4WYKA

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
344
Chain Sequence
ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Nuclear RNA export factor 1
total genus 87
structure length 344
sequence length 347
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4wykA01
4XB5A 4PEQB 3WMDA 3RGRA 3HX8A 4FCJA 3C6NB 1OCVA 5GMHA 3F40A 3CIYA 4XSQA 3LZAA 1O6TA 1EG9B 3OWSA 3GZYB 2RFRA 1GS3A 1LTXA 4UFRA 3CPOA 3GZBA 4LI2A 5B4PA 2BNGA 5IG3A 5D3IA 4K1UA 1DS9A 1XECA 1W01A 1OTOA 1O7PB 1OTMA 3FLJA 2JQ5A 2GBXB 3SOAA 3ZYNA 1M0ZA 3MHEA 4J0MA 4X2OA 4R6FA 3K0ZA 3EHCA 3JUNA 3FF2A 4STDA 1E3RA 5HZLB 1A9NA 4R9KA 1OPYA 2W2CA 5AIGA 4M7EC 2CHCA 3OWUA 5D81A 4TZHA 1OHOA 4KVHA 2RA8A 5GMGA 2GXFA 2Z64A 3G3BA 3UL7A 3F7XA 3RFSA 3ZYJA 4HM6B 3JUPA 2STDA 1C7HA 4ECOA 2Q4GW 3OJAA 1A2KA 1BUQA 4PQ8A 5CMPA 3HK4A 3EQQB 3W3MA 4ARNA 4AW4A 5AWCA 4HM3B 2XRXB 5B0NA 3H51A 3NUVA 3F7SA 3D9RA 2RCDA 4Z94G 4R1KA 3IPTA 3UJMA 2Z82A 2Z65A 4U08A 5AI1A 4R5DA 3CVRA 1JB2A 1D0BA 4J4LA 3KE7A 4HM8B 4GLPA 3F9SA 3UL9A 5AEWB 2Z66A 2JQDA 2XWTC 1PGVA 1GWBA 4LXSA 1GYBA 5A5CA 3P72A 3WPBA 4BV4R 2HMMB 1JL5A 3B4PA 4WP5A 3NV0B 5GQRK 4XBYA 1ZX2A 3EN1B 3RW7A 3A79B 3G04C 2OMXA 2Z7AA 2O6RA 4XGOA 4WWUC 4HM0B 2OWPA 2ASSB 3G0KA 3M19A 2R9UA 4L3AA 1JKGB 4M7EA 1XWDC 5KP4A 4G8AA 3VSYA 4X2HA 3EC9A 3G16A 3RJ0A 4QBZA 1P9AG 3M8CA 1JB4A 2INXA 5JPUA 2GEXA 1K5GC 1XKUA 2OMUA 4L8PA 3RGXA 4PEJA 3OJAB 3M18A 1W8AA 4V2EA 5IENA 4R58A 3EBYA 2QIYA 4FCMA 3G39A 1WQLB 4H3UA 2FT3A 4FS7A 2RR6A 5AWBA 4CILA 3T8UA 1O7NB 5TGNA 4B8CD 4OUQA 1OHPA 3BB9A 4LXRA 1FS2A 2B24B 3CU3A 3CIGA 3BZ5A 2R4IA 1Q42A 5EVHA 4WYKB 5AEUB 2PZVA 1UUVB 5IERA 1JN5A 2OMTA 3EN8A 1FO1A 3G06A 3PMHG 2XSOB 4K17A 5AWAA 1W00A 5BXQA 3WPIA 1YRGA 3E3ZA 3RW6A 1JN5B 3HZPA 3DZLA 2RGQA 4QC0A 4MQWX 2BMQB 4LMIA 3B8LA 2ID5A 4XDVA 3F14A 3WPFA 2CKFB 4ORLA 5FTTB 5CLKA 3EBTA 2IFGA 1O7MB 1GY6A 3I0YA 1IDPA 3GRDA 1P8TA 4PSJA 1ISKA 3ULVA 3MG1A 4HVNA 4HKVB 1U0ND 5JPPA 4NKHA 3DM8A 2F98A 5AIIA 1M10B 2V9SA 4LSXA 5KP3A 4RZMA 3RIZA 3SEDA 2F99A 1OTNA 4AY9X 1O6SA 3S5CA 5GMFA 1W6YA 3KSPA 2HMKB 1UUWB 2CA6A 3RFEA 4U06A 3GZXB 2ELLA 4CNMA 4OQTA 4RWTC 3UN9A 3W3JA 4PERA 4J9AA 4WP6A 4L3FA 3DUKA 4I4KA 4EZGA 1XCDA 4HM5B 4BSSA 4V2DA 1KOHA 1VZZA 3MSOA 3NHXA 1A4YA 4XBTA 4HZ9B 3ZYIA 3EJVA 1OGZA 4CC4C 3FXIA 3MG3A 2V70A 1DCEA 2WQUA 2HMNB 4Q62A 1OH0A 2OMWA 2P1MB 6STDA 5G2GA 3ROBA 5AIHA 4Z8GA 3W3GA 2A0ZA 4KNGA 5BVBA 1SQ0B 2YFJB 4L8OA 4FCGA 1OF5B 5AIFA 2XR8B 4J8TA 3E99A 1M9SA 5IG4A 1TP6A 4OVMA 4P8SA 5CXOA 1GY7A 7STDA 2Z81A 1O6VA 2XSHB 3JB9j 4R6JA 3WN4A 1K5DC 3BLZA 4R6AA 2BNHA 1OUNA 3JUMA 1K41A 3MYTA 2UZYA 3W3NA 1NWWA 4GB5A 3GZRA 4FDWA 3WPGA 5IG5A 4Z79A 4XBXA 3MG2A 4Q53A 3ZYOA 4ARRA 4LSAA 3TSRE 3RGAA 8CHOA 2Z62A 4Q3IA 2HMLB 3FH1A 3STDA 3F8XA 3LYGA 3MKIA 4PKIG 1JB5A 5D83A 4MN8B 2ASTB 1DMMA 3E4GA 1QMAA 5GS0A 5CMNA 2Z76A 2P1QB 1ULJB 4RCAB 3OWYA 3EX9A 1ULIB 3OGKB 5CF1A 5LFNA 3C6OB 4IM6A 2JE1A 1ZO2A 1OGQA 4HM2B 1WWLA 5KP1A 3NM2A 2I9WA 3B7CA 3NBRA 1STDA 3CNMA 2JE0A 4R09A 4LGQA 4WYKA 1OZNA 2WFHA 2Z77A 1SJWA 5DREA 4LSCA 4QXEA 1JKGA 3WPEA 4V2CA 4BSRA 5STDA 3VGNA 3SB4A 3DMCA 3VQ2A 2F86B 3A76A 2WQVA 4I6JB 1DMQA 1HKXA 1Q40A 4XDWA 4HM7B 5D82A 1P8VA 1NDOB 5IEOA 2P1OB 2WQWA 4FMZA 4H09A 1OGXA 1M9LA 5IG0A 1E3VA 3GOZA 3ECFA 4R5CA 1S5AA 3JUOA 5IJCA 3FKAA 2OMZA 1U5OA 1TUHA 2HMOB 4HZBB 5IYXC 2BMOB 3EF8A 3UNLA 2P1NB 3E6JA 1CQSA 2BEXA 5B0TA 4Y61B 3E2JA 4Z61C 3RGZA 3ER7A 3ULUA 5IJBA 3OX9A 4KT1A 5IEPA 3GWRA 3FSDA 1Z1SA 3NXJA 1EA2A 2K54A 3SOYA 4FHOA 2O6QA 4R07A 3FGYA 2HMJB 3W3KA 3K7CA 3JUQA 2IMJA 4CNCA 1GY5A 4HJLB 5CK6A 3OV4A 3OGLB 3H3HA 5HGRA 3DZEA 4YEBB 2GEYA 4Q3GA 1QJGA 4LI1A 5IJDA 2Z7XA 1G9UA 3KJ4A 2V9TB 1FT8A 3FF0A 4K1VA 3VQ1A 1NU3A 3B4OA 4LEHA 1O7WB 4P91A 3OXAA 4CP6A 4L7KA 1OF5A 1Z7XW 5GS2B 4FD0A 4R08A 3FZWA 2OMVA 3WPDA 1ASKA 3ULAA 3OGMB 1OHSA 4BSUA 3WPCA 1XEUA 3O6NA 4CDLA 1AR0A 2Z7XB 2P1PB 4ECNA 1DFJI 3Q90A 3F8HA 4MJDA 2Y5QA 3G3AA 5AWDA 4Z64C 1QYYA 4N3VA 4R6GA 4HM1B 5AZ5A 4U13A 2Z63A 1FQVA 2O6SA 4LSXC 2WQXA 4XOSA 3UL8A 4C2AB 2GBWB 1W02A 4XM4A 3CNXA 4HQ1A 2YFLB 1IO0A 3W3LA 3RFJA 2BMRB 2B1XB 1DMNA 1O7GB 4R9LA 3KKGA 5FW5A 4RCWA 4GT6A 4IIAA 2YFIB 5CF2A 3C6PB 4KXFB 5IF6A 2UZXA 3NV0A 4U7LA 3REZA 1KOOA 2UX0A 4C2BB 2OMYA 4HM4B 1E97A 1OOKG 1ZIWA 2QGUA 5DRVA 4CC4A 2XOTA 3G8ZA 3O53A 1H6TA 3WPHA 5HDHA 4NKGA 4R0AA 1Q40B 2A15A 1O7HB 1H6UA 4U09A 3T8NA 3DXOA 3KZTA
chains in the Genus database with same CATH superfamily
4XB5A 2F4YA 4PEQB 3WMDA 1N8R4 3RGRA 3HX8A 3HIIA 4FCJA 1IVXA 3C6NB 1OCVA 5GMHA 3F40A 1Q864 3CIYA 1BVIA 2W6JH 5AYRB 3BIRA 2PNCA 5GSPA 1JBRA 2R41A 3LXUX 2K0MA 3LZAA 1O6TA 4XSQA 1K734 2KCDA 1EG9B 3OWSA 1M1K4 2CWTA 3GZYB 1BAOA 2RFRA 3BU4A 1GS3A 2KF3A 3WDGB 3URPA 2XGNA 4K90B 2WO0A 3I553 1LTXA 4UFRA 3AMOA 1KC84 2JDIH 3CPOA 3G6E3 4NHFA 1MWTA 3LTBA 3GZBA 3LTAA 4LI2A 5B4PA 2Y73A 2BNGA 5IG3A 5D3IA 1EQKA 1BRHA 4K1UA 1DS9A 1XECA 1ZGXA 1RGFA 1AQZA 1W01A 3EE1A 1OTOA 1O7PB 1OTMA 3FCSB 2JQ5A 2GBXB 3FLJA 3SOAA 1NNVA 1M0ZA 3MHEA 1VQK3 3ZYNA 4J0MA 4X2OA 4R6FA 1RNBA 1PU4A 1D6ZA 3K0ZA 3NBJA 4GL6A 3MWZA 3EHCA 1I0XA 1JBSA 2BT3A 3FF2A 3JUNA 1E3RA 4STDA 4DKIA 5HZLB 1A9NA 3K9MC 4R9KA 1OPYA 2W2CA 1M1XB 2LQVA 4IT7A 5AIGA 4M7EC 5IW9A 2CHCA 3OWUA 1VQM3 1X1YA 1PYLA 5D81A 2CIUA 1RMSA 1OHOA 4KVHA 3WHOA 2RA8A 4TZHA 1RGAA 8RNTA 1UUGB 2CH9A 5GMGA 1N9JA 2E2VA 2GXFA 2W04A 1LRAA 1RKYA 1VQ63 2Z64A 3FG1A 1TIJA 3G3BA 3UL7A 3F7XA 1BSDA 3T0UA 1I0VA 1ZS7A 3RFSA 3ZYJA 3DGNA 2QEX3 1SARA 4AKYA 2IUJA 4HM6B 1BRJA 3WA3A 1JJ22 1TFKA 1BRGA 1BOXA 2STDA 1FGQA 1C7HA 3JUPA 3AMOB 1YVBI 4H61A 3TDGA 1VQ83 3CCQ3 2FXTA 1BUJA 1A2KA 1BUQA 1FGTA 1RN1A 3HK4A 3OJAA 4PQ8A 3EQQB 5CMPA 1KWIA 3W3MA 1LQMB 4IPBA 4ARNA 4AW4A 2C11A 5AWCA 4HM3B 2XRXB 3CC73 3H51A 5B0NA 5AYSC 1BNJA 1RGCA 3F7SA 3NUVA 1I2GA 1FUSA 3D9RA 4BU4A 3K63A 2RCDA 1G0TA 4Z94G 1W6GA 3CXC2 4AEQA 1RGEA 1I3FA 3IPTA 4R1KA 1ROAA 4NREA 1W4NA 3UJMA 1IVUA 3CCE3 2Z65A 1RGKA 1Y4KA 5AI1A 3CD63 2Z82A 4R5DA 1WMOA 4U08A 3CVRA 3CCU3 1JB2A 1D0BA 4J4LA 1UI8A 1RRHA 3KE7A 1Q814 1WTHA 3D5IA 2P05A 1T2IA 1STFI 3PGBA 3NQZA 2H0GA 2W9PA 2XGLA 4HM8B 4ILFA 3F9SA 1C54A 4GLPA 3UL9A 1HU9A 5AEWB 1BRNL 2Z66A 1L5GB 1SIHA 1IQYA 1SIIA 2JQDA 2XWTC 1RRLA 1PGVA 1GWBA 1N8QA 4LXSA 2E2UA 1GYBA 5A5CA 3P72A 2KAAA 3WPBA 1RGLA 4BV4R 1UCJA 2CFLA 2FNQA 2H0HA 2HMMB 2CG1A 1R4YA 2UGIA 1JL5A 5ELUA 1Q9EA 2CFWA 2RSXA 3B4PA 4WP5A 1GD4A 3PCSA 1NB3I 3NV0B 5GQRK 1BNRA 4XBYA 1TTOA 5HOHA 1GMPA 1A2PA 1LOWA 1ZX2A 3EN1B 3RW7A 1US1A 1B2SA 3A79B 3G04C 1RTUA 1IT8A 2Z7AA 3CCV3 1JZDA 2OMXA 3EB8A 1LVNA 4FMBA 1TRPA 2O6RA 4XGOA 4RBNA 4WWUC 4HM0B 2OWPA 1VQP3 2CWVA 2ASSB 2IYJA 2CG0A 3G0KA 4R80A 4FMCA 2R9UA 3M19A 4L3AA 1BIRA 4LYLB 1JZOA 1JKGB 4M7EA 1XWDC 5KP4A 3MPHA 4G8AA 3VSYA 4X2HA 3EC9A 3G16A 1MOLA 3RJ0A 1N5PA 3G06A 2IY2A 1P9AG 1OACA 4QBZA 2BU4A 1K28A 1JB4A 2INXA 3M8CA 2GEXA 1KSIA 4O2HA 5JPUA 3CCM3 4L8PA 1KQS2 1K5GC 1XKUA 5ELJA 3RGXA 4PEJA 3OJAB 3M18A 3KN4A 1X1XA 1W8AA 4V2EA 5IENA 3CPW2 2BHMA 3QK9A 4R4KA 3CMA3 4R58A 3EBYA 2QIYA 4FCMA 3G39A 1WQLB 4H3UA 2FT3A 5EEOA 1CEWI 4FS7A 2ML6A 4LSOA 2RR6A 4WHAA 5RNTA 1PFPA 2CK3H 5AWBA 1GSPA 2AADA 3NBBA 2LYXA 4CILA 1V57A 2W9QA 3T8UA 1O7NB 5TGNA 1B21A 4EBGA 4OUQA 5A0OB 4B8CD 2M7OA 1CH0A 3G713 1OHPA 3BB9A 1VQ53 4LXRA 1FS2A 1RNTA 3DH2A 1MWSA 2B24B 2CX0A 3CU3A 1BNGA 4AKZA 1FA3A 3CIGA 4WFOA 2R4IA 3BZ5A 1Q42A 5EVHA 3K5TA 3PCRA 4WYKB 4QWTA 2YX9A 2PZVA 1TFOA 1UUVB 2Q07A 1JN5A 3ALAA 4N6TA 5AEUB 5IERA 3CC23 4J5GA 1B2MA 3X40A 1VQN3 2OMTA 3EN8A 1G96A 4HYZA 2XH9A 3BNEA 1AY7A 2XSOB 3D3LA 1W00A 4N6UA 1FO1A 3PMHG 4K17A 1JV2B 1LOYA 2E2TA 5BXQA 3WPIA 1YRGA 1I8VA 3E3ZA 3RW6A 1JN5B 4HOHA 3HZPA 4I5QA 3DZLA 2RGQA 4QC0A 4GSPA 4MQWX 1F8NA 3BNCA 1B2UA 2KRTA 2BMQB 4LMIA 1U8CB 2XFSA 3B8LA 2ID5A 4XDVA 3F14A 3FG4A 3WPFA 4N6OB 3RDEA 2CKFB 4ORLA 2BIRA 1BRIA 2CWUA 1A90A 5FTTB 5CLKA 3EBTA 5IJCA 2IFGA 1O7MB 1GY6A 3SVAA 3CCR3 3I0YA 1IDPA 3GRDA 1P8TA 4PSJA 1ISKA 3ULVA 3MG1A 4HVNA 1LOVA 1WMPA 3HI7A 4HKVB 1U0ND 4RNYA 4EC6A 3GSPA 3V92A 2WGOA 5JPPA 4NZRM 4NKHA 4FMDA 3DM8A 3Q3FA 1YVSA 3SXXA 4MMYB 2F98A 1GD3A 2W56B 5AIIA 1W5ZA 3S67A 5M19A 3CCS3 1M10B 2V9SA 4LSXA 1HYFA 4TX4A 1IYYA 3ZFZA 5KP3A 4RZMA 6RNTA 3PXMA 3SEDA 1JBTA 1W7CA 2F99A 3RIZA 1OTNA 4AY9X 1O6SA 1FUTA 3S5CA 5GMFA 1RHLA 1W6YA 1JRQA 3AHWA 3KSPA 1W2B2 2HMKB 1UUWB 3A5EA 2CA6A 3RFEA 3X3ZA 1YJN3 2CC3A 4U06A 3GZXB 2ELLA 4CNMA 3WA2X 4OQTA 4RWTC 3UN9A 3W3JA 4PERA 4J9AA 1EUIC 4WP6A 4L3FA 3DUKA 1YGWA 2V1LA 2IA7A 3Q1CA 4I4KA 4JF8A 4EZGA 1TU5A 2Q4GW 1B2XA 1XCDA 4HM5B 4BSSA 1B2ZA 1BNEA 2HOHA 4V2DA 1KOHA 1VZZA 1FUWA 3MSOA 3NHXA 1B20A 1MGRA 4NPBA 4XBTA 4EV2A 2F56A 3OW22 1A4YA 2L4VA 4HZ9B 5IYXC 3EJVA 1OGZA 3ZYIA 4CC4C 3FXIA 3MG3A 2V70A 3N9HA 1DCEA 2WQUA 2HMNB 4Q62A 1NJI4 1OH0A 2XFTA 3L0RA 1VQO3 1LOXA 2OMWA 2P1MB 2WOHA 6STDA 1QVF2 1IQXA 1MWRA 1WMNA 2KF5A 5G2GA 3S29A 3SX1A 3ROBA 2H0IA 3CME3 4MMXB 5AIHA 3I563 4Z8GA 3W3GA 2A0ZA 4KNGA 4FCZA 3HIGA 4MMZB 5BVBA 3CC43 3SLUA 1J2BA 1T3BA 1SQ0B 1I70A 1W2ZA 2YFJB 4L8OA 4CCVA 4FCGA 1OF5B 5AIFA 2XR8B 1AVKA 2RNTA 3E99A 4J8TA 1M9SA 3KSED 5IG4A 1BU4A 1Q7Y4 1BSBA 1TP6A 3PS8A 4KFEA 4OVMA 5CXOA 2OTL3 4O8SA 1GY7A 7STDA 1YI23 3LT9A 2Z81A 2KF6A 2GSPA 1O6VA 1FGRA 1K9M4 2XSHB 3JB9j 1IVVA 1AV4A 1Q7HA 3DGMA 1IVWA 1UCIA 7RNTA 4R6JA 1IQ8A 5M1AA 3WN4A 1K5DC 1A2VA 2K3DA 2XF3A 3BLZA 3BNBA 4EYCA 1BRKA 4R6AA 3LTCA 2BNHA 1OUNA 3JUMA 1K41A 1IK3A 1R4CA 2XEPA 3MYTA 2OMUA 3HOHA 4CPKA 3O8YA 4FR9A 3NM7A 2UZYA 3W3NA 1NWWA 1V58A 4GB5A 1T2HA 1M904 3GZRA 4FDWA 3WPGA 2O9UX 5IG5A 4Z79A 2W0QA 3PZWA 1B3SA 2KF4A 4XBXA 4HAAA 7GSPA 4N6V0 3MG2A 4J5KA 4Q53A 3ZYOA 5BU4A 3TSRE 4ARRA 1TRQA 3RGAA 3S27A 4LSAA 8CHOA 2Z62A 4Q3IA 1SQWA 2HMLB 3FH1A 3STDA 3F8XA 3GAXA 3LYGA 1FZUA 3MKIA 4PKIG 1JB5A 1QAKA 2J8XB 2CX1A 5D83A 2OOVA 3NX0A 4MN8B 2ASTB 2SBLA 1DMMA 3E4GA 1QMAA 1WNHA 4BL2A 1RGHA 1X1UA 4ZM8A 1Q824 5GS0A 1RDSA 5CMNA 2Z76A 2P1QB 1SPUA 1ULJB 3ZG0A 2ZHXB 1MNLA 1DE3A 3DGYA 4RCAB 1RCLA 3OWYA 1FGMA 3EX9A 4NZTM 2QA43 1ULIB 2ML5A 1I2FA 3OGKB 5CF1A 3AHSA 9RNTA 5LFNA 1UCKA 3C6OB 4IM6A 1RCKA 1VQ43 1DYUA 2JE1A 2F5WA 1DVCA 1ZO2A 5BIRA 1OGQA 2MF7A 4HM2B 1WWLA 3BNDA 2Y74A 5KP1A 1LQGC 3NM2A 4RNTA 1V74A 2I9WA 3QRDA 3IMAB 2UUGC 2WOFA 3B7CA 1STDA 3NBRA 3V99A 3CNMA 3X3XA 1BSCA 2JE0A 4R09A 1UDII 4LGQA 4WYKA 1OZNA 2WFHA 2Z77A 1SJWA 5DREA 4LSCA 4QXEA 1JKGA 3J7Yd 1UCLA 2BO9B 2CW9A 5M18A 1UI7A 3WPEA 4V2CA 4BSRA 5STDA 1EEJA 3VGNA 3KCHA 3SB4A 3DMCA 3VQ2A 1IT7A 3KFQC 3PYJA 2F86B 4G1MB 1IV9A 1YHQ3 4O3VA 1GMQA 2O3OA 3A76A 2WQVA 3LMLA 2D42A 1UW1A 1DMQA 1HKXA 1Q40A 3X42A 4I6JB 1B27A 4XDWA 4HM7B 4LZIA 5D82A 3U1WA 1P8VA 1D6UA 1G02A 5G1KA 3UL6A 1VQL3 1NDOB 2C4BA 2C10A 5IEOA 4BIRA 1S723 2P1OB 2WQWA 4FMZA 4H09A 3NQYA 5AWAA 1OGXA 3AGNA 1M9LA 1BSAA 1E3VA 1N5HA 5IG0A 1RN7A 4FMAA 3ECFA 3GOZA 1S5AA 3IJEB 1N9EA 3JUOA 4R5CA 3FKAA 1HZ1A 2OMZA 1U5OA 4K61A 1NO3A 1TUHA 3UB1A 3WOEB 2HMOB 3G4S3 4HZBB 5FGOA 2BMOB 2WGQA 3EF8A 1MWUA 3LT8A 4JRFA 2MC8A 3UNLA 1A67A 2P1NB 3E6JA 1GOYA 1CQSA 2ZDJA 2BEXA 5B0TA 1FYSA 4Y61B 3E2JA 4Z61C 3RGZA 3ER7A 3ZG5A 3KIIA 1VQ73 1QALA 3ULUA 1YNVX 4GHOA 4ECOA 3OX9A 5IJBA 1MGWA 4KT1A 2CFGA 3N8BA 5IEPA 1I3IA 3GWRA 3FSDA 1Z1SA 3NXJA 1EA2A 2K54A 3SOYA 1RSNA 1QVG2 1ROVA 2GU3A 2O6QA 4FHOA 4R07A 3FGYA 2HMJB 3W3KA 4KFFA 1FW7A 1I2EA 3K7CA 3JUQA 1KD14 2F5MA 2IMJA 4BTXA 2L1SA 3LTDA 1EKMA 4CNCA 1BRSA 1GY5A 4HJLB 5CK6A 3OV4A 1YIT3 3DY5A 1CYVA 3OGLB 3H3HA 5HGRA 4KT3B 4BL3A 2Z6BA 4KZ1A 3DZEA 1RN4A 4YEBB 2GEYA 4Q3GA 2CFDA 1QJGA 4LI1A 1YJ93 3Q2PA 5IJDA 2Z7XA 2ZA4A 3WR2A 1G9UA 3KJ4A 2W56A 2V9TB 1FT8A 3FF0A 4K1VA 4EXRA 3VQ1A 3FG3A 1NU3A 1RGGA 3B4OA 5G1LA 1W6CA 1GOUA 1O7WB 1BNSA 4LEHA 4MEIA 4O02B 1FGOA 3OXAA 5EQLA 6GSPA 1NB5I 2OTJ3 4P91A 4CP6A 4L7KA 1OF5A 1Z7XW 5GS2B 1RLSA 1M9GA 3N54B 4CJNA 4FD0A 4R08A 3FZWA 2OMVA 3WPDA 2D1WA 1ASKA 3S28A 3ULAA 2P0MA 3OGMB 1OHSA 4BSUA 3WPCA 4EV5A 1XEUA 1BANA 4CDLA 1AR0A 3O6NA 2KXGA 3CCL3 2SARA 3V98A 2Z7XB 1BGSA 1YGEA 2P1PB 1X1WA 3D4AA 4RNZA 5LC7A 1DFJI 4ECNA 3Q90A 3F8HA 4MJDA 2Y5QA 1LNIA 1JNQA 3G3AA 5AWDA 5JBSA 4Z64C 4N6MA 1QAFA 1QYYA 3LH4A 4N3VA 4R6GA 4HM1B 5AZ5A 1BNIA 2OQEA 4U13A 1VQQA 3X41A 1FQVA 2Z63A 2AAEA 1BNFA 5LC6A 3LOYA 3WODG 1GMRA 1UGIA 2O6SA 4LSXC 2WQXA 3VF1A 1DVDA 1D6YA 4XOSA 3UL8A 4C2AB 4N6LA 2GBWB 1W02A 1BSEA 3CNXA 1UGHI 4N6NB 4XM4A 4HQ1A 2YFLB 1K8A4 4BTWA 1IO0A 2P09A 3W3LA 4HBRA 3CCJ3 2BMRB 3AGOA 3RFJA 2B1XB 1IV7A 1DMNA 1GOVA 1O7GB 4R9LA 1YIJ3 2CFKA 1YJW3 2OQEC 3KKGA 5FW5A 4RCWA 4GT6A 4IIAA 2YFIB 1VQ93 1RJOA 2GU1A 4KFDA 5CF2A 2OCTA 1DETA 3JVCA 4EW5A 3C6PB 4KXFB 5IF6A 3D79A 2UZXA 3SYUA 2OOVC 5I97A 3NV0A 4U7LA 3D5GA 3U97A 2IUKA 2P38A 1T5YA 3REZA 4OK0A 1LNHA 3UL5A 2UX0A 1KOOA 4C2BB 2ZL8A 3RNTA 4HM4B 1E97A 1CYUA 2OMYA 1OOKG 1PY3A 1TJDA 3DGLA 1ZIWA 2QGUA 5DRVA 3X3YA 2XOTA 4CC4A 3G8ZA 3O53A 1AVLA 3DGOA 3WOFB 1H6TA 2FGTA 2P0XA 5HDHA 3WPHA 4NKGA 4R0AA 1Q40B 2W03A 2RBIA 2A15A 1O7HB 1H6UA 4U09A 4BTYA 1LXEA 3T8NA 1IU7A 3DXOA 4P8SA 3KZTA
chains in the Genus database with same CATH topology
4XB5A 4PEQB 3WMDA 1N8R4 3RGRA 3HX8A 3HIIA 4FCJA 1IVXA 3C6NB 1OCVA 5GMHA 3F40A 1Q864 5AYRB 2W6JH 3CIYA 2PNCA 3LXUX 2K0MA 3LZAA 1O6TA 4XSQA 1K734 2KCDA 1EG9B 3OWSA 1M1K4 2CWTA 3GZYB 2RFRA 3I553 1GS3A 3WDGB 2XGNA 4K90B 2WO0A 1LTXA 4UFRA 3AMOA 1KC84 2JDIH 3CPOA 3G6E3 4NHFA 3LTBA 3GZBA 3LTAA 4LI2A 5B4PA 2Y73A 2BNGA 5IG3A 5D3IA 1EQKA 4K1UA 1DS9A 1XECA 1W01A 1OTOA 3EE1A 1O7PB 1OTMA 3FCSB 2JQ5A 2GBXB 3FLJA 3SOAA 3ZYNA 1M0ZA 3MHEA 1VQK3 4J0MA 4X2OA 4R6FA 1PU4A 1D6ZA 3K0ZA 3NBJA 4GL6A 3MWZA 3EHCA 2BT3A 3FF2A 3JUNA 1E3RA 4STDA 5HZLB 1A9NA 3K9MC 4R9KA 1OPYA 2W2CA 1M1XB 2LQVA 4IT7A 5AIGA 4M7EC 5IW9A 2CHCA 3OWUA 1VQM3 5D81A 2CIUA 4TZHA 1OHOA 4KVHA 2RA8A 2CH9A 5GMGA 1N9JA 2E2VA 2GXFA 2W04A 1RKYA 2Z64A 1VQ63 3FG1A 1TIJA 3G3BA 3UL7A 3F7XA 3RFSA 3T0UA 3ZYJA 3DGNA 2QEX3 4AKYA 2IUJA 4HM6B 3WA3A 1JJ22 1TFKA 3JUPA 2STDA 4H61A 1FGQA 1C7HA 3TDGA 3AMOB 1YVBI 1VQ83 2Q4GW 4ECOA 3CCQ3 2FXTA 3OJAA 1A2KA 1BUQA 1FGTA 4PQ8A 3HK4A 5CMPA 3EQQB 1KWIA 3W3MA 4ARNA 4IPBA 4AW4A 2C11A 5AWCA 4HM3B 2XRXB 3CC73 3H51A 5B0NA 5AYSC 3NUVA 3F7SA 3D9RA 3K63A 2RCDA 4Z94G 1W6GA 3CXC2 4AEQA 4R1KA 3IPTA 3UJMA 3CCE3 1ROAA 4NREA 1W4NA 2Z82A 1IVUA 2Z65A 4U08A 1Y4KA 5AI1A 3CD63 4R5DA 1WMOA 3CVRA 3CCU3 1JB2A 1D0BA 4J4LA 1UI8A 1RRHA 3KE7A 1Q814 1WTHA 2P05A 1STFI 3PGBA 3NQZA 2W9PA 2XGLA 4HM8B 4GLPA 3F9SA 3UL9A 1HU9A 5AEWB 2Z66A 1L5GB 1SIHA 1IQYA 1SIIA 2JQDA 2XWTC 1RRLA 1PGVA 1GWBA 1N8QA 4LXSA 2E2UA 1GYBA 5A5CA 3P72A 3WPBA 4BV4R 2CFLA 2FNQA 2HMMB 2CG1A 1JL5A 5ELUA 2CFWA 2RSXA 3B4PA 4WP5A 1GD4A 3PCSA 1NB3I 3NV0B 5GQRK 4XBYA 1ZX2A 3EN1B 3RW7A 1US1A 3A79B 3G04C 2OMXA 1IT8A 2Z7AA 3CCV3 3EB8A 1LVNA 4FMBA 2O6RA 4XGOA 4RBNA 4WWUC 4HM0B 2OWPA 1VQP3 2CWVA 2ASSB 2CG0A 3G0KA 4R80A 4FMCA 2R9UA 3M19A 4L3AA 1JKGB 4M7EA 1XWDC 5KP4A 3MPHA 4G8AA 3VSYA 4X2HA 3EC9A 3G16A 1MOLA 3RJ0A 1N5PA 3G06A 1P9AG 4QBZA 1OACA 1K28A 1JB4A 2INXA 3M8CA 2GEXA 1KSIA 4O2HA 5JPUA 3CCM3 4L8PA 1KQS2 1K5GC 1XKUA 5ELJA 3RGXA 4PEJA 3OJAB 3M18A 3KN4A 1W8AA 4V2EA 5IENA 3CPW2 2BHMA 3QK9A 4R4KA 3CMA3 4R58A 3EBYA 2QIYA 4FCMA 3G39A 1WQLB 4H3UA 2FT3A 5EEOA 1CEWI 4FS7A 2ML6A 4LSOA 2RR6A 4WHAA 1PFPA 2CK3H 5AWBA 3NBBA 2LYXA 4CILA 4EBGA 2W9QA 3T8UA 1O7NB 5TGNA 4B8CD 4OUQA 5A0OB 2M7OA 3G713 1OHPA 3BB9A 1VQ53 4LXRA 1FS2A 2B24B 3CU3A 4AKZA 1FA3A 3CIGA 4WFOA 2R4IA 3BZ5A 1Q42A 5EVHA 3K5TA 3PCRA 4WYKB 4QWTA 2YX9A 2PZVA 1TFOA 1UUVB 2Q07A 1JN5A 3ALAA 4N6TA 5AEUB 5IERA 3CC23 1VQN3 2OMTA 3X40A 3EN8A 1G96A 4HYZA 2XH9A 3BNEA 2XSOB 3D3LA 1FO1A 1W00A 4N6UA 3PMHG 4K17A 5AWAA 1JV2B 2E2TA 5BXQA 3WPIA 1YRGA 3E3ZA 3RW6A 1JN5B 3HZPA 3DZLA 2RGQA 4QC0A 4MQWX 1F8NA 3BNCA 2KRTA 2BMQB 4LMIA 1U8CB 2XFSA 3B8LA 2ID5A 4XDVA 3F14A 3FG4A 3WPFA 4N6OB 3RDEA 2CKFB 4ORLA 1A90A 2CWUA 5FTTB 5CLKA 3EBTA 2IFGA 1O7MB 1GY6A 3SVAA 3CCR3 3I0YA 1IDPA 3GRDA 1P8TA 4PSJA 1ISKA 3ULVA 3MG1A 4HVNA 4HKVB 1WMPA 3HI7A 1U0ND 4RNYA 4EC6A 3V92A 2WGOA 5JPPA 4NKHA 4FMDA 3DM8A 3SXXA 4MMYB 2F98A 1GD3A 2W56B 5AIIA 1W5ZA 3S67A 3CCS3 1M10B 2V9SA 4LSXA 4TX4A 5KP3A 4RZMA 3RIZA 3PXMA 3SEDA 1W7CA 2F99A 1OTNA 4AY9X 1O6SA 3S5CA 5GMFA 1W6YA 1JRQA 3KSPA 1W2B2 2HMKB 1UUWB 2CA6A 3RFEA 3X3ZA 1YJN3 2CC3A 4U06A 3GZXB 2ELLA 4CNMA 3WA2X 4OQTA 4RWTC 3UN9A 3W3JA 4PERA 4J9AA 4WP6A 4L3FA 3DUKA 2V1LA 3Q1CA 2IA7A 4I4KA 4JF8A 4EZGA 1TU5A 1XCDA 4HM5B 4BSSA 4V2DA 1KOHA 1VZZA 1FUWA 3MSOA 3NHXA 4EV2A 3OW22 4XBTA 1A4YA 5IYXC 2L4VA 4HZ9B 3ZYIA 3EJVA 1OGZA 4CC4C 3FXIA 3MG3A 2V70A 3N9HA 1DCEA 2WQUA 2HMNB 4Q62A 1NJI4 1OH0A 2XFTA 3L0RA 1VQO3 1LOXA 2OMWA 2P1MB 2WOHA 6STDA 1QVF2 1IQXA 1WMNA 5G2GA 3S29A 3SX1A 3ROBA 3CME3 4MMXB 5AIHA 3I563 4Z8GA 3W3GA 2A0ZA 4KNGA 4FCZA 3HIGA 4MMZB 5BVBA 3CC43 3SLUA 1J2BA 1SQ0B 1W2ZA 2YFJB 4L8OA 4CCVA 4FCGA 1OF5B 5AIFA 2XR8B 1AVKA 4J8TA 3E99A 1M9SA 3KSED 5IG4A 1Q7Y4 1TP6A 3PS8A 4KFEA 4OVMA 5CXOA 2OTL3 4O8SA 1GY7A 7STDA 1YI23 3LT9A 2Z81A 1O6VA 1FGRA 1K9M4 2XSHB 3JB9j 1IVVA 1AV4A 3DGMA 1IVWA 4R6JA 1IQ8A 3WN4A 1K5DC 1A2VA 2XF3A 4EYCA 3BLZA 3BNBA 4R6AA 3LTCA 2BNHA 1OUNA 3JUMA 1K41A 1IK3A 1R4CA 2XEPA 3MYTA 2OMUA 3O8YA 4FR9A 3NM7A 2UZYA 3W3NA 1NWWA 4GB5A 1M904 3GZRA 4FDWA 3WPGA 2O9UX 5IG5A 4Z79A 2W0QA 3PZWA 4XBXA 4N6V0 3MG2A 4Q53A 3ZYOA 4ARRA 4LSAA 3TSRE 3S27A 3RGAA 8CHOA 2Z62A 4Q3IA 1SQWA 2HMLB 3FH1A 3STDA 3F8XA 3GAXA 3LYGA 3MKIA 4PKIG 1JB5A 1QAKA 5D83A 2OOVA 4MN8B 3NX0A 2ASTB 2SBLA 1DMMA 3E4GA 1QMAA 1WNHA 4ZM8A 1Q824 5GS0A 5CMNA 2Z76A 2P1QB 1SPUA 1ULJB 4RCAB 1MNLA 3OWYA 1FGMA 3EX9A 2QA43 1ULIB 2ML5A 3OGKB 5CF1A 5LFNA 3C6OB 4IM6A 1VQ43 1DYUA 2JE1A 1DVCA 1ZO2A 1OGQA 2MF7A 4HM2B 1WWLA 3BNDA 2Y74A 5KP1A 3NM2A 1V74A 2I9WA 3QRDA 3IMAB 2WOFA 3B7CA 3NBRA 1STDA 3V99A 3CNMA 3X3XA 2JE0A 4R09A 4LGQA 4WYKA 1OZNA 2WFHA 2Z77A 1SJWA 5DREA 4LSCA 4QXEA 1JKGA 3J7Yd 2BO9B 2CW9A 3WPEA 1UI7A 4V2CA 4BSRA 5STDA 3VGNA 3SB4A 3DMCA 3VQ2A 1IT7A 3KFQC 3PYJA 2F86B 4G1MB 1IV9A 1YHQ3 4O3VA 2O3OA 3A76A 2WQVA 3LMLA 2D42A 1DMQA 1HKXA 1Q40A 1UW1A 3X42A 4I6JB 4XDWA 4HM7B 4LZIA 5D82A 3U1WA 1P8VA 1D6UA 3UL6A 1VQL3 1NDOB 5IEOA 2C10A 1S723 2P1OB 2WQWA 4FMZA 4H09A 3NQYA 1OGXA 1M9LA 5IG0A 1E3VA 1N5HA 3GOZA 1RN7A 4FMAA 3ECFA 4R5CA 1S5AA 3IJEB 1N9EA 3JUOA 5IJCA 3FKAA 2OMZA 1U5OA 4K61A 1NO3A 1TUHA 3UB1A 3WOEB 2HMOB 3G4S3 4HZBB 5FGOA 2BMOB 2WGQA 3EF8A 3LT8A 4JRFA 2MC8A 3UNLA 1A67A 2P1NB 3E6JA 1CQSA 2ZDJA 2BEXA 5B0TA 4Y61B 3E2JA 4Z61C 3RGZA 3ER7A 3KIIA 1VQ73 1QALA 3ULUA 5IJBA 3OX9A 4KT1A 2CFGA 3N8BA 5IEPA 3GWRA 3FSDA 1Z1SA 3NXJA 1EA2A 2K54A 3SOYA 1QVG2 2O6QA 1ROVA 2GU3A 4FHOA 4R07A 3FGYA 2HMJB 3W3KA 4KFFA 3K7CA 3JUQA 1KD14 2IMJA 4BTXA 3LTDA 1EKMA 4CNCA 1GY5A 4HJLB 5CK6A 3OV4A 1YIT3 3DY5A 1CYVA 3OGLB 3H3HA 5HGRA 2Z6BA 4KZ1A 3DZEA 4YEBB 2GEYA 4Q3GA 2CFDA 1QJGA 4LI1A 1YJ93 3Q2PA 5IJDA 2Z7XA 1G9UA 3KJ4A 2W56A 2V9TB 1FT8A 3FF0A 4K1VA 4EXRA 3VQ1A 3FG3A 1NU3A 3B4OA 1W6CA 4LEHA 1O7WB 4O02B 4MEIA 5EQLA 1NB5I 1FGOA 3OXAA 2OTJ3 4P91A 4CP6A 4L7KA 1OF5A 1Z7XW 5GS2B 3N54B 1M9GA 4FD0A 4R08A 3FZWA 2OMVA 3WPDA 2D1WA 1ASKA 3S28A 3ULAA 2P0MA 3OGMB 1OHSA 4BSUA 3WPCA 4EV5A 1XEUA 3O6NA 4CDLA 1AR0A 2KXGA 3CCL3 3V98A 2Z7XB 1YGEA 2P1PB 4ECNA 4RNZA 5LC7A 1DFJI 3Q90A 3F8HA 4MJDA 2Y5QA 1JNQA 3G3AA 5AWDA 5JBSA 4Z64C 4N6MA 1QAFA 1QYYA 3LH4A 4N3VA 4R6GA 4HM1B 5AZ5A 2OQEA 4U13A 3X41A 2Z63A 1FQVA 5LC6A 3LOYA 3WODG 2O6SA 4LSXC 2WQXA 3VF1A 1DVDA 1D6YA 4XOSA 3UL8A 4C2AB 4N6LA 2GBWB 1W02A 4N6NB 3CNXA 4XM4A 4HQ1A 2YFLB 1K8A4 4BTWA 1IO0A 2P09A 3W3LA 4HBRA 3CCJ3 2BMRB 3RFJA 2B1XB 1IV7A 1DMNA 1O7GB 1YIJ3 4R9LA 2CFKA 1YJW3 2OQEC 3KKGA 5FW5A 4RCWA 4GT6A 4IIAA 2YFIB 1VQ93 1RJOA 2GU1A 4KFDA 5CF2A 2OCTA 3JVCA 3C6PB 4KXFB 5IF6A 2UZXA 2OOVC 5I97A 3NV0A 4U7LA 3U97A 2IUKA 2P38A 1T5YA 3REZA 4OK0A 1LNHA 3UL5A 2UX0A 1KOOA 4C2BB 2ZL8A 1CYUA 4HM4B 1E97A 2OMYA 1OOKG 3DGLA 1ZIWA 2QGUA 5DRVA 3X3YA 2XOTA 4CC4A 3G8ZA 3O53A 1AVLA 3DGOA 3WOFB 1H6TA 2FGTA 2P0XA 5HDHA 3WPHA 4NKGA 4R0AA 1Q40B 2W03A 2A15A 1O7HB 1H6UA 4U09A 4BTYA 1LXEA 3T8NA 1IU7A 3DXOA 4P8SA 3KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XB5 A;  4PEQ B;  3WMD A;  3RGR A;  3HX8 A;  4FCJ A;  3C6N B;  1OCV A;  5GMH A;  3F40 A;  3CIY A;  4XSQ A;  3LZA A;  1O6T A;  1EG9 B;  3OWS A;  3GZY B;  2RFR A;  1GS3 A;  1LTX A;  4UFR A;  3CPO A;  3GZB A;  4LI2 A;  5B4P A;  2BNG A;  5IG3 A;  5D3I A;  4K1U A;  1DS9 A;  1XEC A;  1W01 A;  1OTO A;  1O7P B;  1OTM A;  3FLJ A;  2JQ5 A;  2GBX B;  3SOA A;  3ZYN A;  1M0Z A;  3MHE A;  4J0M A;  4X2O A;  4R6F A;  3K0Z A;  3EHC A;  3JUN A;  3FF2 A;  4STD A;  1E3R A;  5HZL B;  1A9N A;  4R9K A;  1OPY A;  2W2C A;  5AIG A;  4M7E C;  2CHC A;  3OWU A;  5D81 A;  4TZH A;  1OHO A;  4KVH A;  2RA8 A;  5GMG A;  2GXF A;  2Z64 A;  3G3B A;  3UL7 A;  3F7X A;  3RFS A;  3ZYJ A;  4HM6 B;  3JUP A;  2STD A;  1C7H A;  4ECO A;  2Q4G W;  3OJA A;  1A2K A;  1BUQ A;  4PQ8 A;  5CMP A;  3HK4 A;  3EQQ B;  3W3M A;  4ARN A;  4AW4 A;  5AWC A;  4HM3 B;  2XRX B;  5B0N A;  3H51 A;  3NUV A;  3F7S A;  3D9R A;  2RCD A;  4Z94 G;  4R1K A;  3IPT A;  3UJM A;  2Z82 A;  2Z65 A;  4U08 A;  5AI1 A;  4R5D A;  3CVR A;  1JB2 A;  1D0B A;  4J4L A;  3KE7 A;  4HM8 B;  4GLP A;  3F9S A;  3UL9 A;  5AEW B;  2Z66 A;  2JQD A;  2XWT C;  1PGV A;  1GWB A;  4LXS A;  1GYB A;  5A5C A;  3P72 A;  3WPB A;  4BV4 R;  2HMM B;  1JL5 A;  3B4P A;  4WP5 A;  3NV0 B;  5GQR K;  4XBY A;  1ZX2 A;  3EN1 B;  3RW7 A;  3A79 B;  3G04 C;  2OMX A;  2Z7A A;  2O6R A;  4XGO A;  4WWU C;  4HM0 B;  2OWP A;  2ASS B;  3G0K A;  3M19 A;  2R9U A;  4L3A A;  1JKG B;  4M7E A;  1XWD C;  5KP4 A;  4G8A A;  3VSY A;  4X2H A;  3EC9 A;  3G16 A;  3RJ0 A;  4QBZ A;  1P9A G;  3M8C A;  1JB4 A;  2INX A;  5JPU A;  2GEX A;  1K5G C;  1XKU A;  2OMU A;  4L8P A;  3RGX A;  4PEJ A;  3OJA B;  3M18 A;  1W8A A;  4V2E A;  5IEN A;  4R58 A;  3EBY A;  2QIY A;  4FCM A;  3G39 A;  1WQL B;  4H3U A;  2FT3 A;  4FS7 A;  2RR6 A;  5AWB A;  4CIL A;  3T8U A;  1O7N B;  5TGN A;  4B8C D;  4OUQ A;  1OHP A;  3BB9 A;  4LXR A;  1FS2 A;  2B24 B;  3CU3 A;  3CIG A;  3BZ5 A;  2R4I A;  1Q42 A;  5EVH A;  4WYK B;  5AEU B;  2PZV A;  1UUV B;  5IER A;  1JN5 A;  2OMT A;  3EN8 A;  1FO1 A;  3G06 A;  3PMH G;  2XSO B;  4K17 A;  5AWA A;  1W00 A;  5BXQ A;  3WPI A;  1YRG A;  3E3Z A;  3RW6 A;  1JN5 B;  3HZP A;  3DZL A;  2RGQ A;  4QC0 A;  4MQW X;  2BMQ B;  4LMI A;  3B8L A;  2ID5 A;  4XDV A;  3F14 A;  3WPF A;  2CKF B;  4ORL A;  5FTT B;  5CLK A;  3EBT A;  2IFG A;  1O7M B;  1GY6 A;  3I0Y A;  1IDP A;  3GRD A;  1P8T A;  4PSJ A;  1ISK A;  3ULV A;  3MG1 A;  4HVN A;  4HKV B;  1U0N D;  5JPP A;  4NKH A;  3DM8 A;  2F98 A;  5AII A;  1M10 B;  2V9S A;  4LSX A;  5KP3 A;  4RZM A;  3RIZ A;  3SED A;  2F99 A;  1OTN A;  4AY9 X;  1O6S A;  3S5C A;  5GMF A;  1W6Y A;  3KSP A;  2HMK B;  1UUW B;  2CA6 A;  3RFE A;  4U06 A;  3GZX B;  2ELL A;  4CNM A;  4OQT A;  4RWT C;  3UN9 A;  3W3J A;  4PER A;  4J9A A;  4WP6 A;  4L3F A;  3DUK A;  4I4K A;  4EZG A;  1XCD A;  4HM5 B;  4BSS A;  4V2D A;  1KOH A;  1VZZ A;  3MSO A;  3NHX A;  1A4Y A;  4XBT A;  4HZ9 B;  3ZYI A;  3EJV A;  1OGZ A;  4CC4 C;  3FXI A;  3MG3 A;  2V70 A;  1DCE A;  2WQU A;  2HMN B;  4Q62 A;  1OH0 A;  2OMW A;  2P1M B;  6STD A;  5G2G A;  3ROB A;  5AIH A;  4Z8G A;  3W3G A;  2A0Z A;  4KNG A;  5BVB A;  1SQ0 B;  2YFJ B;  4L8O A;  4FCG A;  1OF5 B;  5AIF A;  2XR8 B;  4J8T A;  3E99 A;  1M9S A;  5IG4 A;  1TP6 A;  4OVM A;  4P8S A;  5CXO A;  1GY7 A;  7STD A;  2Z81 A;  1O6V A;  2XSH B;  3JB9 j;  4R6J A;  3WN4 A;  1K5D C;  3BLZ A;  4R6A A;  2BNH A;  1OUN A;  3JUM A;  1K41 A;  3MYT A;  2UZY A;  3W3N A;  1NWW A;  4GB5 A;  3GZR A;  4FDW A;  3WPG A;  5IG5 A;  4Z79 A;  4XBX A;  3MG2 A;  4Q53 A;  3ZYO A;  4ARR A;  4LSA A;  3TSR E;  3RGA A;  8CHO A;  2Z62 A;  4Q3I A;  2HML B;  3FH1 A;  3STD A;  3F8X A;  3LYG A;  3MKI A;  4PKI G;  1JB5 A;  5D83 A;  4MN8 B;  2AST B;  1DMM A;  3E4G A;  1QMA A;  5GS0 A;  5CMN A;  2Z76 A;  2P1Q B;  1ULJ B;  4RCA B;  3OWY A;  3EX9 A;  1ULI B;  3OGK B;  5CF1 A;  5LFN A;  3C6O B;  4IM6 A;  2JE1 A;  1ZO2 A;  1OGQ A;  4HM2 B;  1WWL A;  5KP1 A;  3NM2 A;  2I9W A;  3B7C A;  3NBR A;  1STD A;  3CNM A;  2JE0 A;  4R09 A;  4LGQ A;  4WYK A;  1OZN A;  2WFH A;  2Z77 A;  1SJW A;  5DRE A;  4LSC A;  4QXE A;  1JKG A;  3WPE A;  4V2C A;  4BSR A;  5STD A;  3VGN A;  3SB4 A;  3DMC A;  3VQ2 A;  2F86 B;  3A76 A;  2WQV A;  4I6J B;  1DMQ A;  1HKX A;  1Q40 A;  4XDW A;  4HM7 B;  5D82 A;  1P8V A;  1NDO B;  5IEO A;  2P1O B;  2WQW A;  4FMZ A;  4H09 A;  1OGX A;  1M9L A;  5IG0 A;  1E3V A;  3GOZ A;  3ECF A;  4R5C A;  1S5A A;  3JUO A;  5IJC A;  3FKA A;  2OMZ A;  1U5O A;  1TUH A;  2HMO B;  4HZB B;  5IYX C;  2BMO B;  3EF8 A;  3UNL A;  2P1N B;  3E6J A;  1CQS A;  2BEX A;  5B0T A;  4Y61 B;  3E2J A;  4Z61 C;  3RGZ A;  3ER7 A;  3ULU A;  5IJB A;  3OX9 A;  4KT1 A;  5IEP A;  3GWR A;  3FSD A;  1Z1S A;  3NXJ A;  1EA2 A;  2K54 A;  3SOY A;  4FHO A;  2O6Q A;  4R07 A;  3FGY A;  2HMJ B;  3W3K A;  3K7C A;  3JUQ A;  2IMJ A;  4CNC A;  1GY5 A;  4HJL B;  5CK6 A;  3OV4 A;  3OGL B;  3H3H A;  5HGR A;  3DZE A;  4YEB B;  2GEY A;  4Q3G A;  1QJG A;  4LI1 A;  5IJD A;  2Z7X A;  1G9U A;  3KJ4 A;  2V9T B;  1FT8 A;  3FF0 A;  4K1V A;  3VQ1 A;  1NU3 A;  3B4O A;  4LEH A;  1O7W B;  4P91 A;  3OXA A;  4CP6 A;  4L7K A;  1OF5 A;  1Z7X W;  5GS2 B;  4FD0 A;  4R08 A;  3FZW A;  2OMV A;  3WPD A;  1ASK A;  3ULA A;  3OGM B;  1OHS A;  4BSU A;  3WPC A;  1XEU A;  3O6N A;  4CDL A;  1AR0 A;  2Z7X B;  2P1P B;  4ECN A;  1DFJ I;  3Q90 A;  3F8H A;  4MJD A;  2Y5Q A;  3G3A A;  5AWD A;  4Z64 C;  1QYY A;  4N3V A;  4R6G A;  4HM1 B;  5AZ5 A;  4U13 A;  2Z63 A;  1FQV A;  2O6S A;  4LSX C;  2WQX A;  4XOS A;  3UL8 A;  4C2A B;  2GBW B;  1W02 A;  4XM4 A;  3CNX A;  4HQ1 A;  2YFL B;  1IO0 A;  3W3L A;  3RFJ A;  2BMR B;  2B1X B;  1DMN A;  1O7G B;  4R9L A;  3KKG A;  5FW5 A;  4RCW A;  4GT6 A;  4IIA A;  2YFI B;  5CF2 A;  3C6P B;  4KXF B;  5IF6 A;  2UZX A;  3NV0 A;  4U7L A;  3REZ A;  1KOO A;  2UX0 A;  4C2B B;  2OMY A;  4HM4 B;  1E97 A;  1OOK G;  1ZIW A;  2QGU A;  5DRV A;  4CC4 A;  2XOT A;  3G8Z A;  3O53 A;  1H6T A;  3WPH A;  5HDH A;  4NKG A;  4R0A A;  1Q40 B;  2A15 A;  1O7H B;  1H6U A;  4U09 A;  3T8N A;  3DXO A;  3KZT A; 
#chains in the Genus database with same CATH topology
 4XB5 A;  2F4Y A;  4PEQ B;  3WMD A;  1N8R 4;  3RGR A;  3HX8 A;  3HII A;  4FCJ A;  1IVX A;  3C6N B;  1OCV A;  5GMH A;  3F40 A;  1Q86 4;  3CIY A;  1BVI A;  2W6J H;  5AYR B;  3BIR A;  2PNC A;  5GSP A;  1JBR A;  2R41 A;  3LXU X;  2K0M A;  3LZA A;  1O6T A;  4XSQ A;  1K73 4;  2KCD A;  1EG9 B;  3OWS A;  1M1K 4;  2CWT A;  3GZY B;  1BAO A;  2RFR A;  3BU4 A;  1GS3 A;  2KF3 A;  3WDG B;  3URP A;  2XGN A;  4K90 B;  2WO0 A;  3I55 3;  1LTX A;  4UFR A;  3AMO A;  1KC8 4;  2JDI H;  3CPO A;  3G6E 3;  4NHF A;  1MWT A;  3LTB A;  3GZB A;  3LTA A;  4LI2 A;  5B4P A;  2Y73 A;  2BNG A;  5IG3 A;  5D3I A;  1EQK A;  1BRH A;  4K1U A;  1DS9 A;  1XEC A;  1ZGX A;  1RGF A;  1AQZ A;  1W01 A;  3EE1 A;  1OTO A;  1O7P B;  1OTM A;  3FCS B;  2JQ5 A;  2GBX B;  3FLJ A;  3SOA A;  1NNV A;  1M0Z A;  3MHE A;  1VQK 3;  3ZYN A;  4J0M A;  4X2O A;  4R6F A;  1RNB A;  1PU4 A;  1D6Z A;  3K0Z A;  3NBJ A;  4GL6 A;  3MWZ A;  3EHC A;  1I0X A;  1JBS A;  2BT3 A;  3FF2 A;  3JUN A;  1E3R A;  4STD A;  4DKI A;  5HZL B;  1A9N A;  3K9M C;  4R9K A;  1OPY A;  2W2C A;  1M1X B;  2LQV A;  4IT7 A;  5AIG A;  4M7E C;  5IW9 A;  2CHC A;  3OWU A;  1VQM 3;  1X1Y A;  1PYL A;  5D81 A;  2CIU A;  1RMS A;  1OHO A;  4KVH A;  3WHO A;  2RA8 A;  4TZH A;  1RGA A;  8RNT A;  1UUG B;  2CH9 A;  5GMG A;  1N9J A;  2E2V A;  2GXF A;  2W04 A;  1LRA A;  1RKY A;  1VQ6 3;  2Z64 A;  3FG1 A;  1TIJ A;  3G3B A;  3UL7 A;  3F7X A;  1BSD A;  3T0U A;  1I0V A;  1ZS7 A;  3RFS A;  3ZYJ A;  3DGN A;  2QEX 3;  1SAR A;  4AKY A;  2IUJ A;  4HM6 B;  1BRJ A;  3WA3 A;  1JJ2 2;  1TFK A;  1BRG A;  1BOX A;  2STD A;  1FGQ A;  1C7H A;  3JUP A;  3AMO B;  1YVB I;  4H61 A;  3TDG A;  1VQ8 3;  3CCQ 3;  2FXT A;  1BUJ A;  1A2K A;  1BUQ A;  1FGT A;  1RN1 A;  3HK4 A;  3OJA A;  4PQ8 A;  3EQQ B;  5CMP A;  1KWI A;  3W3M A;  1LQM B;  4IPB A;  4ARN A;  4AW4 A;  2C11 A;  5AWC A;  4HM3 B;  2XRX B;  3CC7 3;  3H51 A;  5B0N A;  5AYS C;  1BNJ A;  1RGC A;  3F7S A;  3NUV A;  1I2G A;  1FUS A;  3D9R A;  4BU4 A;  3K63 A;  2RCD A;  1G0T A;  4Z94 G;  1W6G A;  3CXC 2;  4AEQ A;  1RGE A;  1I3F A;  3IPT A;  4R1K A;  1ROA A;  4NRE A;  1W4N A;  3UJM A;  1IVU A;  3CCE 3;  2Z65 A;  1RGK A;  1Y4K A;  5AI1 A;  3CD6 3;  2Z82 A;  4R5D A;  1WMO A;  4U08 A;  3CVR A;  3CCU 3;  1JB2 A;  1D0B A;  4J4L A;  1UI8 A;  1RRH A;  3KE7 A;  1Q81 4;  1WTH A;  3D5I A;  2P05 A;  1T2I A;  1STF I;  3PGB A;  3NQZ A;  2H0G A;  2W9P A;  2XGL A;  4HM8 B;  4ILF A;  3F9S A;  1C54 A;  4GLP A;  3UL9 A;  1HU9 A;  5AEW B;  1BRN L;  2Z66 A;  1L5G B;  1SIH A;  1IQY A;  1SII A;  2JQD A;  2XWT C;  1RRL A;  1PGV A;  1GWB A;  1N8Q A;  4LXS A;  2E2U A;  1GYB A;  5A5C A;  3P72 A;  2KAA A;  3WPB A;  1RGL A;  4BV4 R;  1UCJ A;  2CFL A;  2FNQ A;  2H0H A;  2HMM B;  2CG1 A;  1R4Y A;  2UGI A;  1JL5 A;  5ELU A;  1Q9E A;  2CFW A;  2RSX A;  3B4P A;  4WP5 A;  1GD4 A;  3PCS A;  1NB3 I;  3NV0 B;  5GQR K;  1BNR A;  4XBY A;  1TTO A;  5HOH A;  1GMP A;  1A2P A;  1LOW A;  1ZX2 A;  3EN1 B;  3RW7 A;  1US1 A;  1B2S A;  3A79 B;  3G04 C;  1RTU A;  1IT8 A;  2Z7A A;  3CCV 3;  1JZD A;  2OMX A;  3EB8 A;  1LVN A;  4FMB A;  1TRP A;  2O6R A;  4XGO A;  4RBN A;  4WWU C;  4HM0 B;  2OWP A;  1VQP 3;  2CWV A;  2ASS B;  2IYJ A;  2CG0 A;  3G0K A;  4R80 A;  4FMC A;  2R9U A;  3M19 A;  4L3A A;  1BIR A;  4LYL B;  1JZO A;  1JKG B;  4M7E A;  1XWD C;  5KP4 A;  3MPH A;  4G8A A;  3VSY A;  4X2H A;  3EC9 A;  3G16 A;  1MOL A;  3RJ0 A;  1N5P A;  3G06 A;  2IY2 A;  1P9A G;  1OAC A;  4QBZ A;  2BU4 A;  1K28 A;  1JB4 A;  2INX A;  3M8C A;  2GEX A;  1KSI A;  4O2H A;  5JPU A;  3CCM 3;  4L8P A;  1KQS 2;  1K5G C;  1XKU A;  5ELJ A;  3RGX A;  4PEJ A;  3OJA B;  3M18 A;  3KN4 A;  1X1X A;  1W8A A;  4V2E A;  5IEN A;  3CPW 2;  2BHM A;  3QK9 A;  4R4K A;  3CMA 3;  4R58 A;  3EBY A;  2QIY A;  4FCM A;  3G39 A;  1WQL B;  4H3U A;  2FT3 A;  5EEO A;  1CEW I;  4FS7 A;  2ML6 A;  4LSO A;  2RR6 A;  4WHA A;  5RNT A;  1PFP A;  2CK3 H;  5AWB A;  1GSP A;  2AAD A;  3NBB A;  2LYX A;  4CIL A;  1V57 A;  2W9Q A;  3T8U A;  1O7N B;  5TGN A;  1B21 A;  4EBG A;  4OUQ A;  5A0O B;  4B8C D;  2M7O A;  1CH0 A;  3G71 3;  1OHP A;  3BB9 A;  1VQ5 3;  4LXR A;  1FS2 A;  1RNT A;  3DH2 A;  1MWS A;  2B24 B;  2CX0 A;  3CU3 A;  1BNG A;  4AKZ A;  1FA3 A;  3CIG A;  4WFO A;  2R4I A;  3BZ5 A;  1Q42 A;  5EVH A;  3K5T A;  3PCR A;  4WYK B;  4QWT A;  2YX9 A;  2PZV A;  1TFO A;  1UUV B;  2Q07 A;  1JN5 A;  3ALA A;  4N6T A;  5AEU B;  5IER A;  3CC2 3;  4J5G A;  1B2M A;  3X40 A;  1VQN 3;  2OMT A;  3EN8 A;  1G96 A;  4HYZ A;  2XH9 A;  3BNE A;  1AY7 A;  2XSO B;  3D3L A;  1W00 A;  4N6U A;  1FO1 A;  3PMH G;  4K17 A;  1JV2 B;  1LOY A;  2E2T A;  5BXQ A;  3WPI A;  1YRG A;  1I8V A;  3E3Z A;  3RW6 A;  1JN5 B;  4HOH A;  3HZP A;  4I5Q A;  3DZL A;  2RGQ A;  4QC0 A;  4GSP A;  4MQW X;  1F8N A;  3BNC A;  1B2U A;  2KRT A;  2BMQ B;  4LMI A;  1U8C B;  2XFS A;  3B8L A;  2ID5 A;  4XDV A;  3F14 A;  3FG4 A;  3WPF A;  4N6O B;  3RDE A;  2CKF B;  4ORL A;  2BIR A;  1BRI A;  2CWU A;  1A90 A;  5FTT B;  5CLK A;  3EBT A;  5IJC A;  2IFG A;  1O7M B;  1GY6 A;  3SVA A;  3CCR 3;  3I0Y A;  1IDP A;  3GRD A;  1P8T A;  4PSJ A;  1ISK A;  3ULV A;  3MG1 A;  4HVN A;  1LOV A;  1WMP A;  3HI7 A;  4HKV B;  1U0N D;  4RNY A;  4EC6 A;  3GSP A;  3V92 A;  2WGO A;  5JPP A;  4NZR M;  4NKH A;  4FMD A;  3DM8 A;  3Q3F A;  1YVS A;  3SXX A;  4MMY B;  2F98 A;  1GD3 A;  2W56 B;  5AII A;  1W5Z A;  3S67 A;  5M19 A;  3CCS 3;  1M10 B;  2V9S A;  4LSX A;  1HYF A;  4TX4 A;  1IYY A;  3ZFZ A;  5KP3 A;  4RZM A;  6RNT A;  3PXM A;  3SED A;  1JBT A;  1W7C A;  2F99 A;  3RIZ A;  1OTN A;  4AY9 X;  1O6S A;  1FUT A;  3S5C A;  5GMF A;  1RHL A;  1W6Y A;  1JRQ A;  3AHW A;  3KSP A;  1W2B 2;  2HMK B;  1UUW B;  3A5E A;  2CA6 A;  3RFE A;  3X3Z A;  1YJN 3;  2CC3 A;  4U06 A;  3GZX B;  2ELL A;  4CNM A;  3WA2 X;  4OQT A;  4RWT C;  3UN9 A;  3W3J A;  4PER A;  4J9A A;  1EUI C;  4WP6 A;  4L3F A;  3DUK A;  1YGW A;  2V1L A;  2IA7 A;  3Q1C A;  4I4K A;  4JF8 A;  4EZG A;  1TU5 A;  2Q4G W;  1B2X A;  1XCD A;  4HM5 B;  4BSS A;  1B2Z A;  1BNE A;  2HOH A;  4V2D A;  1KOH A;  1VZZ A;  1FUW A;  3MSO A;  3NHX A;  1B20 A;  1MGR A;  4NPB A;  4XBT A;  4EV2 A;  2F56 A;  3OW2 2;  1A4Y A;  2L4V A;  4HZ9 B;  5IYX C;  3EJV A;  1OGZ A;  3ZYI A;  4CC4 C;  3FXI A;  3MG3 A;  2V70 A;  3N9H A;  1DCE A;  2WQU A;  2HMN B;  4Q62 A;  1NJI 4;  1OH0 A;  2XFT A;  3L0R A;  1VQO 3;  1LOX A;  2OMW A;  2P1M B;  2WOH A;  6STD A;  1QVF 2;  1IQX A;  1MWR A;  1WMN A;  2KF5 A;  5G2G A;  3S29 A;  3SX1 A;  3ROB A;  2H0I A;  3CME 3;  4MMX B;  5AIH A;  3I56 3;  4Z8G A;  3W3G A;  2A0Z A;  4KNG A;  4FCZ A;  3HIG A;  4MMZ B;  5BVB A;  3CC4 3;  3SLU A;  1J2B A;  1T3B A;  1SQ0 B;  1I70 A;  1W2Z A;  2YFJ B;  4L8O A;  4CCV A;  4FCG A;  1OF5 B;  5AIF A;  2XR8 B;  1AVK A;  2RNT A;  3E99 A;  4J8T A;  1M9S A;  3KSE D;  5IG4 A;  1BU4 A;  1Q7Y 4;  1BSB A;  1TP6 A;  3PS8 A;  4KFE A;  4OVM A;  5CXO A;  2OTL 3;  4O8S A;  1GY7 A;  7STD A;  1YI2 3;  3LT9 A;  2Z81 A;  2KF6 A;  2GSP A;  1O6V A;  1FGR A;  1K9M 4;  2XSH B;  3JB9 j;  1IVV A;  1AV4 A;  1Q7H A;  3DGM A;  1IVW A;  1UCI A;  7RNT A;  4R6J A;  1IQ8 A;  5M1A A;  3WN4 A;  1K5D C;  1A2V A;  2K3D A;  2XF3 A;  3BLZ A;  3BNB A;  4EYC A;  1BRK A;  4R6A A;  3LTC A;  2BNH A;  1OUN A;  3JUM A;  1K41 A;  1IK3 A;  1R4C A;  2XEP A;  3MYT A;  2OMU A;  3HOH A;  4CPK A;  3O8Y A;  4FR9 A;  3NM7 A;  2UZY A;  3W3N A;  1NWW A;  1V58 A;  4GB5 A;  1T2H A;  1M90 4;  3GZR A;  4FDW A;  3WPG A;  2O9U X;  5IG5 A;  4Z79 A;  2W0Q A;  3PZW A;  1B3S A;  2KF4 A;  4XBX A;  4HAA A;  7GSP A;  4N6V 0;  3MG2 A;  4J5K A;  4Q53 A;  3ZYO A;  5BU4 A;  3TSR E;  4ARR A;  1TRQ A;  3RGA A;  3S27 A;  4LSA A;  8CHO A;  2Z62 A;  4Q3I A;  1SQW A;  2HML B;  3FH1 A;  3STD A;  3F8X A;  3GAX A;  3LYG A;  1FZU A;  3MKI A;  4PKI G;  1JB5 A;  1QAK A;  2J8X B;  2CX1 A;  5D83 A;  2OOV A;  3NX0 A;  4MN8 B;  2AST B;  2SBL A;  1DMM A;  3E4G A;  1QMA A;  1WNH A;  4BL2 A;  1RGH A;  1X1U A;  4ZM8 A;  1Q82 4;  5GS0 A;  1RDS A;  5CMN A;  2Z76 A;  2P1Q B;  1SPU A;  1ULJ B;  3ZG0 A;  2ZHX B;  1MNL A;  1DE3 A;  3DGY A;  4RCA B;  1RCL A;  3OWY A;  1FGM A;  3EX9 A;  4NZT M;  2QA4 3;  1ULI B;  2ML5 A;  1I2F A;  3OGK B;  5CF1 A;  3AHS A;  9RNT A;  5LFN A;  1UCK A;  3C6O B;  4IM6 A;  1RCK A;  1VQ4 3;  1DYU A;  2JE1 A;  2F5W A;  1DVC A;  1ZO2 A;  5BIR A;  1OGQ A;  2MF7 A;  4HM2 B;  1WWL A;  3BND A;  2Y74 A;  5KP1 A;  1LQG C;  3NM2 A;  4RNT A;  1V74 A;  2I9W A;  3QRD A;  3IMA B;  2UUG C;  2WOF A;  3B7C A;  1STD A;  3NBR A;  3V99 A;  3CNM A;  3X3X A;  1BSC A;  2JE0 A;  4R09 A;  1UDI I;  4LGQ A;  4WYK A;  1OZN A;  2WFH A;  2Z77 A;  1SJW A;  5DRE A;  4LSC A;  4QXE A;  1JKG A;  3J7Y d;  1UCL A;  2BO9 B;  2CW9 A;  5M18 A;  1UI7 A;  3WPE A;  4V2C A;  4BSR A;  5STD A;  1EEJ A;  3VGN A;  3KCH A;  3SB4 A;  3DMC A;  3VQ2 A;  1IT7 A;  3KFQ C;  3PYJ A;  2F86 B;  4G1M B;  1IV9 A;  1YHQ 3;  4O3V A;  1GMQ A;  2O3O A;  3A76 A;  2WQV A;  3LML A;  2D42 A;  1UW1 A;  1DMQ A;  1HKX A;  1Q40 A;  3X42 A;  4I6J B;  1B27 A;  4XDW A;  4HM7 B;  4LZI A;  5D82 A;  3U1W A;  1P8V A;  1D6U A;  1G02 A;  5G1K A;  3UL6 A;  1VQL 3;  1NDO B;  2C4B A;  2C10 A;  5IEO A;  4BIR A;  1S72 3;  2P1O B;  2WQW A;  4FMZ A;  4H09 A;  3NQY A;  5AWA A;  1OGX A;  3AGN A;  1M9L A;  1BSA A;  1E3V A;  1N5H A;  5IG0 A;  1RN7 A;  4FMA A;  3ECF A;  3GOZ A;  1S5A A;  3IJE B;  1N9E A;  3JUO A;  4R5C A;  3FKA A;  1HZ1 A;  2OMZ A;  1U5O A;  4K61 A;  1NO3 A;  1TUH A;  3UB1 A;  3WOE B;  2HMO B;  3G4S 3;  4HZB B;  5FGO A;  2BMO B;  2WGQ A;  3EF8 A;  1MWU A;  3LT8 A;  4JRF A;  2MC8 A;  3UNL A;  1A67 A;  2P1N B;  3E6J A;  1GOY A;  1CQS A;  2ZDJ A;  2BEX A;  5B0T A;  1FYS A;  4Y61 B;  3E2J A;  4Z61 C;  3RGZ A;  3ER7 A;  3ZG5 A;  3KII A;  1VQ7 3;  1QAL A;  3ULU A;  1YNV X;  4GHO A;  4ECO A;  3OX9 A;  5IJB A;  1MGW A;  4KT1 A;  2CFG A;  3N8B A;  5IEP A;  1I3I A;  3GWR A;  3FSD A;  1Z1S A;  3NXJ A;  1EA2 A;  2K54 A;  3SOY A;  1RSN A;  1QVG 2;  1ROV A;  2GU3 A;  2O6Q A;  4FHO A;  4R07 A;  3FGY A;  2HMJ B;  3W3K A;  4KFF A;  1FW7 A;  1I2E A;  3K7C A;  3JUQ A;  1KD1 4;  2F5M A;  2IMJ A;  4BTX A;  2L1S A;  3LTD A;  1EKM A;  4CNC A;  1BRS A;  1GY5 A;  4HJL B;  5CK6 A;  3OV4 A;  1YIT 3;  3DY5 A;  1CYV A;  3OGL B;  3H3H A;  5HGR A;  4KT3 B;  4BL3 A;  2Z6B A;  4KZ1 A;  3DZE A;  1RN4 A;  4YEB B;  2GEY A;  4Q3G A;  2CFD A;  1QJG A;  4LI1 A;  1YJ9 3;  3Q2P A;  5IJD A;  2Z7X A;  2ZA4 A;  3WR2 A;  1G9U A;  3KJ4 A;  2W56 A;  2V9T B;  1FT8 A;  3FF0 A;  4K1V A;  4EXR A;  3VQ1 A;  3FG3 A;  1NU3 A;  1RGG A;  3B4O A;  5G1L A;  1W6C A;  1GOU A;  1O7W B;  1BNS A;  4LEH A;  4MEI A;  4O02 B;  1FGO A;  3OXA A;  5EQL A;  6GSP A;  1NB5 I;  2OTJ 3;  4P91 A;  4CP6 A;  4L7K A;  1OF5 A;  1Z7X W;  5GS2 B;  1RLS A;  1M9G A;  3N54 B;  4CJN A;  4FD0 A;  4R08 A;  3FZW A;  2OMV A;  3WPD A;  2D1W A;  1ASK A;  3S28 A;  3ULA A;  2P0M A;  3OGM B;  1OHS A;  4BSU A;  3WPC A;  4EV5 A;  1XEU A;  1BAN A;  4CDL A;  1AR0 A;  3O6N A;  2KXG A;  3CCL 3;  2SAR A;  3V98 A;  2Z7X B;  1BGS A;  1YGE A;  2P1P B;  1X1W A;  3D4A A;  4RNZ A;  5LC7 A;  1DFJ I;  4ECN A;  3Q90 A;  3F8H A;  4MJD A;  2Y5Q A;  1LNI A;  1JNQ A;  3G3A A;  5AWD A;  5JBS A;  4Z64 C;  4N6M A;  1QAF A;  1QYY A;  3LH4 A;  4N3V A;  4R6G A;  4HM1 B;  5AZ5 A;  1BNI A;  2OQE A;  4U13 A;  1VQQ A;  3X41 A;  1FQV A;  2Z63 A;  2AAE A;  1BNF A;  5LC6 A;  3LOY A;  3WOD G;  1GMR A;  1UGI A;  2O6S A;  4LSX C;  2WQX A;  3VF1 A;  1DVD A;  1D6Y A;  4XOS A;  3UL8 A;  4C2A B;  4N6L A;  2GBW B;  1W02 A;  1BSE A;  3CNX A;  1UGH I;  4N6N B;  4XM4 A;  4HQ1 A;  2YFL B;  1K8A 4;  4BTW A;  1IO0 A;  2P09 A;  3W3L A;  4HBR A;  3CCJ 3;  2BMR B;  3AGO A;  3RFJ A;  2B1X B;  1IV7 A;  1DMN A;  1GOV A;  1O7G B;  4R9L A;  1YIJ 3;  2CFK A;  1YJW 3;  2OQE C;  3KKG A;  5FW5 A;  4RCW A;  4GT6 A;  4IIA A;  2YFI B;  1VQ9 3;  1RJO A;  2GU1 A;  4KFD A;  5CF2 A;  2OCT A;  1DET A;  3JVC A;  4EW5 A;  3C6P B;  4KXF B;  5IF6 A;  3D79 A;  2UZX A;  3SYU A;  2OOV C;  5I97 A;  3NV0 A;  4U7L A;  3D5G A;  3U97 A;  2IUK A;  2P38 A;  1T5Y A;  3REZ A;  4OK0 A;  1LNH A;  3UL5 A;  2UX0 A;  1KOO A;  4C2B B;  2ZL8 A;  3RNT A;  4HM4 B;  1E97 A;  1CYU A;  2OMY A;  1OOK G;  1PY3 A;  1TJD A;  3DGL A;  1ZIW A;  2QGU A;  5DRV A;  3X3Y A;  2XOT A;  4CC4 A;  3G8Z A;  3O53 A;  1AVL A;  3DGO A;  3WOF B;  1H6T A;  2FGT A;  2P0X A;  5HDH A;  3WPH A;  4NKG A;  4R0A A;  1Q40 B;  2W03 A;  2RBI A;  2A15 A;  1O7H B;  1H6U A;  4U09 A;  4BTY A;  1LXE A;  3T8N A;  1IU7 A;  3DXO A;  4P8S A;  3KZT A; 
#chains in the Genus database with same CATH homology
 4XB5 A;  4PEQ B;  3WMD A;  1N8R 4;  3RGR A;  3HX8 A;  3HII A;  4FCJ A;  1IVX A;  3C6N B;  1OCV A;  5GMH A;  3F40 A;  1Q86 4;  5AYR B;  2W6J H;  3CIY A;  2PNC A;  3LXU X;  2K0M A;  3LZA A;  1O6T A;  4XSQ A;  1K73 4;  2KCD A;  1EG9 B;  3OWS A;  1M1K 4;  2CWT A;  3GZY B;  2RFR A;  3I55 3;  1GS3 A;  3WDG B;  2XGN A;  4K90 B;  2WO0 A;  1LTX A;  4UFR A;  3AMO A;  1KC8 4;  2JDI H;  3CPO A;  3G6E 3;  4NHF A;  3LTB A;  3GZB A;  3LTA A;  4LI2 A;  5B4P A;  2Y73 A;  2BNG A;  5IG3 A;  5D3I A;  1EQK A;  4K1U A;  1DS9 A;  1XEC A;  1W01 A;  1OTO A;  3EE1 A;  1O7P B;  1OTM A;  3FCS B;  2JQ5 A;  2GBX B;  3FLJ A;  3SOA A;  3ZYN A;  1M0Z A;  3MHE A;  1VQK 3;  4J0M A;  4X2O A;  4R6F A;  1PU4 A;  1D6Z A;  3K0Z A;  3NBJ A;  4GL6 A;  3MWZ A;  3EHC A;  2BT3 A;  3FF2 A;  3JUN A;  1E3R A;  4STD A;  5HZL B;  1A9N A;  3K9M C;  4R9K A;  1OPY A;  2W2C A;  1M1X B;  2LQV A;  4IT7 A;  5AIG A;  4M7E C;  5IW9 A;  2CHC A;  3OWU A;  1VQM 3;  5D81 A;  2CIU A;  4TZH A;  1OHO A;  4KVH A;  2RA8 A;  2CH9 A;  5GMG A;  1N9J A;  2E2V A;  2GXF A;  2W04 A;  1RKY A;  2Z64 A;  1VQ6 3;  3FG1 A;  1TIJ A;  3G3B A;  3UL7 A;  3F7X A;  3RFS A;  3T0U A;  3ZYJ A;  3DGN A;  2QEX 3;  4AKY A;  2IUJ A;  4HM6 B;  3WA3 A;  1JJ2 2;  1TFK A;  3JUP A;  2STD A;  4H61 A;  1FGQ A;  1C7H A;  3TDG A;  3AMO B;  1YVB I;  1VQ8 3;  2Q4G W;  4ECO A;  3CCQ 3;  2FXT A;  3OJA A;  1A2K A;  1BUQ A;  1FGT A;  4PQ8 A;  3HK4 A;  5CMP A;  3EQQ B;  1KWI A;  3W3M A;  4ARN A;  4IPB A;  4AW4 A;  2C11 A;  5AWC A;  4HM3 B;  2XRX B;  3CC7 3;  3H51 A;  5B0N A;  5AYS C;  3NUV A;  3F7S A;  3D9R A;  3K63 A;  2RCD A;  4Z94 G;  1W6G A;  3CXC 2;  4AEQ A;  4R1K A;  3IPT A;  3UJM A;  3CCE 3;  1ROA A;  4NRE A;  1W4N A;  2Z82 A;  1IVU A;  2Z65 A;  4U08 A;  1Y4K A;  5AI1 A;  3CD6 3;  4R5D A;  1WMO A;  3CVR A;  3CCU 3;  1JB2 A;  1D0B A;  4J4L A;  1UI8 A;  1RRH A;  3KE7 A;  1Q81 4;  1WTH A;  2P05 A;  1STF I;  3PGB A;  3NQZ A;  2W9P A;  2XGL A;  4HM8 B;  4GLP A;  3F9S A;  3UL9 A;  1HU9 A;  5AEW B;  2Z66 A;  1L5G B;  1SIH A;  1IQY A;  1SII A;  2JQD A;  2XWT C;  1RRL A;  1PGV A;  1GWB A;  1N8Q A;  4LXS A;  2E2U A;  1GYB A;  5A5C A;  3P72 A;  3WPB A;  4BV4 R;  2CFL A;  2FNQ A;  2HMM B;  2CG1 A;  1JL5 A;  5ELU A;  2CFW A;  2RSX A;  3B4P A;  4WP5 A;  1GD4 A;  3PCS A;  1NB3 I;  3NV0 B;  5GQR K;  4XBY A;  1ZX2 A;  3EN1 B;  3RW7 A;  1US1 A;  3A79 B;  3G04 C;  2OMX A;  1IT8 A;  2Z7A A;  3CCV 3;  3EB8 A;  1LVN A;  4FMB A;  2O6R A;  4XGO A;  4RBN A;  4WWU C;  4HM0 B;  2OWP A;  1VQP 3;  2CWV A;  2ASS B;  2CG0 A;  3G0K A;  4R80 A;  4FMC A;  2R9U A;  3M19 A;  4L3A A;  1JKG B;  4M7E A;  1XWD C;  5KP4 A;  3MPH A;  4G8A A;  3VSY A;  4X2H A;  3EC9 A;  3G16 A;  1MOL A;  3RJ0 A;  1N5P A;  3G06 A;  1P9A G;  4QBZ A;  1OAC A;  1K28 A;  1JB4 A;  2INX A;  3M8C A;  2GEX A;  1KSI A;  4O2H A;  5JPU A;  3CCM 3;  4L8P A;  1KQS 2;  1K5G C;  1XKU A;  5ELJ A;  3RGX A;  4PEJ A;  3OJA B;  3M18 A;  3KN4 A;  1W8A A;  4V2E A;  5IEN A;  3CPW 2;  2BHM A;  3QK9 A;  4R4K A;  3CMA 3;  4R58 A;  3EBY A;  2QIY A;  4FCM A;  3G39 A;  1WQL B;  4H3U A;  2FT3 A;  5EEO A;  1CEW I;  4FS7 A;  2ML6 A;  4LSO A;  2RR6 A;  4WHA A;  1PFP A;  2CK3 H;  5AWB A;  3NBB A;  2LYX A;  4CIL A;  4EBG A;  2W9Q A;  3T8U A;  1O7N B;  5TGN A;  4B8C D;  4OUQ A;  5A0O B;  2M7O A;  3G71 3;  1OHP A;  3BB9 A;  1VQ5 3;  4LXR A;  1FS2 A;  2B24 B;  3CU3 A;  4AKZ A;  1FA3 A;  3CIG A;  4WFO A;  2R4I A;  3BZ5 A;  1Q42 A;  5EVH A;  3K5T A;  3PCR A;  4WYK B;  4QWT A;  2YX9 A;  2PZV A;  1TFO A;  1UUV B;  2Q07 A;  1JN5 A;  3ALA A;  4N6T A;  5AEU B;  5IER A;  3CC2 3;  1VQN 3;  2OMT A;  3X40 A;  3EN8 A;  1G96 A;  4HYZ A;  2XH9 A;  3BNE A;  2XSO B;  3D3L A;  1FO1 A;  1W00 A;  4N6U A;  3PMH G;  4K17 A;  5AWA A;  1JV2 B;  2E2T A;  5BXQ A;  3WPI A;  1YRG A;  3E3Z A;  3RW6 A;  1JN5 B;  3HZP A;  3DZL A;  2RGQ A;  4QC0 A;  4MQW X;  1F8N A;  3BNC A;  2KRT A;  2BMQ B;  4LMI A;  1U8C B;  2XFS A;  3B8L A;  2ID5 A;  4XDV A;  3F14 A;  3FG4 A;  3WPF A;  4N6O B;  3RDE A;  2CKF B;  4ORL A;  1A90 A;  2CWU A;  5FTT B;  5CLK A;  3EBT A;  2IFG A;  1O7M B;  1GY6 A;  3SVA A;  3CCR 3;  3I0Y A;  1IDP A;  3GRD A;  1P8T A;  4PSJ A;  1ISK A;  3ULV A;  3MG1 A;  4HVN A;  4HKV B;  1WMP A;  3HI7 A;  1U0N D;  4RNY A;  4EC6 A;  3V92 A;  2WGO A;  5JPP A;  4NKH A;  4FMD A;  3DM8 A;  3SXX A;  4MMY B;  2F98 A;  1GD3 A;  2W56 B;  5AII A;  1W5Z A;  3S67 A;  3CCS 3;  1M10 B;  2V9S A;  4LSX A;  4TX4 A;  5KP3 A;  4RZM A;  3RIZ A;  3PXM A;  3SED A;  1W7C A;  2F99 A;  1OTN A;  4AY9 X;  1O6S A;  3S5C A;  5GMF A;  1W6Y A;  1JRQ A;  3KSP A;  1W2B 2;  2HMK B;  1UUW B;  2CA6 A;  3RFE A;  3X3Z A;  1YJN 3;  2CC3 A;  4U06 A;  3GZX B;  2ELL A;  4CNM A;  3WA2 X;  4OQT A;  4RWT C;  3UN9 A;  3W3J A;  4PER A;  4J9A A;  4WP6 A;  4L3F A;  3DUK A;  2V1L A;  3Q1C A;  2IA7 A;  4I4K A;  4JF8 A;  4EZG A;  1TU5 A;  1XCD A;  4HM5 B;  4BSS A;  4V2D A;  1KOH A;  1VZZ A;  1FUW A;  3MSO A;  3NHX A;  4EV2 A;  3OW2 2;  4XBT A;  1A4Y A;  5IYX C;  2L4V A;  4HZ9 B;  3ZYI A;  3EJV A;  1OGZ A;  4CC4 C;  3FXI A;  3MG3 A;  2V70 A;  3N9H A;  1DCE A;  2WQU A;  2HMN B;  4Q62 A;  1NJI 4;  1OH0 A;  2XFT A;  3L0R A;  1VQO 3;  1LOX A;  2OMW A;  2P1M B;  2WOH A;  6STD A;  1QVF 2;  1IQX A;  1WMN A;  5G2G A;  3S29 A;  3SX1 A;  3ROB A;  3CME 3;  4MMX B;  5AIH A;  3I56 3;  4Z8G A;  3W3G A;  2A0Z A;  4KNG A;  4FCZ A;  3HIG A;  4MMZ B;  5BVB A;  3CC4 3;  3SLU A;  1J2B A;  1SQ0 B;  1W2Z A;  2YFJ B;  4L8O A;  4CCV A;  4FCG A;  1OF5 B;  5AIF A;  2XR8 B;  1AVK A;  4J8T A;  3E99 A;  1M9S A;  3KSE D;  5IG4 A;  1Q7Y 4;  1TP6 A;  3PS8 A;  4KFE A;  4OVM A;  5CXO A;  2OTL 3;  4O8S A;  1GY7 A;  7STD A;  1YI2 3;  3LT9 A;  2Z81 A;  1O6V A;  1FGR A;  1K9M 4;  2XSH B;  3JB9 j;  1IVV A;  1AV4 A;  3DGM A;  1IVW A;  4R6J A;  1IQ8 A;  3WN4 A;  1K5D C;  1A2V A;  2XF3 A;  4EYC A;  3BLZ A;  3BNB A;  4R6A A;  3LTC A;  2BNH A;  1OUN A;  3JUM A;  1K41 A;  1IK3 A;  1R4C A;  2XEP A;  3MYT A;  2OMU A;  3O8Y A;  4FR9 A;  3NM7 A;  2UZY A;  3W3N A;  1NWW A;  4GB5 A;  1M90 4;  3GZR A;  4FDW A;  3WPG A;  2O9U X;  5IG5 A;  4Z79 A;  2W0Q A;  3PZW A;  4XBX A;  4N6V 0;  3MG2 A;  4Q53 A;  3ZYO A;  4ARR A;  4LSA A;  3TSR E;  3S27 A;  3RGA A;  8CHO A;  2Z62 A;  4Q3I A;  1SQW A;  2HML B;  3FH1 A;  3STD A;  3F8X A;  3GAX A;  3LYG A;  3MKI A;  4PKI G;  1JB5 A;  1QAK A;  5D83 A;  2OOV A;  4MN8 B;  3NX0 A;  2AST B;  2SBL A;  1DMM A;  3E4G A;  1QMA A;  1WNH A;  4ZM8 A;  1Q82 4;  5GS0 A;  5CMN A;  2Z76 A;  2P1Q B;  1SPU A;  1ULJ B;  4RCA B;  1MNL A;  3OWY A;  1FGM A;  3EX9 A;  2QA4 3;  1ULI B;  2ML5 A;  3OGK B;  5CF1 A;  5LFN A;  3C6O B;  4IM6 A;  1VQ4 3;  1DYU A;  2JE1 A;  1DVC A;  1ZO2 A;  1OGQ A;  2MF7 A;  4HM2 B;  1WWL A;  3BND A;  2Y74 A;  5KP1 A;  3NM2 A;  1V74 A;  2I9W A;  3QRD A;  3IMA B;  2WOF A;  3B7C A;  3NBR A;  1STD A;  3V99 A;  3CNM A;  3X3X A;  2JE0 A;  4R09 A;  4LGQ A;  4WYK A;  1OZN A;  2WFH A;  2Z77 A;  1SJW A;  5DRE A;  4LSC A;  4QXE A;  1JKG A;  3J7Y d;  2BO9 B;  2CW9 A;  3WPE A;  1UI7 A;  4V2C A;  4BSR A;  5STD A;  3VGN A;  3SB4 A;  3DMC A;  3VQ2 A;  1IT7 A;  3KFQ C;  3PYJ A;  2F86 B;  4G1M B;  1IV9 A;  1YHQ 3;  4O3V A;  2O3O A;  3A76 A;  2WQV A;  3LML A;  2D42 A;  1DMQ A;  1HKX A;  1Q40 A;  1UW1 A;  3X42 A;  4I6J B;  4XDW A;  4HM7 B;  4LZI A;  5D82 A;  3U1W A;  1P8V A;  1D6U A;  3UL6 A;  1VQL 3;  1NDO B;  5IEO A;  2C10 A;  1S72 3;  2P1O B;  2WQW A;  4FMZ A;  4H09 A;  3NQY A;  1OGX A;  1M9L A;  5IG0 A;  1E3V A;  1N5H A;  3GOZ A;  1RN7 A;  4FMA A;  3ECF A;  4R5C A;  1S5A A;  3IJE B;  1N9E A;  3JUO A;  5IJC A;  3FKA A;  2OMZ A;  1U5O A;  4K61 A;  1NO3 A;  1TUH A;  3UB1 A;  3WOE B;  2HMO B;  3G4S 3;  4HZB B;  5FGO A;  2BMO B;  2WGQ A;  3EF8 A;  3LT8 A;  4JRF A;  2MC8 A;  3UNL A;  1A67 A;  2P1N B;  3E6J A;  1CQS A;  2ZDJ A;  2BEX A;  5B0T A;  4Y61 B;  3E2J A;  4Z61 C;  3RGZ A;  3ER7 A;  3KII A;  1VQ7 3;  1QAL A;  3ULU A;  5IJB A;  3OX9 A;  4KT1 A;  2CFG A;  3N8B A;  5IEP A;  3GWR A;  3FSD A;  1Z1S A;  3NXJ A;  1EA2 A;  2K54 A;  3SOY A;  1QVG 2;  2O6Q A;  1ROV A;  2GU3 A;  4FHO A;  4R07 A;  3FGY A;  2HMJ B;  3W3K A;  4KFF A;  3K7C A;  3JUQ A;  1KD1 4;  2IMJ A;  4BTX A;  3LTD A;  1EKM A;  4CNC A;  1GY5 A;  4HJL B;  5CK6 A;  3OV4 A;  1YIT 3;  3DY5 A;  1CYV A;  3OGL B;  3H3H A;  5HGR A;  2Z6B A;  4KZ1 A;  3DZE A;  4YEB B;  2GEY A;  4Q3G A;  2CFD A;  1QJG A;  4LI1 A;  1YJ9 3;  3Q2P A;  5IJD A;  2Z7X A;  1G9U A;  3KJ4 A;  2W56 A;  2V9T B;  1FT8 A;  3FF0 A;  4K1V A;  4EXR A;  3VQ1 A;  3FG3 A;  1NU3 A;  3B4O A;  1W6C A;  4LEH A;  1O7W B;  4O02 B;  4MEI A;  5EQL A;  1NB5 I;  1FGO A;  3OXA A;  2OTJ 3;  4P91 A;  4CP6 A;  4L7K A;  1OF5 A;  1Z7X W;  5GS2 B;  3N54 B;  1M9G A;  4FD0 A;  4R08 A;  3FZW A;  2OMV A;  3WPD A;  2D1W A;  1ASK A;  3S28 A;  3ULA A;  2P0M A;  3OGM B;  1OHS A;  4BSU A;  3WPC A;  4EV5 A;  1XEU A;  3O6N A;  4CDL A;  1AR0 A;  2KXG A;  3CCL 3;  3V98 A;  2Z7X B;  1YGE A;  2P1P B;  4ECN A;  4RNZ A;  5LC7 A;  1DFJ I;  3Q90 A;  3F8H A;  4MJD A;  2Y5Q A;  1JNQ A;  3G3A A;  5AWD A;  5JBS A;  4Z64 C;  4N6M A;  1QAF A;  1QYY A;  3LH4 A;  4N3V A;  4R6G A;  4HM1 B;  5AZ5 A;  2OQE A;  4U13 A;  3X41 A;  2Z63 A;  1FQV A;  5LC6 A;  3LOY A;  3WOD G;  2O6S A;  4LSX C;  2WQX A;  3VF1 A;  1DVD A;  1D6Y A;  4XOS A;  3UL8 A;  4C2A B;  4N6L A;  2GBW B;  1W02 A;  4N6N B;  3CNX A;  4XM4 A;  4HQ1 A;  2YFL B;  1K8A 4;  4BTW A;  1IO0 A;  2P09 A;  3W3L A;  4HBR A;  3CCJ 3;  2BMR B;  3RFJ A;  2B1X B;  1IV7 A;  1DMN A;  1O7G B;  1YIJ 3;  4R9L A;  2CFK A;  1YJW 3;  2OQE C;  3KKG A;  5FW5 A;  4RCW A;  4GT6 A;  4IIA A;  2YFI B;  1VQ9 3;  1RJO A;  2GU1 A;  4KFD A;  5CF2 A;  2OCT A;  3JVC A;  3C6P B;  4KXF B;  5IF6 A;  2UZX A;  2OOV C;  5I97 A;  3NV0 A;  4U7L A;  3U97 A;  2IUK A;  2P38 A;  1T5Y A;  3REZ A;  4OK0 A;  1LNH A;  3UL5 A;  2UX0 A;  1KOO A;  4C2B B;  2ZL8 A;  1CYU A;  4HM4 B;  1E97 A;  2OMY A;  1OOK G;  3DGL A;  1ZIW A;  2QGU A;  5DRV A;  3X3Y A;  2XOT A;  4CC4 A;  3G8Z A;  3O53 A;  1AVL A;  3DGO A;  3WOF B;  1H6T A;  2FGT A;  2P0X A;  5HDH A;  3WPH A;  4NKG A;  4R0A A;  1Q40 B;  2W03 A;  2A15 A;  1O7H B;  1H6U A;  4U09 A;  4BTY A;  1LXE A;  3T8N A;  1IU7 A;  3DXO A;  4P8S A;  3KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...