1SQ0B

Crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
265
structure length
265
Chain Sequence
HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNDLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor (vWF) [Contains: Von Willebrand antige
publication title Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 66
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1sq0B00
4U09A 4U7LA 4HQ1A 3ZYIA 4CNMA 3ZYNA 4K17A 1H6TA 5GMHA 4KXFB 4FDWA 4L3AA 1XWDC 3G06A 3RGXA 3W3NA 2XWTC 4P8SA 4R6AA 4R6GA 2Z63A 1K5GC 1O6TA 4Y61B 4NKHA 4Z64C 1ZIWA 2V9TB 1P9AG 4ECOA 4FCGA 2Z7XA 4CILA 5GMFA 1G9UA 2WQUA 1XKUA 4TZHA 1W8AA 4KT1A 3OGMB 3P72A 5AWCA 5AWDA 3ZYJA 4RWTC 4XOSA 4Z94G 4FS7A 1KOHA 4PKIG 2P1NB 2XOTA 5A5CA 4U06A 1A4YA 4J4LA 4UFRA 4M7EA 2OMZA 3RIZA 2Z66A 4LSAA 5AZ5A 2OMWA 2ASSB 1XCDA 1FQVA 3E2JA 4CC4C 1P8TA 4Q62A 3G04C 4RCWA 5GQRK 4U08A 1SQ0B 3WPEA 4V2DA 4WP6A 2Z62A 2WFHA 3A79B 2JE0A 4GLPA 2OMVA 3WPGA 3WPDA 3C6NB 4FHOA 5HDHA 3CIGA 3M19A 4MN8B 4V2CA 4GT6A 3RGZA 3W3JA 3SB4A 3RFJA 5D3IA 4R07A 4CNCA 1OTMA 5LFNA 3O53A 1D0BA 2O6QA 4R58A 1Z7XW 2Z64A 3WN4A 4ECNA 4Q3GA 1M9LA 3RW6A 2Y5QA 1FS2A 4PSJA 3RW7A 4Z8GA 3REZA 4FD0A 3ZYOA 4XGOA 4QBZA 2UZXA 2A0ZA 2Z65A 3E3ZA 5HZLB 3G3BA 2O6RA 4BSSA 1OZNA 2BEXA 3C6PB 1H6UA 3UL7A 1DCEA 2P1QB 1M9SA 4R5CA 4V2EA 5AWAA 4J0MA 2OMXA 1XEUA 1O6VA 3W3LA 4CP6A 1KOOA 4BV4R 3ULVA 3OGLB 2P1PB 3C6OB 4P91A 3RFEA 4R6FA 3W3GA 2Z7XB 3ULAA 4BSUA 3WPBA 1M0ZA 4Z79A 2OMUA 3RJ0A 4OQTA 2JE1A 4PEQB 3WPFA 4CC4A 1IO0A 3OJAA 1OOKG 3G39A 4LSXC 2O6SA 2Q4GW 4Q3IA 3WPIA 2P1MB 3VQ2A 4QXEA 5IYXC 2ASTB 3UL9A 4BSRA 5CMPA 3G3AA 4LI2A 1FO1A 3WPCA 2P1OB 5GMGA 2Z81A 4R0AA 4LSCA 2ID5A 2WQXA 1YRGA 4ARRA 2Z82A 1FT8A 4QC0A 4R6JA 3UN9A 1U0ND 4G8AA 4AW4A 3OJAB 3CIYA 1GWBA 1PGVA 1OTOA 2CA6A 1DFJI 4C2BB 3FXIA 1P8VA 1QYYA 4PQ8A 4MQWX 3KJ4A 2JQDA 2R9UA 1JL5A 3JB9j 3E6JA 3BZ5A 3OGKB 4FMZA 4WYKA 2UZYA 4KNGA 3PMHG 2FT3A 2IFGA 1XECA 2WQWA 3W3MA 1OTNA 4IM6A 5IJCA 2OMYA 4L3FA 2V9SA 2V70A 5AWBA 3UL8A 4M7EC 1K5DC 4AY9X 3E4GA 5CMNA 2ELLA 3W3KA 5GS2B 2WQVA 3M18A 1LTXA 4LXSA 4XSQA 4LI1A 5IJBA 4PERA 5IJDA 4LXRA 4C2AB 4H09A 5GS0A 1DS9A 3DZEA 5B0TA 3TSRE 3O6NA 1A9NA 3VQ1A 4NKGA 4YEBB 4B8CD 1OGQA 4I6JB 2RR6A 3WPHA 2BNHA 3CVRA 5FTTB 1M10B 4R08A 1WWLA 1O6SA 4LSXA 4R09A 2RA8A 5B0NA 4ARNA 5B4PA 4Z61C 3ULUA 3GOZA 4R5DA 2OMTA 3RFSA 4RCAB 4EZGA
chains in the Genus database with same CATH superfamily
4U09A 4U7LA 4HQ1A 3ZYIA 4CNMA 3ZYNA 4K17A 1H6TA 5GMHA 4KXFB 4FDWA 4L3AA 1XWDC 3G06A 3RGXA 3W3NA 2XWTC 4P8SA 4R6AA 4R6GA 2Z63A 1K5GC 1O6TA 4Y61B 4NKHA 4Z64C 1ZIWA 2V9TB 1P9AG 4ECOA 4FCGA 2Z7XA 4CILA 5GMFA 1G9UA 2WQUA 1XKUA 4TZHA 1W8AA 4KT1A 3OGMB 3P72A 5AWCA 5AWDA 3ZYJA 4RWTC 4XOSA 4Z94G 4FS7A 1KOHA 4PKIG 2P1NB 2XOTA 5A5CA 4U06A 1A4YA 4J4LA 4UFRA 4M7EA 2OMZA 3RIZA 2Z66A 4LSAA 5AZ5A 2OMWA 2ASSB 1XCDA 1FQVA 3E2JA 4CC4C 1P8TA 4Q62A 3G04C 4RCWA 5GQRK 4U08A 1SQ0B 3WPEA 4V2DA 4WP6A 2Z62A 2WFHA 3A79B 2JE0A 4GLPA 2OMVA 3WPGA 3WPDA 3C6NB 4FHOA 5HDHA 3CIGA 3M19A 4MN8B 4V2CA 4GT6A 3RGZA 3W3JA 3SB4A 3RFJA 5D3IA 4R07A 4CNCA 1OTMA 5LFNA 3O53A 1D0BA 2O6QA 4R58A 1Z7XW 2Z64A 3WN4A 4ECNA 4Q3GA 1M9LA 3RW6A 2Y5QA 1FS2A 4PSJA 3RW7A 4Z8GA 3REZA 4FD0A 3ZYOA 4XGOA 4QBZA 2UZXA 2A0ZA 2Z65A 3E3ZA 5HZLB 3G3BA 2O6RA 4BSSA 1OZNA 2BEXA 3C6PB 1H6UA 3UL7A 1DCEA 2P1QB 1M9SA 4R5CA 4V2EA 5AWAA 4J0MA 2OMXA 1XEUA 1O6VA 3W3LA 4CP6A 1KOOA 4BV4R 3ULVA 3OGLB 2P1PB 3C6OB 4P91A 3RFEA 4R6FA 3W3GA 2Z7XB 3ULAA 4BSUA 3WPBA 1M0ZA 4Z79A 2OMUA 3RJ0A 4OQTA 2JE1A 4PEQB 4NZRM 3WPFA 4CC4A 1IO0A 3OJAA 1OOKG 3G39A 4LSXC 2O6SA 2Q4GW 4Q3IA 3WPIA 2P1MB 3VQ2A 4QXEA 5IYXC 2ASTB 3UL9A 4BSRA 5CMPA 3G3AA 4LI2A 1FO1A 3WPCA 2P1OB 5GMGA 2Z81A 4R0AA 4LSCA 2ID5A 2WQXA 1YRGA 4ARRA 2Z82A 1FT8A 4QC0A 4R6JA 3UN9A 1U0ND 4G8AA 4AW4A 3OJAB 3CIYA 1GWBA 1PGVA 1OTOA 2CA6A 4NZTM 1DFJI 4C2BB 3FXIA 1P8VA 1QYYA 4PQ8A 4MQWX 3KJ4A 2JQDA 2R9UA 1JL5A 3JB9j 3E6JA 3BZ5A 3OGKB 4FMZA 4WYKA 2UZYA 4KNGA 3PMHG 2FT3A 2IFGA 1XECA 2WQWA 3W3MA 1OTNA 4IM6A 5IJCA 2OMYA 4L3FA 2V9SA 2V70A 5AWBA 3UL8A 4M7EC 1K5DC 4AY9X 3E4GA 5CMNA 2ELLA 3W3KA 5GS2B 2WQVA 3M18A 1LTXA 4LXSA 4XSQA 4LI1A 5IJBA 4PERA 5IJDA 4LXRA 4C2AB 4H09A 5GS0A 1DS9A 3DZEA 5B0TA 3TSRE 3O6NA 1A9NA 3VQ1A 4NKGA 4YEBB 4B8CD 1OGQA 4I6JB 2RR6A 3WPHA 2BNHA 3CVRA 5FTTB 1M10B 4R08A 1WWLA 1O6SA 4LSXA 4R09A 2RA8A 5B0NA 4ARNA 5B4PA 4Z61C 3ULUA 3GOZA 4R5DA 2OMTA 3RFSA 4RCAB 4EZGA
chains in the Genus database with same CATH topology
4U09A 4U7LA 4HQ1A 3ZYIA 4CNMA 3ZYNA 4K17A 1H6TA 5GMHA 4KXFB 4FDWA 4L3AA 1XWDC 3G06A 3RGXA 3W3NA 2XWTC 4P8SA 4R6AA 4R6GA 2Z63A 1K5GC 1O6TA 4Y61B 4NKHA 4Z64C 1ZIWA 2V9TB 1P9AG 4ECOA 4FCGA 2Z7XA 4CILA 5GMFA 1G9UA 2WQUA 1XKUA 4TZHA 1W8AA 4KT1A 3OGMB 3P72A 5AWCA 5AWDA 3ZYJA 4RWTC 4XOSA 4Z94G 4FS7A 1KOHA 4PKIG 2P1NB 2XOTA 5A5CA 4U06A 1A4YA 4J4LA 4UFRA 4M7EA 2OMZA 3RIZA 2Z66A 4LSAA 5AZ5A 2OMWA 2ASSB 1XCDA 1FQVA 3E2JA 4CC4C 1P8TA 4Q62A 3G04C 4RCWA 5GQRK 4U08A 1SQ0B 3WPEA 4V2DA 4WP6A 2Z62A 2WFHA 3A79B 2JE0A 4GLPA 2OMVA 3WPGA 3WPDA 3C6NB 4FHOA 5HDHA 3CIGA 3M19A 4MN8B 4V2CA 4GT6A 3RGZA 3W3JA 3SB4A 3RFJA 5D3IA 4R07A 4CNCA 1OTMA 5LFNA 3O53A 1D0BA 2O6QA 4R58A 1Z7XW 2Z64A 3WN4A 4ECNA 4Q3GA 1M9LA 3RW6A 2Y5QA 1FS2A 4PSJA 3RW7A 4Z8GA 3REZA 4FD0A 3ZYOA 4XGOA 4QBZA 2UZXA 2A0ZA 2Z65A 3E3ZA 5HZLB 3G3BA 2O6RA 4BSSA 1OZNA 2BEXA 3C6PB 1H6UA 3UL7A 1DCEA 2P1QB 1M9SA 4R5CA 4V2EA 5AWAA 4J0MA 2OMXA 1XEUA 1O6VA 3W3LA 4CP6A 1KOOA 4BV4R 3ULVA 3OGLB 2P1PB 3C6OB 4P91A 3RFEA 4R6FA 3W3GA 2Z7XB 3ULAA 4BSUA 3WPBA 1M0ZA 4Z79A 2OMUA 3RJ0A 4OQTA 2JE1A 4PEQB 3WPFA 4CC4A 1IO0A 3OJAA 1OOKG 3G39A 4LSXC 2O6SA 2Q4GW 4Q3IA 3WPIA 2P1MB 3VQ2A 4QXEA 5IYXC 2ASTB 3UL9A 4BSRA 5CMPA 3G3AA 4LI2A 1FO1A 3WPCA 2P1OB 5GMGA 2Z81A 4R0AA 4LSCA 2ID5A 2WQXA 1YRGA 4ARRA 2Z82A 1FT8A 4QC0A 4R6JA 3UN9A 1U0ND 4G8AA 4AW4A 3OJAB 3CIYA 1GWBA 1PGVA 1OTOA 2CA6A 1DFJI 4C2BB 3FXIA 1P8VA 1QYYA 4PQ8A 4MQWX 3KJ4A 2JQDA 2R9UA 1JL5A 3JB9j 3E6JA 3BZ5A 3OGKB 4FMZA 4WYKA 2UZYA 4KNGA 3PMHG 2FT3A 2IFGA 1XECA 2WQWA 3W3MA 1OTNA 4IM6A 5IJCA 2OMYA 4L3FA 2V9SA 2V70A 5AWBA 3UL8A 4M7EC 1K5DC 4AY9X 3E4GA 5CMNA 2ELLA 3W3KA 5GS2B 2WQVA 3M18A 1LTXA 4LXSA 4XSQA 4LI1A 5IJBA 4PERA 5IJDA 4LXRA 4C2AB 4H09A 5GS0A 1DS9A 3DZEA 5B0TA 3TSRE 3O6NA 1A9NA 3VQ1A 4NKGA 4YEBB 4B8CD 1OGQA 4I6JB 2RR6A 3WPHA 2BNHA 3CVRA 5FTTB 1M10B 4R08A 1WWLA 1O6SA 4LSXA 4R09A 2RA8A 5B0NA 4ARNA 5B4PA 4Z61C 3ULUA 3GOZA 4R5DA 2OMTA 3RFSA 4RCAB 4EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U09 A;  4U7L A;  4HQ1 A;  3ZYI A;  4CNM A;  3ZYN A;  4K17 A;  1H6T A;  5GMH A;  4KXF B;  4FDW A;  4L3A A;  1XWD C;  3G06 A;  3RGX A;  3W3N A;  2XWT C;  4P8S A;  4R6A A;  4R6G A;  2Z63 A;  1K5G C;  1O6T A;  4Y61 B;  4NKH A;  4Z64 C;  1ZIW A;  2V9T B;  1P9A G;  4ECO A;  4FCG A;  2Z7X A;  4CIL A;  5GMF A;  1G9U A;  2WQU A;  1XKU A;  4TZH A;  1W8A A;  4KT1 A;  3OGM B;  3P72 A;  5AWC A;  5AWD A;  3ZYJ A;  4RWT C;  4XOS A;  4Z94 G;  4FS7 A;  1KOH A;  4PKI G;  2P1N B;  2XOT A;  5A5C A;  4U06 A;  1A4Y A;  4J4L A;  4UFR A;  4M7E A;  2OMZ A;  3RIZ A;  2Z66 A;  4LSA A;  5AZ5 A;  2OMW A;  2ASS B;  1XCD A;  1FQV A;  3E2J A;  4CC4 C;  1P8T A;  4Q62 A;  3G04 C;  4RCW A;  5GQR K;  4U08 A;  1SQ0 B;  3WPE A;  4V2D A;  4WP6 A;  2Z62 A;  2WFH A;  3A79 B;  2JE0 A;  4GLP A;  2OMV A;  3WPG A;  3WPD A;  3C6N B;  4FHO A;  5HDH A;  3CIG A;  3M19 A;  4MN8 B;  4V2C A;  4GT6 A;  3RGZ A;  3W3J A;  3SB4 A;  3RFJ A;  5D3I A;  4R07 A;  4CNC A;  1OTM A;  5LFN A;  3O53 A;  1D0B A;  2O6Q A;  4R58 A;  1Z7X W;  2Z64 A;  3WN4 A;  4ECN A;  4Q3G A;  1M9L A;  3RW6 A;  2Y5Q A;  1FS2 A;  4PSJ A;  3RW7 A;  4Z8G A;  3REZ A;  4FD0 A;  3ZYO A;  4XGO A;  4QBZ A;  2UZX A;  2A0Z A;  2Z65 A;  3E3Z A;  5HZL B;  3G3B A;  2O6R A;  4BSS A;  1OZN A;  2BEX A;  3C6P B;  1H6U A;  3UL7 A;  1DCE A;  2P1Q B;  1M9S A;  4R5C A;  4V2E A;  5AWA A;  4J0M A;  2OMX A;  1XEU A;  1O6V A;  3W3L A;  4CP6 A;  1KOO A;  4BV4 R;  3ULV A;  3OGL B;  2P1P B;  3C6O B;  4P91 A;  3RFE A;  4R6F A;  3W3G A;  2Z7X B;  3ULA A;  4BSU A;  3WPB A;  1M0Z A;  4Z79 A;  2OMU A;  3RJ0 A;  4OQT A;  2JE1 A;  4PEQ B;  3WPF A;  4CC4 A;  1IO0 A;  3OJA A;  1OOK G;  3G39 A;  4LSX C;  2O6S A;  2Q4G W;  4Q3I A;  3WPI A;  2P1M B;  3VQ2 A;  4QXE A;  5IYX C;  2AST B;  3UL9 A;  4BSR A;  5CMP A;  3G3A A;  4LI2 A;  1FO1 A;  3WPC A;  2P1O B;  5GMG A;  2Z81 A;  4R0A A;  4LSC A;  2ID5 A;  2WQX A;  1YRG A;  4ARR A;  2Z82 A;  1FT8 A;  4QC0 A;  4R6J A;  3UN9 A;  1U0N D;  4G8A A;  4AW4 A;  3OJA B;  3CIY A;  1GWB A;  1PGV A;  1OTO A;  2CA6 A;  1DFJ I;  4C2B B;  3FXI A;  1P8V A;  1QYY A;  4PQ8 A;  4MQW X;  3KJ4 A;  2JQD A;  2R9U A;  1JL5 A;  3JB9 j;  3E6J A;  3BZ5 A;  3OGK B;  4FMZ A;  4WYK A;  2UZY A;  4KNG A;  3PMH G;  2FT3 A;  2IFG A;  1XEC A;  2WQW A;  3W3M A;  1OTN A;  4IM6 A;  5IJC A;  2OMY A;  4L3F A;  2V9S A;  2V70 A;  5AWB A;  3UL8 A;  4M7E C;  1K5D C;  4AY9 X;  3E4G A;  5CMN A;  2ELL A;  3W3K A;  5GS2 B;  2WQV A;  3M18 A;  1LTX A;  4LXS A;  4XSQ A;  4LI1 A;  5IJB A;  4PER A;  5IJD A;  4LXR A;  4C2A B;  4H09 A;  5GS0 A;  1DS9 A;  3DZE A;  5B0T A;  3TSR E;  3O6N A;  1A9N A;  3VQ1 A;  4NKG A;  4YEB B;  4B8C D;  1OGQ A;  4I6J B;  2RR6 A;  3WPH A;  2BNH A;  3CVR A;  5FTT B;  1M10 B;  4R08 A;  1WWL A;  1O6S A;  4LSX A;  4R09 A;  2RA8 A;  5B0N A;  4ARN A;  5B4P A;  4Z61 C;  3ULU A;  3GOZ A;  4R5D A;  2OMT A;  3RFS A;  4RCA B;  4EZG A; 
#chains in the Genus database with same CATH topology
 4U09 A;  4U7L A;  4HQ1 A;  3ZYI A;  4CNM A;  3ZYN A;  4K17 A;  1H6T A;  5GMH A;  4KXF B;  4FDW A;  4L3A A;  1XWD C;  3G06 A;  3RGX A;  3W3N A;  2XWT C;  4P8S A;  4R6A A;  4R6G A;  2Z63 A;  1K5G C;  1O6T A;  4Y61 B;  4NKH A;  4Z64 C;  1ZIW A;  2V9T B;  1P9A G;  4ECO A;  4FCG A;  2Z7X A;  4CIL A;  5GMF A;  1G9U A;  2WQU A;  1XKU A;  4TZH A;  1W8A A;  4KT1 A;  3OGM B;  3P72 A;  5AWC A;  5AWD A;  3ZYJ A;  4RWT C;  4XOS A;  4Z94 G;  4FS7 A;  1KOH A;  4PKI G;  2P1N B;  2XOT A;  5A5C A;  4U06 A;  1A4Y A;  4J4L A;  4UFR A;  4M7E A;  2OMZ A;  3RIZ A;  2Z66 A;  4LSA A;  5AZ5 A;  2OMW A;  2ASS B;  1XCD A;  1FQV A;  3E2J A;  4CC4 C;  1P8T A;  4Q62 A;  3G04 C;  4RCW A;  5GQR K;  4U08 A;  1SQ0 B;  3WPE A;  4V2D A;  4WP6 A;  2Z62 A;  2WFH A;  3A79 B;  2JE0 A;  4GLP A;  2OMV A;  3WPG A;  3WPD A;  3C6N B;  4FHO A;  5HDH A;  3CIG A;  3M19 A;  4MN8 B;  4V2C A;  4GT6 A;  3RGZ A;  3W3J A;  3SB4 A;  3RFJ A;  5D3I A;  4R07 A;  4CNC A;  1OTM A;  5LFN A;  3O53 A;  1D0B A;  2O6Q A;  4R58 A;  1Z7X W;  2Z64 A;  3WN4 A;  4ECN A;  4Q3G A;  1M9L A;  3RW6 A;  2Y5Q A;  1FS2 A;  4PSJ A;  3RW7 A;  4Z8G A;  3REZ A;  4FD0 A;  3ZYO A;  4XGO A;  4QBZ A;  2UZX A;  2A0Z A;  2Z65 A;  3E3Z A;  5HZL B;  3G3B A;  2O6R A;  4BSS A;  1OZN A;  2BEX A;  3C6P B;  1H6U A;  3UL7 A;  1DCE A;  2P1Q B;  1M9S A;  4R5C A;  4V2E A;  5AWA A;  4J0M A;  2OMX A;  1XEU A;  1O6V A;  3W3L A;  4CP6 A;  1KOO A;  4BV4 R;  3ULV A;  3OGL B;  2P1P B;  3C6O B;  4P91 A;  3RFE A;  4R6F A;  3W3G A;  2Z7X B;  3ULA A;  4BSU A;  3WPB A;  1M0Z A;  4Z79 A;  2OMU A;  3RJ0 A;  4OQT A;  2JE1 A;  4PEQ B;  4NZR M;  3WPF A;  4CC4 A;  1IO0 A;  3OJA A;  1OOK G;  3G39 A;  4LSX C;  2O6S A;  2Q4G W;  4Q3I A;  3WPI A;  2P1M B;  3VQ2 A;  4QXE A;  5IYX C;  2AST B;  3UL9 A;  4BSR A;  5CMP A;  3G3A A;  4LI2 A;  1FO1 A;  3WPC A;  2P1O B;  5GMG A;  2Z81 A;  4R0A A;  4LSC A;  2ID5 A;  2WQX A;  1YRG A;  4ARR A;  2Z82 A;  1FT8 A;  4QC0 A;  4R6J A;  3UN9 A;  1U0N D;  4G8A A;  4AW4 A;  3OJA B;  3CIY A;  1GWB A;  1PGV A;  1OTO A;  2CA6 A;  4NZT M;  1DFJ I;  4C2B B;  3FXI A;  1P8V A;  1QYY A;  4PQ8 A;  4MQW X;  3KJ4 A;  2JQD A;  2R9U A;  1JL5 A;  3JB9 j;  3E6J A;  3BZ5 A;  3OGK B;  4FMZ A;  4WYK A;  2UZY A;  4KNG A;  3PMH G;  2FT3 A;  2IFG A;  1XEC A;  2WQW A;  3W3M A;  1OTN A;  4IM6 A;  5IJC A;  2OMY A;  4L3F A;  2V9S A;  2V70 A;  5AWB A;  3UL8 A;  4M7E C;  1K5D C;  4AY9 X;  3E4G A;  5CMN A;  2ELL A;  3W3K A;  5GS2 B;  2WQV A;  3M18 A;  1LTX A;  4LXS A;  4XSQ A;  4LI1 A;  5IJB A;  4PER A;  5IJD A;  4LXR A;  4C2A B;  4H09 A;  5GS0 A;  1DS9 A;  3DZE A;  5B0T A;  3TSR E;  3O6N A;  1A9N A;  3VQ1 A;  4NKG A;  4YEB B;  4B8C D;  1OGQ A;  4I6J B;  2RR6 A;  3WPH A;  2BNH A;  3CVR A;  5FTT B;  1M10 B;  4R08 A;  1WWL A;  1O6S A;  4LSX A;  4R09 A;  2RA8 A;  5B0N A;  4ARN A;  5B4P A;  4Z61 C;  3ULU A;  3GOZ A;  4R5D A;  2OMT A;  3RFS A;  4RCA B;  4EZG A; 
#chains in the Genus database with same CATH homology
 4U09 A;  4U7L A;  4HQ1 A;  3ZYI A;  4CNM A;  3ZYN A;  4K17 A;  1H6T A;  5GMH A;  4KXF B;  4FDW A;  4L3A A;  1XWD C;  3G06 A;  3RGX A;  3W3N A;  2XWT C;  4P8S A;  4R6A A;  4R6G A;  2Z63 A;  1K5G C;  1O6T A;  4Y61 B;  4NKH A;  4Z64 C;  1ZIW A;  2V9T B;  1P9A G;  4ECO A;  4FCG A;  2Z7X A;  4CIL A;  5GMF A;  1G9U A;  2WQU A;  1XKU A;  4TZH A;  1W8A A;  4KT1 A;  3OGM B;  3P72 A;  5AWC A;  5AWD A;  3ZYJ A;  4RWT C;  4XOS A;  4Z94 G;  4FS7 A;  1KOH A;  4PKI G;  2P1N B;  2XOT A;  5A5C A;  4U06 A;  1A4Y A;  4J4L A;  4UFR A;  4M7E A;  2OMZ A;  3RIZ A;  2Z66 A;  4LSA A;  5AZ5 A;  2OMW A;  2ASS B;  1XCD A;  1FQV A;  3E2J A;  4CC4 C;  1P8T A;  4Q62 A;  3G04 C;  4RCW A;  5GQR K;  4U08 A;  1SQ0 B;  3WPE A;  4V2D A;  4WP6 A;  2Z62 A;  2WFH A;  3A79 B;  2JE0 A;  4GLP A;  2OMV A;  3WPG A;  3WPD A;  3C6N B;  4FHO A;  5HDH A;  3CIG A;  3M19 A;  4MN8 B;  4V2C A;  4GT6 A;  3RGZ A;  3W3J A;  3SB4 A;  3RFJ A;  5D3I A;  4R07 A;  4CNC A;  1OTM A;  5LFN A;  3O53 A;  1D0B A;  2O6Q A;  4R58 A;  1Z7X W;  2Z64 A;  3WN4 A;  4ECN A;  4Q3G A;  1M9L A;  3RW6 A;  2Y5Q A;  1FS2 A;  4PSJ A;  3RW7 A;  4Z8G A;  3REZ A;  4FD0 A;  3ZYO A;  4XGO A;  4QBZ A;  2UZX A;  2A0Z A;  2Z65 A;  3E3Z A;  5HZL B;  3G3B A;  2O6R A;  4BSS A;  1OZN A;  2BEX A;  3C6P B;  1H6U A;  3UL7 A;  1DCE A;  2P1Q B;  1M9S A;  4R5C A;  4V2E A;  5AWA A;  4J0M A;  2OMX A;  1XEU A;  1O6V A;  3W3L A;  4CP6 A;  1KOO A;  4BV4 R;  3ULV A;  3OGL B;  2P1P B;  3C6O B;  4P91 A;  3RFE A;  4R6F A;  3W3G A;  2Z7X B;  3ULA A;  4BSU A;  3WPB A;  1M0Z A;  4Z79 A;  2OMU A;  3RJ0 A;  4OQT A;  2JE1 A;  4PEQ B;  3WPF A;  4CC4 A;  1IO0 A;  3OJA A;  1OOK G;  3G39 A;  4LSX C;  2O6S A;  2Q4G W;  4Q3I A;  3WPI A;  2P1M B;  3VQ2 A;  4QXE A;  5IYX C;  2AST B;  3UL9 A;  4BSR A;  5CMP A;  3G3A A;  4LI2 A;  1FO1 A;  3WPC A;  2P1O B;  5GMG A;  2Z81 A;  4R0A A;  4LSC A;  2ID5 A;  2WQX A;  1YRG A;  4ARR A;  2Z82 A;  1FT8 A;  4QC0 A;  4R6J A;  3UN9 A;  1U0N D;  4G8A A;  4AW4 A;  3OJA B;  3CIY A;  1GWB A;  1PGV A;  1OTO A;  2CA6 A;  1DFJ I;  4C2B B;  3FXI A;  1P8V A;  1QYY A;  4PQ8 A;  4MQW X;  3KJ4 A;  2JQD A;  2R9U A;  1JL5 A;  3JB9 j;  3E6J A;  3BZ5 A;  3OGK B;  4FMZ A;  4WYK A;  2UZY A;  4KNG A;  3PMH G;  2FT3 A;  2IFG A;  1XEC A;  2WQW A;  3W3M A;  1OTN A;  4IM6 A;  5IJC A;  2OMY A;  4L3F A;  2V9S A;  2V70 A;  5AWB A;  3UL8 A;  4M7E C;  1K5D C;  4AY9 X;  3E4G A;  5CMN A;  2ELL A;  3W3K A;  5GS2 B;  2WQV A;  3M18 A;  1LTX A;  4LXS A;  4XSQ A;  4LI1 A;  5IJB A;  4PER A;  5IJD A;  4LXR A;  4C2A B;  4H09 A;  5GS0 A;  1DS9 A;  3DZE A;  5B0T A;  3TSR E;  3O6N A;  1A9N A;  3VQ1 A;  4NKG A;  4YEB B;  4B8C D;  1OGQ A;  4I6J B;  2RR6 A;  3WPH A;  2BNH A;  3CVR A;  5FTT B;  1M10 B;  4R08 A;  1WWL A;  1O6S A;  4LSX A;  4R09 A;  2RA8 A;  5B0N A;  4ARN A;  5B4P A;  4Z61 C;  3ULU A;  3GOZ A;  4R5D A;  2OMT A;  3RFS A;  4RCA B;  4EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...