BSC A;  4N6O B;  1JJ2 2;  4FCZ A;  2C4B A;  1H6T A;  3X3X A;  2P05 A;  4R6G A;  2IA7 A;  1W2Z A;  1YIT 3;  3GZB A;  3MYT A;  3DXO A;  1QVG 2;  1VQK 3;  1RMS A;  1IVU A;  3FKA A;  2YFL B;  4R07 A;  1DMN A;  3BB9 A;  3KJ4 A;  3LYG A;  2IYJ A;  5IJD A;  5LC6 A;  3LXU X;  3FZW A;  2JQD A;  4EC6 A;  3HIG A;  5D83 A;  1IV9 A;  4X2O A;  4U08 A;  3KN4 A;  3FG4 A;  4NHF A;  1FGQ A;  3N9H A;  1O7H B;  2A15 A;  4P91 A;  1OCV A;  4LYL B;  3OWS A;  1VQP 3;  1BNF A;  1Q81 4;  2ASS B;  4BL2 A;  4O2H A;  3GZY B;  1IYY A;  2M7O A;  2CG1 A;  3WMD A;  2Y74 A;  3JUN A;  3OGM B;  3FG1 A;  3DZL A;  4BSU A;  2KRT A;  1STD A;  1BNJ A;  1TRP A;  3ER7 A;  5IW9 A;  1FS2 A;  3CVR A;  4J5G A;  3W3G A;  2KAA A;  4HM5 B;  2WO0 A;  2KF6 A;  1AVL A;  2F86 B;  3WA2 X;  3GZX B;  5AYS C;  3ECF A;  2Z77 A;  1YRG A;  1JZD A;  2XFS A;  7RNT A;  5ELJ A;  1A4Y A;  4OQT A;  1Q9E A;  3SYU A;  1ZO2 A;  1QAK A;  3PCS A;  2GBW B;  2W03 A;  3WPE A;  1PGV A;  4ZM8 A;  1P8T A;  5IYX C;  3D3L A;  1ZS7 A;  1EQK A;  3C6O B;  4R58 A;  4K61 A;  2O6S A;  3MG1 A;  4YEB B;  3E4G A;  4XDV A;  1X1U A;  2CX0 A;  3BZ5 A;  3SXX A;  1X1Y A;  1G0T A;  3BNE A;  3DGN A;  4LMI A;  2BMQ B;  3HOH A;  2XSH B;  3SVA A;  3UL8 A;  1BUJ A;  4FMC A;  1MGW A;  2JQ5 A;  4XBY A;  9RNT A;  1FGR A;  3WPD A;  2CW9 A;  5CK6 A;  1BSD A;  3WOE B;  1VQM 3;  7STD A;  1U0N D;  1AVK A;  4GT6 A;  3V99 A;  2OOV A;  3Q3F A;  3HZP A;  4IIA A;  1OF5 A;  3A5E A;  3GRD A;  4M7E C;  1PY3 A;  2OTJ 3;  1C7H A;  1BNI A;  4MQW X;  1IVV A;  4NKG A;  3F14 A;  2BHM A;  1JB5 A;  4N3V A;  6RNT A;  3KII A;  4HM4 B;  3CPW 2;  3CCE 3;  1Q7Y 4;  5AZ5 A;  2RGQ A;  5EQL A;  5AIF A;  2XRX B;  3OWU A;  3CCJ 3;  2KF4 A;  2CFK A;  3K0Z A;  1L5G B;  3FSD A;  1RJO A;  1OHP A;  2ZA4 A;  1W00 A;  5EVH A;  3ZYJ A;  5IG3 A;  2CFL A;  2W0Q A;  2IUJ A;  1IU7 A;  2RCD A;  3T0U A;  1RGG A;  5EEO A;  3OJA B;  5B4P A;  2R4I A;  1FGM A;  5DRV A;  4HM7 B;  4I6J B;  1RGA A;  3OJA A;  4TZH A;  1BRH A;  7GSP A;  4ARR A;  1DET A;  1UUW B;  1RTU A;  2LYX A;  5GMG A;  4HBR A;  1LRA A;  3S28 A;  3D79 A;  1RRH A;  1N5P A;  2JE1 A;  3DGM A;  1BGS A;  3E99 A;  1B27 A;  1ULJ B;  4LSX C;  3ULV A;  1GMQ A;  2KF3 A;  4CDL A;  1LXE A;  1OHS A;  3ZG0 A;  2W9P A;  3NQY A;  1OAC A;  2HMN B;  3SOA A;  1JZO A;  1JBS A;  3KCH A;  1MWR A;  2OMU A;  4N6V 0;  1T2I A;  4MN8 B;  1Q42 A;  3X3Y A;  2V9T B;  1K41 A;  4H3U A;  2RBI A;  3G06 A;  3UL9 A;  1UGI A;  2FNQ A;  3B4P A;  4FD0 A;  3S27 A;  2YFJ B;  3CXC 2;  1SII A;  2W6J H;  1W4N A;  1RSN A;  3M18 A;  3MSO A;  4X2H A;  4LSC A;  3JB9 j;  3O53 A;  1IK3 A;  3X40 A;  4L3A A;  1GY7 A;  4BTY A;  4FMD A;  3LZA A;  1LOX A;  1OTN A;  2XR8 B;  4QC0 A;  3GAX A;  4CIL A;  2GEX A;  5GS2 B;  3MPH A;  1YVB I;  3G3B A;  3G39 A;  3CME 3;  1FUW A;  3X3Z A;  4NZT M;  1JN5 B;  2E2V A;  3KSP A;  2P1O B;  4HQ1 A;  4V2E A;  1EKM A;  1MWT A;  4GLP A;  2BU4 A;  2XOT A;  3STD A;  4HAA A;  3U97 A;  3WPH A;  1GOV A;  3VQ2 A;  4H61 A;  3W3K A;  3HII A;  1P8V A;  3MHE A;  3BNC A;  4GHO A;  3LTB A;  4GL6 A;  1BRN L;  3LTD A;  3IMA B;  5IG5 A;  8CHO A;  5HDH A;  4Z64 C;  1O6S A;  4KFD A;  1N8R 4;  4OK0 A;  5GQR K;  5CXO A;  3EQQ B;  1OGX A;  1NNV A;  2RSX A;  4B8C D;  1MOL A;  2GU3 A;  1OTO A;  3NV0 B;  3RW6 A;  3DMC A;  1STF I;  1F8N A;  1YVS A;  4LSX A;  2PNC A;  3DY5 A;  1QVF 2;  1NB5 I;  1UUG B;  4R6J A;  3NV0 A;  1B2X A;  2XEP A;  3GZR A;  1SJW A;  2V9S A;  4PQ8 A;  2CX1 A;  1LOV A;  5AEU B;  1Y4K A;  3M8C A;  1RLS A;  4DKI A;  2P1P B;  5CLK A;  5RNT A;  5JBS A;  3X41 A;  1BSE A;  1KWI A;  4AKY A;  1B20 A;  1BOX A;  3JUQ A;  1JKG B;  1XWD C;  4XOS A;  1XEU A;  2BO9 B;  3ULU A;  4RZM A;  1TFO A;  2C11 A;  2WGO A;  3UB1 A;  4FMB A;  1IQ8 A;  2GU1 A;  4WYK A;  5HZL B;  3NUV A;  1YHQ 3;  2P1N B;  4Y61 B;  3CIY A;  1A90 A;  4XBT A;  2P1Q B;  3CCV 3;  2Q4G W;  1CEW I;  1FA3 A;  2OMX A;  4K17 A;  4I5Q A;  3REZ A;  1ZIW A;  3W3M A;  2KCD A;  4J4L A;  1K5D C;  2MF7 A;  4MMX B;  4EW5 A;  1A67 A;  2QA4 3;  4LSA A;  4N6U A;  3FXI A;  4MJD A;  2CWU A;  4HZB B;  2HOH A;  3NBJ A;  2RNT A;  3IPT A;  1AQZ A;  4KXF B;  4FS7 A;  5JPU A;  1Z1S A;  2CG0 A;  1JV2 B;  2B24 B;  2YFI B;  4R6F A;  4Z8G A;  4PEJ A;  1LQM B;  1I8V A;  3WR2 A;  2WQW A;  4LSO A;  3D4A A;  1OGQ A;  4ECO A;  4J5K A;  4WP5 A;  1D6Y A;  3MG3 A;  4EV5 A;  3RIZ A;  3BIR A;  5HOH A;  2Z64 A;  3G04 C;  2OOV C;  4RNZ A;  3QRD A;  1RRL A;  1Q82 4;  1FUT A;  1HKX A;  1X1W A;  5TGN A;  4NZR M;  3FF0 A;  1DMM A;  4PER A;  2F5W A;  4HM1 B;  1FW7 A;  1AV4 A;  1MWU A;  1ROV A;  4J8T A;  1PYL A;  1ASK A;  3F7X A;  3F40 A;  1DS9 A;  2IUK A;  1EUI C;  5FW5 A;  1FT8 A;  1W02 A;  4HYZ A;  1RN7 A;  2WOH A;  4R1K A;  4XBX A;  5D81 A;  3RW7 A;  1X1X A;  1CYV A;  2OCT A;  4CNC A;  3OX9 A;  1NO3 A;  3JUP A;  3OV4 A;  5BVB A;  2UZY A;  1T3B A;  4BL3 A;  1JBT A;  4HM2 B;  4LEH A;  3VF1 A;  4FR9 A;  3HI7 A;  5IG0 A;  3F8X A;  1JB4 A;  1WMO A;  4NRE A;  1TIJ A;  4AW4 A;  1RNT A;  1V58 A;  1DVC A;  2Z6B A;  3LH4 A;  5M1A A;  3DH2 A;  3EX9 A;  3PZW A;  3W3L A;  5LC7 A;  4WFO A;  2FGT A;  1BRK A;  5CMP A;  4XB5 A;  2Z63 A;  4N6M A;  3FLJ A;  3WA3 A;  2W56 B;  1M0Z A;  3OWY A;  4RCW A;  5GMF A;  5AEW B;  1JNQ A;  1NDO B;  2HMK B;  1AY7 A;  1LVN A;  4N6N B;  5GMH A;  5CF1 A;  5FGO A;  1I2G A;  1FUS A;  4FMA A;  5AYR B;  4R9K A;  5AIH A;  4J0M A;  3Q90 A;  3GSP A;  1LOY A;  1TTO A;  3UN9 A;  3S67 A;  4HJL B;  2BEX A;  1YIJ 3;  1UCK A;  3I56 3;  3E3Z A;  4RBN A;  4FMZ A;  2QGU A;  4CP6 A;  2F5M A;  3DGO A;  5KP1 A;  1E3R A;  1FO1 A;  5GSP A;  1GY6 A;  3SB4 A;  2W04 A;  1S5A A;  5ELU A;  3PGB A;  5M18 A;  4OVM A;  5JPP A;  1R4Y A;  4O3V A;  3VQ1 A;  4LZI A;  3DM8 A;  3BND A;  2PZV A;  1RGL A;  6STD A;  3LTA A;  3EJV A;  3UL5 A;  1J2B A;  2F56 A;  3G4S 3;  1UI7 A;  3CCQ 3;  3WPF A;  5G2G A;  2WQU A;  1EG9 B;  1U8C B;  3ALA A;  1VZZ A;  4R08 A;  3JVC A;  4Z94 G;  2CIU A;  3G0K A;  3FGY A;  5GS0 A;  2HMM B;  4ORL A;  4L3F A;  3T8U A;  5G1L A;  5IER A;  4XDW A;  5AI1 A;  2ZL8 A;  3CNX A;  2ZHX B;  3O6N A;  1IO0 A;  2BT3 A;  4IT7 A;  4RCA B;  3Q2P A;  2IFG A;  1A2V A;  3URP A;  1DMQ A;  3F7S A;  1B3S A;  3OGL B;  1V74 A;  4P8S A;  1RN4 A;  5STD A;  1I3I A;  3TSR E;  4R0A A;  4K1U A;  3CIG A;  1PU4 A;  1TUH A;  1VQ8 3;  1O7W B;  5IJB A;  1R4C A;  2OQE A;  1K73 4;  1GD3 A;  3EN1 B;  1OPY A;  5M19 A;  2UX0 A;  2C10 A;  4STD A;  3WDG B;  3G16 A;  3D9R A;  3NBR A;  2RFR A;  3IJE B;  1EA2 A;  1IT8 A;  5DRE A;  4Z79 A;  5AWD A;  5IG4 A;  2OWP A;  1RKY A;  4N6T A;  3E6J A;  2F98 A;  2K54 A;  1TP6 A;  4CCV A;  3SOY A;  4I4K A;  3M19 A;  2F99 A;  4HOH A;  3AMO B;  3H51 A;  4LI2 A;  4C2B B;  6GSP A;  1E3V A;  2XWT C;  3J7Y d;  2H0H A;  1BVI A;  2JE0 A;  1EEJ A;  4L8O A;  4UFR A;  1M1K 4;  5AII A;  1P9A G;  1IQX A;  1SQW A;  1SPU A;  1DYU A;  1BNR A;  3B7C A;  1VQN 3;  1OZN A;  2XGN A;  1KOO A;  1JN5 A;  1UCL A;  4BSS A;  2CWT A;  2Z82 A;  4QWT A;  1KSI A;  4PEQ B;  5BXQ A;  4JRF A;  1DCE A;  3WPC A;  2OMZ A;  3F8H A;  1UUV B;  1BUQ A;  4IM6 A;  3AHW A;  1SIH A;  1M90 4;  1UCI A;  1FZU A;  2F4Y A;  3WPI A;  3ZYN A;  3TDG A;  1U5O A;  1RGH A;  1OUN A;  2AAD A;  1I70 A;  2UUG C;  1Q40 B;  3AGN A;  2IY2 A;  3AGO A;  1KQS 2;  4CNM A;  4RNT A;  2HMO B;  3C6P B;  1Q40 A;  5B0N A;  3SLU A;  3G6E 3;  3NQZ A;  3D5G A;  3FCS B;  1ULI B;  1I0X A;  4ARN A;  1B2S A;  4R6A A;  2CFG A;  2ZDJ A;  3RGZ A;  4KT1 A;  1O7N B;  1DVD A;  1RGE A;  1PFP A;  1B21 A;  3KE7 A;  4PSJ A;  5BU4 A;  4LXR A;  2BMO B;  2QIY A;  1YJW 3;  4GB5 A;  3HK4 A;  1CH0 A;  1LNH A;  4FHO A;  2BIR A;  4EYC A;  3K5T A;  4PKI G;  4IPB A;  2Q07 A;  2OMY A;  3A79 B;  3CC2 3;  1RN1 A;  3RFJ A;  1A2P A;  4U09 A;  1N5H A;  1JKG A;  1RHL A;  5G1K A;  1KD1 4;  3CNM A;  3NXJ A;  5BIR A;  1BAO A;  2CHC A;  2B1X B;  1WNH A;  1UDI I;  1LTX A;  2IMJ A;  3WPG A;  4QBZ A;  4K1V A;  3MWZ A;  3VGN A;  4TX4 A;  4WHA A;  2Z7A A;  8RNT A;  1VQL 3;  4Q3I A;  2L4V A;  4MMY B;  4BIR A;  3DUK A;  1TJD A;  3NBB A;  1RNB A;  3BNB A;  4XGO A;  3PMH G;  3N8B A;  2Z7X B;  3EF8 A;  2W9Q A;  1N8Q A;  2L1S A;  3RDE A;  1YI2 3;  3CMA 3;  1JBR A;  1DE3 A;  3WN4 A;  1MNL A;  2Z7X A;  1BAN A;  4GSP A;  4Q53 A;  4KFF A;  3RNT A;  1NU3 A;  3BLZ A;  3CPO A;  1IT7 A;  1MWS A;  2R9U A;  1SAR A;  2H0G A;  1D6Z A;  5A5C A;  3G71 3;  1BRJ A;  1XEC A;  3DGY A;  2RR6 A;  1M9S A;  1A9N A;  3EBT A;  3S29 A;  1OHO A;  2ML6 A;  5FTT B;  3WPB A;  1GS3 A;  3EN8 A;  2Z62 A;  2P0M A;  1BSA A;  1I3F A;  1VQ9 3;  3CC4 3;  2ML5 A;  3FF2 A;  3JUM A;  3PS8 A;  1M9L A;  2HML B;  1B2U A;  2KF5 A;  3W3J A;  2XFT A;  3C6N B;  1WWL A;  2XH9 A;  3GWR A;  3U1W A;  4HKV B;  1A2K A;  1YGW A;  1GOU A;  4Q3G A;  3NM2 A;  5HGR A;  1N9E A;  4LI1 A;  3SX1 A;  1Q86 4;  5AWC A;  2LQV A;  1O6V A;  4XM4 A;  3W3N A;  1M9G A;  1RGF A;  2V70 A;  4H09 A;  2CC3 A;  1D0B A;  2INX A;  4CC4 A;  2GXF A;  3CCL 3;  1VQO 3;  2Y5Q A;  3CU3 A;  2SBL A;  2AAE A;  4R9L A;  3ULA A;  1K9M 4;  4KZ1 A;  1Q7H A;  2CH9 A;  2P38 A;  2W56 A;  2OQE C;  4Q62 A;  2ELL A;  2K3D A;  4MEI A;  4BV4 R;  3EHC A;  3V92 A;  1G96 A;  1UCJ A;  3PYJ A;  2UZX A;  2O9U X;  3EB8 A;  3ZFZ A;  4EBG A;  2OMW A;  1GMP A;  4FCM A;  3DGL A;  3UJM A;  4G1M B;  3PCR A;  3K9M C;  5IEP A;  2CA6 A;  4FCG A;  1YGE A;  3RGR A; 
#chains in the Genus database with same CATH homology
 1JJ2 2;  2RFR A;  5AEU B;  3IJE B;  4FCZ A;  1Y4K A;  3M8C A;  3LTC A;  1EA2 A;  1H6T A;  3X3X A;  2P05 A;  4R6G A;  2IA7 A;  5IF6 A;  3PXM A;  1W2Z A;  1YIT 3;  2P1P B;  1IT8 A;  3GZB A;  3MYT A;  5DRE A;  4AY9 X;  1D6U A;  5CLK A;  4Z79 A;  3DXO A;  5IG4 A;  1VQ4 3;  1QVG 2;  2CFW A;  5AWD A;  2OWP A;  1RKY A;  1VQK 3;  1OF5 B;  1IVU A;  3FKA A;  4N6T A;  4K90 B;  5JBS A;  3E6J A;  2YFL B;  3X41 A;  2F98 A;  4R07 A;  1DMN A;  1TP6 A;  2K54 A;  4CCV A;  1O6T A;  3BB9 A;  3SOY A;  4I4K A;  3KJ4 A;  3M19 A;  2F99 A;  3LYG A;  1KWI A;  5IJC A;  5IJD A;  5LC6 A;  3LXU X;  3FZW A;  2JQD A;  4EC6 A;  3HIG A;  5D83 A;  1IV9 A;  4X2O A;  4AKY A;  4U08 A;  3KN4 A;  3FG4 A;  4NHF A;  1FGQ A;  2OMV A;  3AMO B;  1OH0 A;  1O7H B;  2A15 A;  3N9H A;  4P91 A;  1OCV A;  3OWS A;  1VQP 3;  3H51 A;  3JUQ A;  3T8N A;  1JKG B;  1XWD C;  4ECN A;  4LI2 A;  3CC7 3;  4XOS A;  1XEU A;  2BO9 B;  3ULU A;  4C2B B;  1Q81 4;  1XCD A;  2ASS B;  1E3V A;  1ISK A;  4RZM A;  4FCG A;  1TFO A;  4O2H A;  5D82 A;  2XWT C;  3J7Y d;  1UW1 A;  5I97 A;  3GZY B;  1W6G A;  2M7O A;  2CG1 A;  2C11 A;  3WMD A;  1K8A 4;  2WGO A;  2Y74 A;  4FMB A;  3UB1 A;  3VSY A;  3JUN A;  2JE0 A;  1NJI 4;  1IQ8 A;  4L8O A;  2GU1 A;  3K63 A;  1M1K 4;  4WYK A;  5AII A;  3NUV A;  4AEQ A;  1YHQ 3;  1P9A G;  3OGM B;  5HZL B;  1IQX A;  2O6R A;  3FG1 A;  1SQW A;  3DZL A;  2P1N B;  4Y61 B;  2KRT A;  4BSU A;  1SPU A;  2HMJ B;  1DYU A;  1STD A;  2WGQ A;  3B7C A;  3I55 3;  1VQN 3;  1A90 A;  3CIY A;  1OZN A;  3ER7 A;  2XGN A;  4XBT A;  1JN5 A;  5IW9 A;  1KOO A;  1FS2 A;  1Z7X W;  1QAF A;  2P1Q B;  3CCV 3;  3CVR A;  2Q4G W;  3W3G A;  1CEW I;  1US1 A;  5LFN A;  2D1W A;  2V1L A;  4HM5 B;  2WO0 A;  1FA3 A;  4BSS A;  3I0Y A;  2OMX A;  2BNG A;  4K17 A;  1AVL A;  3REZ A;  1ZIW A;  3W3M A;  2F86 B;  1GYB A;  2CWT A;  2KCD A;  3GZX B;  5AYS C;  3ECF A;  3WA2 X;  2CFD A;  1K5D C;  2MF7 A;  4MMX B;  2KXG A;  4QWT A;  1KSI A;  1A67 A;  2Z77 A;  2QA4 3;  1YRG A;  4LSA A;  2XFS A;  3KKG A;  4PEQ B;  4N6U A;  3FXI A;  4MJD A;  4HZ9 B;  2CWU A;  3HX8 A;  5BXQ A;  4HZB B;  2O6Q A;  4JRF A;  5ELJ A;  1DCE A;  2O3O A;  3WPC A;  1XKU A;  3LOY A;  2OMZ A;  3F8H A;  3NBJ A;  4LGQ A;  1UUV B;  1BUQ A;  1A4Y A;  1QJG A;  1FGO A;  3IPT A;  4OQT A;  4IM6 A;  1ZO2 A;  1M90 4;  1SIH A;  2Z65 A;  1QAK A;  4KXF B;  1JB2 A;  3PCS A;  5JPU A;  2Z82 A;  4FS7 A;  2P09 A;  2GBW B;  1G9U A;  1Z1S A;  2CG0 A;  2W03 A;  3E2J A;  4UFR A;  3WPE A;  3WPI A;  1PGV A;  3TDG A;  2D42 A;  1U5O A;  3ZYN A;  5CMN A;  4ZM8 A;  1JV2 B;  2Z76 A;  1P8T A;  1QAL A;  3D3L A;  4KFE A;  1YJ9 3;  5IYX C;  1OUN A;  2B24 B;  1EQK A;  2YFI B;  4R6F A;  4Z8G A;  3C6O B;  4PEJ A;  1Q40 B;  4R58 A;  4K61 A;  2O6S A;  3MG1 A;  4YEB B;  3E4G A;  4JF8 A;  4XDV A;  1KQS 2;  4NKH A;  2WQW A;  3BZ5 A;  3SXX A;  3UNL A;  4LSO A;  4CNM A;  2HMO B;  1OGQ A;  3BNE A;  3DGN A;  4LMI A;  4ECO A;  3C6P B;  2BMQ B;  1Q40 A;  5B0N A;  2XSH B;  3SLU A;  2XF3 A;  4WP5 A;  3G6E 3;  3GOZ A;  3SVA A;  1D6Y A;  3MG3 A;  3NQZ A;  5KP3 A;  4EV5 A;  3UL8 A;  4U13 A;  4FMC A;  3RIZ A;  3FCS B;  2JQ5 A;  1ULI B;  2BNH A;  4XBY A;  4ARN A;  1FGR A;  2Z64 A;  4R6A A;  4FCJ A;  2CFG A;  3WPD A;  3G04 C;  2OOV C;  2CW9 A;  3P72 A;  1OTM A;  2ZDJ A;  4RNZ A;  5CK6 A;  1ROA A;  3RGZ A;  1OGZ A;  2P1M B;  4KT1 A;  1IV7 A;  1O7N B;  3QRD A;  1RRL A;  1DVD A;  3WOE B;  1VQM 3;  7STD A;  1W2B 2;  1U0N D;  1AVK A;  1Q82 4;  4GT6 A;  1HKX A;  4R4K A;  3V99 A;  5TGN A;  1PFP A;  1JRQ A;  1DMM A;  1K28 A;  3FF0 A;  2OOV A;  4PER A;  4HM1 B;  3KE7 A;  3UL6 A;  4BSR A;  3HZP A;  1AV4 A;  3CCM 3;  2OTL 3;  1JL5 A;  4IIA A;  3JUO A;  3RGA A;  4PSJ A;  1OF5 A;  1ROV A;  4LXR A;  1IVX A;  4XSQ A;  4HVN A;  4J8T A;  2BMO B;  4HM3 B;  2QIY A;  3GRD A;  1ASK A;  4GB5 A;  1YJW 3;  4M7E C;  3FH1 A;  3F7X A;  3F40 A;  3HK4 A;  2WOF A;  1LNH A;  1DS9 A;  4FHO A;  1CYU A;  4EYC A;  4V2C A;  3K5T A;  2IUK A;  3OXA A;  1SQ0 B;  4PKI G;  2OTJ 3;  4R09 A;  5FW5 A;  4IPB A;  2Q07 A;  2OMY A;  5IEO A;  1H6U A;  1C7H A;  1FT8 A;  1W02 A;  4HYZ A;  1RN7 A;  4MQW X;  1IVV A;  2WOH A;  4R1K A;  4R80 A;  1VQ7 3;  3A79 B;  4XBX A;  5D81 A;  3CC2 3;  4NKG A;  3RW7 A;  4M7E A;  3F14 A;  2BHM A;  3AMO A;  1JB5 A;  1OOK G;  1CYV A;  4N3V A;  3KII A;  4HM4 B;  4U7L A;  2OCT A;  3RFJ A;  4U09 A;  4CNC A;  1N5H A;  3CPW 2;  3CCE 3;  1JKG A;  4BTX A;  3OX9 A;  1W8A A;  1Q7Y 4;  5AZ5 A;  2RGQ A;  5EQL A;  1NO3 A;  1KD1 4;  3K7C A;  3WOF B;  3CNM A;  3JUP A;  3NXJ A;  3RFE A;  3F9S A;  3NM7 A;  3OV4 A;  2FXT A;  5AIF A;  2XRX B;  3G3A A;  3OWU A;  3CCJ 3;  4J4L A;  2CHC A;  2B1X B;  5BVB A;  2UZY A;  2CFK A;  3K0Z A;  1L5G B;  3FSD A;  1RJO A;  4L8P A;  1OHP A;  1WNH A;  1W00 A;  3NHX A;  4HM2 B;  5EVH A;  1LTX A;  1QYY A;  4LEH A;  3X42 A;  3ZYJ A;  5IG3 A;  1QMA A;  3DZE A;  3VF1 A;  2IMJ A;  2CFL A;  3WPG A;  2W0Q A;  4FR9 A;  4KVH A;  4EV2 A;  2IUJ A;  1IU7 A;  4QBZ A;  4K1V A;  4QXE A;  3MWZ A;  3VGN A;  3RJ0 A;  2RCD A;  4L7K A;  3Q1C A;  3HI7 A;  4TX4 A;  4WHA A;  2Z7A A;  5AIG A;  5IG0 A;  3T0U A;  3CD6 3;  3F8X A;  1JB4 A;  1WMO A;  4NRE A;  1VQL 3;  4Q3I A;  2L4V A;  5EEO A;  4MMY B;  1TIJ A;  4AW4 A;  5IEN A;  4BTW A;  3OJA B;  1O7M B;  3DUK A;  1DVC A;  3OGK B;  2BMR B;  2GBX B;  3NBB A;  5B4P A;  2Z6B A;  3LH4 A;  3EX9 A;  3BNB A;  2R4I A;  1FGM A;  3PZW A;  3EC9 A;  5LC7 A;  4WFO A;  2FGT A;  4XGO A;  3PMH G;  3W3L A;  5CMP A;  5DRV A;  4HM7 B;  1WMN A;  2CKF B;  2WQV A;  4I6J B;  4TZH A;  3OJA A;  1W7C A;  4XB5 A;  3N8B A;  2Z7X B;  4FDW A;  2Z63 A;  4N6M A;  3EF8 A;  2W9Q A;  1N8Q A;  3FLJ A;  3WA3 A;  4ARR A;  3RDE A;  1YI2 3;  3CMA 3;  3O8Y A;  1N9J A;  1UUW B;  3EBY A;  2W56 B;  2RA8 A;  1M0Z A;  3WN4 A;  3CCS 3;  3OWY A;  2LYX A;  1MNL A;  1KC8 4;  3CCR 3;  4RNY A;  4RCW A;  2Z7X A;  5GMF A;  5B0T A;  5AEW B;  1JNQ A;  5GMG A;  2WFH A;  4Q53 A;  1NDO B;  2HMK B;  4HBR A;  1LVN A;  4N6N B;  3S28 A;  4KFF A;  5GMH A;  1RRH A;  1N5P A;  1HU9 A;  5CF1 A;  2JE1 A;  3DGM A;  5FGO A;  3UL7 A;  3E99 A;  3KSE D;  4R5C A;  4FMA A;  5AYR B;  1NU3 A;  1TU5 A;  3B8L A;  1ULJ B;  3L0R A;  4R9K A;  5AIH A;  1KOH A;  4LSX C;  3BLZ A;  3EE1 A;  4J0M A;  3CPO A;  3B4O A;  3ULV A;  3Q90 A;  1O7G B;  1W6C A;  1IT7 A;  1M10 B;  2E2U A;  2YX9 A;  3UN9 A;  4CDL A;  1DFJ I;  3S67 A;  1LXE A;  1OHS A;  2W9P A;  3NQY A;  1OAC A;  2HMN B;  4HJL B;  3SOA A;  3CCU 3;  2R9U A;  2BEX A;  1YIJ 3;  1GWB A;  3I56 3;  4AKZ A;  1D6Z A;  2OMU A;  2Z81 A;  4N6V 0;  3E3Z A;  5A5C A;  3G71 3;  4RBN A;  1M1X B;  3A76 A;  1XEC A;  4FMZ A;  4HM8 B;  2QGU A;  4MN8 B;  1Q42 A;  2RR6 A;  2JDI H;  3KZT A;  4CP6 A;  1AR0 A;  3X3Y A;  1M9S A;  2V9T B;  3DGO A;  1K41 A;  1A9N A;  5KP1 A;  1E3R A;  4H3U A;  3EBT A;  3G06 A;  1FO1 A;  3UL9 A;  3KFQ C;  2XGL A;  3S29 A;  1OHO A;  2ML6 A;  5FTT B;  3WPB A;  2WQX A;  1GY6 A;  3SB4 A;  2W04 A;  2FNQ A;  1S5A A;  4N6L A;  3LT8 A;  2Z66 A;  5ELU A;  3B4P A;  1GS3 A;  1WQL B;  3EN8 A;  3PGB A;  5A0O B;  4FD0 A;  3S27 A;  2YFJ B;  2Z62 A;  3CXC 2;  5D3I A;  2P0M A;  1SII A;  4OVM A;  5JPP A;  2W6J H;  1VQ9 3;  3CC4 3;  3WOD G;  1W4N A;  2ML5 A;  3FF2 A;  3M18 A;  3MSO A;  3JUM A;  1YJN 3;  3G8Z A;  4LSC A;  3PS8 A;  2MC8 A;  5AWB A;  4O3V A;  3VQ1 A;  3JB9 j;  1M9L A;  3FG3 A;  4HM6 B;  4LZI A;  1IK3 A;  3O53 A;  4Z61 C;  3DM8 A;  3BND A;  2HML B;  2PZV A;  3X40 A;  6STD A;  4L3A A;  1GY7 A;  3LTA A;  3W3J A;  2XFT A;  4MMZ B;  3EJV A;  1VQ5 3;  1UI8 A;  1WWL A;  3C6N B;  4BTY A;  4FMD A;  2XH9 A;  3LZA A;  2P0X A;  3UL5 A;  1J2B A;  2CK3 H;  3G4S 3;  2W2C A;  1LOX A;  1WTH A;  1OTN A;  1UI7 A;  3GWR A;  3ZYI A;  1O7P B;  2XR8 B;  3QK9 A;  4QC0 A;  3GAX A;  3U1W A;  4O02 B;  3CCQ 3;  3RFS A;  3WPF A;  4HKV B;  4CIL A;  5G2G A;  2FT3 A;  1FGT A;  3ZYO A;  4WYK B;  2WQU A;  4V2D A;  1A2K A;  1NWW A;  2GEX A;  5GS2 B;  4Q3G A;  3NM2 A;  3MPH A;  1YVB I;  1EG9 B;  1U8C B;  3ALA A;  1N9E A;  5HGR A;  1VZZ A;  3G3B A;  3G39 A;  4LI1 A;  3CME 3;  4R08 A;  1E97 A;  1FUW A;  3X3Z A;  3JVC A;  2I9W A;  4C2A B;  4Z94 G;  1JN5 B;  3SX1 A;  2E2V A;  3KSP A;  2P1O B;  2CIU A;  3G0K A;  3FGY A;  5GS0 A;  1IDP A;  1WMP A;  3LML A;  2HMM B;  1Q86 4;  4ORL A;  4HQ1 A;  1IQY A;  3S5C A;  4L3F A;  4V2E A;  1S72 3;  1EKM A;  1GY5 A;  2AST B;  1NB3 I;  1VQ6 3;  1GD4 A;  5AWC A;  2LQV A;  3T8U A;  4GLP A;  1O6V A;  4XM4 A;  4CC4 C;  1T5Y A;  3W3N A;  5IER A;  1M9G A;  1W6Y A;  4XDW A;  2XOT A;  3STD A;  5AI1 A;  3U97 A;  2V70 A;  4H09 A;  2CC3 A;  3WPH A;  4EXR A;  2OMT A;  2ZL8 A;  3CNX A;  2CWV A;  3NX0 A;  3O6N A;  1W01 A;  4H61 A;  3VQ2 A;  1IO0 A;  2BT3 A;  3W3K A;  4IT7 A;  1D0B A;  3Q2P A;  3HII A;  1P8V A;  4RCA B;  3MG2 A;  3BNC A;  3MHE A;  5CF2 A;  2INX A;  2IFG A;  2GXF A;  1A2V A;  4CC4 A;  3LTB A;  1W5Z A;  4GL6 A;  3CCL 3;  1VQO 3;  2Y5Q A;  4LXS A;  3LTD A;  1DMQ A;  3CU3 A;  3IMA B;  3F7S A;  5IG5 A;  4G8A A;  2K0M A;  8CHO A;  3SED A;  5HDH A;  2SBL A;  4R9L A;  4Z64 C;  4WP6 A;  1O6S A;  5KP4 A;  2A0Z A;  3ULA A;  4KFD A;  4KNG A;  1K9M 4;  3H3H A;  5AWA A;  4KZ1 A;  2STD A;  1N8R 4;  4OK0 A;  2CH9 A;  3OGL B;  1V74 A;  4P8S A;  2P38 A;  1TFK A;  5STD A;  1K5G C;  5CXO A;  3OW2 2;  4O8S A;  5GQR K;  3EQQ B;  3TSR E;  2W56 A;  2OQE C;  3MKI A;  4HM0 B;  4OUQ A;  3ROB A;  2Y73 A;  3V98 A;  4K1U A;  4RWT C;  4R0A A;  1OGX A;  3CIG A;  1PU4 A;  3RGX A;  2RSX A;  4WWU C;  4B8C D;  1MOL A;  1TUH A;  4Q62 A;  2ELL A;  1VQ8 3;  1FQV A;  2GEY A;  2GU3 A;  4MEI A;  1OTO A;  1O7W B;  2QEX 3;  4EZG A;  5IJB A;  3NV0 B;  3EHC A;  3V92 A;  4BV4 R;  1G96 A;  1R4C A;  2XSO B;  3RW6 A;  3DMC A;  3PYJ A;  2O9U X;  1STF I;  3EB8 A;  2OQE A;  4EBG A;  1K73 4;  2OMW A;  1GD3 A;  2UZX A;  1F8N A;  4R5D A;  3EN1 B;  1OPY A;  1IVW A;  2UX0 A;  2C10 A;  4LSX A;  1ZX2 A;  4U06 A;  2PNC A;  3DY5 A;  1QVF 2;  4STD A;  1NB5 I;  3WDG B;  4R6J A;  4FCM A;  3DGL A;  3NV0 A;  2E2T A;  3G16 A;  3UJM A;  1CQS A;  4G1M B;  2XEP A;  3PCR A;  3GZR A;  4J9A A;  3N54 B;  3D9R A;  1SJW A;  3LT9 A;  3NBR A;  3K9M C;  5IEP A;  2V9S A;  4PQ8 A;  2CA6 A;  2ID5 A;  4X2H A;  1YGE A;  4N6O B;  3RGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...