1SQ0B

Crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
265
structure length
265
Chain Sequence
HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNDLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Von Willebrand factor (vWF) [Contains: Von Willebrand antige
total genus 66
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1sq0B00
4CILA 4CNMA 3OJAB 4L3FA 4M7EA 4WP6A 4ARNA 1XWDC 3JB9j 5AWBA 3O6NA 3OGKB 3OGMB 3OJAA 4IM6A 2XWTC 1H6UA 4PERA 4R6FA 3RGZA 3W3MA 3WPDA 3G3AA 3W3KA 4CP6A 4G8AA 2IFGA 1OTOA 4U09A 5B0TA 4HQ1A 4Z79A 5GMHA 4LSXA 3RW6A 4OQTA 1M9SA 4J4LA 4CC4A 4LXSA 4V2DA 4YEBB 3W3NA 4J0MA 3W3LA 3CIYA 4PEQB 1K5GC 4L3AA 2BNHA 4LSCA 4NKHA 4PQ8A 4RCAB 4Q3IA 4CC4C 1DFJI 1A4YA 4R6GA 4RWTC 4XOSA 2WQVA 4LI2A 3TSRE 2WQWA 2P1PB 4P8SA 2ASSB 4BSSA 4LSXC 1K5DC 4KNGA 4ECNA 1P8VA 5HZLB 3RJ0A 5GMGA 2CA6A 4XSQA 4NKGA 2UZYA 1PGVA 3ZYNA 2FT3A 2WFHA 2Z82A 3UL7A 4R08A 5AWAA 3E6JA 4FD0A 2OMUA 4R07A 4R0AA 3WPFA 1D0BA 3WPCA 3REZA 4C2BB 4GT6A 3M18A 2OMVA 1FT8A 5LFNA 5GS2B 3E4GA 1FQVA 2RA8A 2UZXA 4R09A 1P9AG 1YRGA 3G39A 4UFRA 4B8CD 3WPGA 1OOKG 2Z62A 3ULUA 1ZIWA 1O6TA 4FDWA 5B4PA 2JQDA 1Z7XW 1W8AA 2BEXA 1G9UA 1XEUA 2O6RA 2Z7XA 3UN9A 4EZGA 3DZEA 3RIZA 3G06A 5GS0A 2A0ZA 4KT1A 4BSRA 4R6AA 4CNCA 4LSAA 1KOOA 2Z7XB 4V2CA 4QBZA 2OMTA 4GLPA 3ZYJA 3WPEA 5B0NA 5A5CA 1SQ0B 2OMZA 4ECOA 4FS7A 3CIGA 4I6JB 2V9TB 3BZ5A 4KXFB 4Z94G 4R6JA 3RFSA 4Q3GA 5AZ5A 3O53A 4PKIG 5AWDA 2OMWA 4V2EA 3VQ1A 2Z65A 4QXEA 3GOZA 4P91A 4Y61B 2P1QB 3RFEA 3RGXA 4U06A 1M10B 1DCEA 1O6SA 2P1OB 5AWCA 5GMFA 3ULAA 1KOHA 4C2AB 4U08A 3WPIA 1WWLA 1FO1A 1OTNA 2XOTA 2RR6A 4FCGA 4RCWA 3VQ2A 4QC0A 1FS2A 2ELLA 3WPHA 2OMYA 1JL5A 1P8TA 2Z64A 4FMZA 4M7EC 3P72A 3W3JA 3WPBA 3SB4A 4R58A 1XECA 4Q62A 2Z81A 4AW4A 3ULVA 4XGOA 1DS9A 4R5DA 1OTMA 1XCDA 2P1NB 2V70A 3C6OB 2OMXA 4WYKA 4MQWX 3UL9A 5IJCA 5CMPA 2O6SA 4K17A 5IYXC 1OZNA 1M9LA 2WQXA 4ARRA 2Z66A 1A9NA 2Q4GW 2Z63A 4FHOA 4H09A 5IJBA 3G04C 5GQRK 1GWBA 1IO0A 3PMHG 3M19A 2O6QA 2WQUA 4AY9X 2ASTB 4R5CA 1OGQA 1U0ND 2V9SA 4PSJA 5D3IA 4LI1A 3RFJA 5HDHA 5CMNA 1QYYA 3ZYOA 2Y5QA 3ZYIA 3RW7A 3C6PB 3E3ZA 3WN4A 1LTXA 2JE0A 2R9UA 4MN8B 4Z64C 5IJDA 3UL8A 1H6TA 4Z61C 4TZHA 3FXIA 3CVRA 3OGLB 4LXRA 4U7LA 3E2JA 2JE1A 1M0ZA 1XKUA 4BSUA 4BV4R 2P1MB 3KJ4A 3W3GA 1O6VA 3G3BA 5FTTB 2ID5A 4Z8GA 3A79B 3C6NB
chains in the Genus database with same CATH superfamily
4CILA 4CNMA 3OJAB 4L3FA 4M7EA 4WP6A 4ARNA 1XWDC 3JB9j 5AWBA 3O6NA 3OGKB 3OGMB 3OJAA 4IM6A 2XWTC 1H6UA 4PERA 4R6FA 3RGZA 3W3MA 3WPDA 3G3AA 3W3KA 4CP6A 4G8AA 2IFGA 1OTOA 4U09A 5B0TA 4HQ1A 4Z79A 5GMHA 4LSXA 3RW6A 4OQTA 1M9SA 4J4LA 4CC4A 4LXSA 4V2DA 4YEBB 3W3NA 4J0MA 3W3LA 3CIYA 4PEQB 1K5GC 4L3AA 2BNHA 4LSCA 4NKHA 4PQ8A 4RCAB 4Q3IA 4CC4C 1DFJI 1A4YA 4R6GA 4RWTC 4XOSA 2WQVA 4LI2A 3TSRE 2WQWA 2P1PB 4P8SA 2ASSB 4BSSA 4LSXC 1K5DC 4KNGA 4ECNA 1P8VA 5HZLB 3RJ0A 5GMGA 2CA6A 4XSQA 4NKGA 2UZYA 1PGVA 3ZYNA 2FT3A 2WFHA 2Z82A 3UL7A 4R08A 5AWAA 3E6JA 4FD0A 2OMUA 4R07A 4R0AA 3WPFA 1D0BA 3WPCA 3REZA 4C2BB 4GT6A 3M18A 2OMVA 1FT8A 5LFNA 5GS2B 3E4GA 1FQVA 2RA8A 2UZXA 4R09A 1P9AG 1YRGA 3G39A 4UFRA 4B8CD 3WPGA 1OOKG 2Z62A 3ULUA 1ZIWA 1O6TA 4FDWA 5B4PA 2JQDA 1Z7XW 1W8AA 2BEXA 1G9UA 1XEUA 2O6RA 2Z7XA 3UN9A 4EZGA 3DZEA 3RIZA 3G06A 5GS0A 2A0ZA 4KT1A 4BSRA 4R6AA 4CNCA 4LSAA 1KOOA 2Z7XB 4V2CA 4QBZA 2OMTA 4GLPA 3ZYJA 3WPEA 5B0NA 5A5CA 1SQ0B 2OMZA 4ECOA 4FS7A 3CIGA 4I6JB 2V9TB 3BZ5A 4KXFB 4Z94G 4R6JA 3RFSA 4Q3GA 5AZ5A 3O53A 4PKIG 5AWDA 2OMWA 4V2EA 3VQ1A 2Z65A 4QXEA 3GOZA 4P91A 4Y61B 2P1QB 3RFEA 3RGXA 4U06A 1M10B 1DCEA 1O6SA 2P1OB 5AWCA 5GMFA 4NZRM 1KOHA 3ULAA 4U08A 4C2AB 3WPIA 1WWLA 1FO1A 1OTNA 2XOTA 2RR6A 4FCGA 4RCWA 3VQ2A 4QC0A 1FS2A 2ELLA 3WPHA 2OMYA 1JL5A 1P8TA 2Z64A 4FMZA 4M7EC 3P72A 3W3JA 3WPBA 3SB4A 4R58A 1XECA 4Q62A 2Z81A 4AW4A 3ULVA 4XGOA 1DS9A 4R5DA 1OTMA 1XCDA 2P1NB 2V70A 3C6OB 2OMXA 4WYKA 4MQWX 3UL9A 5IJCA 5CMPA 2O6SA 4K17A 5IYXC 1OZNA 1M9LA 2WQXA 4ARRA 2Z66A 1A9NA 2Q4GW 2Z63A 4FHOA 4H09A 5IJBA 3G04C 5GQRK 1GWBA 1IO0A 3PMHG 3M19A 2O6QA 2WQUA 4AY9X 2ASTB 4R5CA 1OGQA 1U0ND 2V9SA 4NZTM 4PSJA 4LI1A 5D3IA 3RFJA 5HDHA 5CMNA 1QYYA 3ZYOA 2Y5QA 3ZYIA 3RW7A 3C6PB 3E3ZA 3WN4A 1LTXA 2JE0A 2R9UA 4MN8B 4Z64C 5IJDA 3UL8A 1H6TA 4Z61C 4TZHA 3FXIA 3CVRA 3OGLB 4LXRA 4U7LA 3E2JA 2JE1A 1M0ZA 1XKUA 4BSUA 4BV4R 2P1MB 3KJ4A 3W3GA 1O6VA 3G3BA 5FTTB 2ID5A 4Z8GA 3A79B 3C6NB
chains in the Genus database with same CATH topology
4CILA 4CNMA 3OJAB 4L3FA 4M7EA 4WP6A 4ARNA 1XWDC 3JB9j 5AWBA 3O6NA 3OGKB 3OGMB 3OJAA 4IM6A 2XWTC 1H6UA 4PERA 4R6FA 3RGZA 3W3MA 3WPDA 3G3AA 3W3KA 4CP6A 4G8AA 2IFGA 1OTOA 4U09A 5B0TA 4HQ1A 4Z79A 5GMHA 4LSXA 3RW6A 4OQTA 1M9SA 4J4LA 4CC4A 4LXSA 4V2DA 4YEBB 3W3NA 4J0MA 3W3LA 3CIYA 4PEQB 1K5GC 4L3AA 2BNHA 4LSCA 4NKHA 4PQ8A 4RCAB 4Q3IA 4CC4C 1DFJI 1A4YA 4R6GA 4RWTC 4XOSA 2WQVA 4LI2A 3TSRE 2WQWA 2P1PB 4P8SA 2ASSB 4BSSA 4LSXC 1K5DC 4KNGA 4ECNA 1P8VA 5HZLB 3RJ0A 5GMGA 2CA6A 4XSQA 4NKGA 2UZYA 1PGVA 3ZYNA 2FT3A 2WFHA 2Z82A 3UL7A 4R08A 5AWAA 3E6JA 4FD0A 2OMUA 4R07A 4R0AA 3WPFA 1D0BA 3WPCA 3REZA 4C2BB 4GT6A 3M18A 2OMVA 1FT8A 5LFNA 5GS2B 3E4GA 1FQVA 2RA8A 2UZXA 4R09A 1P9AG 1YRGA 3G39A 4UFRA 4B8CD 3WPGA 1OOKG 2Z62A 3ULUA 1ZIWA 1O6TA 4FDWA 5B4PA 2JQDA 1Z7XW 1W8AA 2BEXA 1G9UA 1XEUA 2O6RA 2Z7XA 3UN9A 4EZGA 3DZEA 3RIZA 3G06A 5GS0A 2A0ZA 4KT1A 4BSRA 4R6AA 4CNCA 4LSAA 1KOOA 2Z7XB 4V2CA 4QBZA 2OMTA 4GLPA 3ZYJA 3WPEA 5B0NA 5A5CA 1SQ0B 2OMZA 4ECOA 4FS7A 3CIGA 4I6JB 2V9TB 3BZ5A 4KXFB 4Z94G 4R6JA 3RFSA 4Q3GA 5AZ5A 3O53A 4PKIG 5AWDA 2OMWA 4V2EA 3VQ1A 2Z65A 4QXEA 3GOZA 4P91A 4Y61B 2P1QB 3RFEA 3RGXA 4U06A 1M10B 1DCEA 1O6SA 2P1OB 5AWCA 5GMFA 3ULAA 1KOHA 4C2AB 4U08A 3WPIA 1WWLA 1FO1A 1OTNA 2XOTA 2RR6A 4FCGA 4RCWA 3VQ2A 4QC0A 1FS2A 2ELLA 3WPHA 2OMYA 1JL5A 1P8TA 2Z64A 4FMZA 4M7EC 3P72A 3W3JA 3WPBA 3SB4A 4R58A 1XECA 4Q62A 2Z81A 4AW4A 3ULVA 4XGOA 1DS9A 4R5DA 1OTMA 1XCDA 2P1NB 2V70A 3C6OB 2OMXA 4WYKA 4MQWX 3UL9A 5IJCA 5CMPA 2O6SA 4K17A 5IYXC 1OZNA 1M9LA 2WQXA 4ARRA 2Z66A 1A9NA 2Q4GW 2Z63A 4FHOA 4H09A 5IJBA 3G04C 5GQRK 1GWBA 1IO0A 3PMHG 3M19A 2O6QA 2WQUA 4AY9X 2ASTB 4R5CA 1OGQA 1U0ND 2V9SA 4PSJA 5D3IA 4LI1A 3RFJA 5HDHA 5CMNA 1QYYA 3ZYOA 2Y5QA 3ZYIA 3RW7A 3C6PB 3E3ZA 3WN4A 1LTXA 2JE0A 2R9UA 4MN8B 4Z64C 5IJDA 3UL8A 1H6TA 4Z61C 4TZHA 3FXIA 3CVRA 3OGLB 4LXRA 4U7LA 3E2JA 2JE1A 1M0ZA 1XKUA 4BSUA 4BV4R 2P1MB 3KJ4A 3W3GA 1O6VA 3G3BA 5FTTB 2ID5A 4Z8GA 3A79B 3C6NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIL A;  4CNM A;  3OJA B;  4L3F A;  4M7E A;  4WP6 A;  4ARN A;  1XWD C;  3JB9 j;  5AWB A;  3O6N A;  3OGK B;  3OGM B;  3OJA A;  4IM6 A;  2XWT C;  1H6U A;  4PER A;  4R6F A;  3RGZ A;  3W3M A;  3WPD A;  3G3A A;  3W3K A;  4CP6 A;  4G8A A;  2IFG A;  1OTO A;  4U09 A;  5B0T A;  4HQ1 A;  4Z79 A;  5GMH A;  4LSX A;  3RW6 A;  4OQT A;  1M9S A;  4J4L A;  4CC4 A;  4LXS A;  4V2D A;  4YEB B;  3W3N A;  4J0M A;  3W3L A;  3CIY A;  4PEQ B;  1K5G C;  4L3A A;  2BNH A;  4LSC A;  4NKH A;  4PQ8 A;  4RCA B;  4Q3I A;  4CC4 C;  1DFJ I;  1A4Y A;  4R6G A;  4RWT C;  4XOS A;  2WQV A;  4LI2 A;  3TSR E;  2WQW A;  2P1P B;  4P8S A;  2ASS B;  4BSS A;  4LSX C;  1K5D C;  4KNG A;  4ECN A;  1P8V A;  5HZL B;  3RJ0 A;  5GMG A;  2CA6 A;  4XSQ A;  4NKG A;  2UZY A;  1PGV A;  3ZYN A;  2FT3 A;  2WFH A;  2Z82 A;  3UL7 A;  4R08 A;  5AWA A;  3E6J A;  4FD0 A;  2OMU A;  4R07 A;  4R0A A;  3WPF A;  1D0B A;  3WPC A;  3REZ A;  4C2B B;  4GT6 A;  3M18 A;  2OMV A;  1FT8 A;  5LFN A;  5GS2 B;  3E4G A;  1FQV A;  2RA8 A;  2UZX A;  4R09 A;  1P9A G;  1YRG A;  3G39 A;  4UFR A;  4B8C D;  3WPG A;  1OOK G;  2Z62 A;  3ULU A;  1ZIW A;  1O6T A;  4FDW A;  5B4P A;  2JQD A;  1Z7X W;  1W8A A;  2BEX A;  1G9U A;  1XEU A;  2O6R A;  2Z7X A;  3UN9 A;  4EZG A;  3DZE A;  3RIZ A;  3G06 A;  5GS0 A;  2A0Z A;  4KT1 A;  4BSR A;  4R6A A;  4CNC A;  4LSA A;  1KOO A;  2Z7X B;  4V2C A;  4QBZ A;  2OMT A;  4GLP A;  3ZYJ A;  3WPE A;  5B0N A;  5A5C A;  1SQ0 B;  2OMZ A;  4ECO A;  4FS7 A;  3CIG A;  4I6J B;  2V9T B;  3BZ5 A;  4KXF B;  4Z94 G;  4R6J A;  3RFS A;  4Q3G A;  5AZ5 A;  3O53 A;  4PKI G;  5AWD A;  2OMW A;  4V2E A;  3VQ1 A;  2Z65 A;  4QXE A;  3GOZ A;  4P91 A;  4Y61 B;  2P1Q B;  3RFE A;  3RGX A;  4U06 A;  1M10 B;  1DCE A;  1O6S A;  2P1O B;  5AWC A;  5GMF A;  3ULA A;  1KOH A;  4C2A B;  4U08 A;  3WPI A;  1WWL A;  1FO1 A;  1OTN A;  2XOT A;  2RR6 A;  4FCG A;  4RCW A;  3VQ2 A;  4QC0 A;  1FS2 A;  2ELL A;  3WPH A;  2OMY A;  1JL5 A;  1P8T A;  2Z64 A;  4FMZ A;  4M7E C;  3P72 A;  3W3J A;  3WPB A;  3SB4 A;  4R58 A;  1XEC A;  4Q62 A;  2Z81 A;  4AW4 A;  3ULV A;  4XGO A;  1DS9 A;  4R5D A;  1OTM A;  1XCD A;  2P1N B;  2V70 A;  3C6O B;  2OMX A;  4WYK A;  4MQW X;  3UL9 A;  5IJC A;  5CMP A;  2O6S A;  4K17 A;  5IYX C;  1OZN A;  1M9L A;  2WQX A;  4ARR A;  2Z66 A;  1A9N A;  2Q4G W;  2Z63 A;  4FHO A;  4H09 A;  5IJB A;  3G04 C;  5GQR K;  1GWB A;  1IO0 A;  3PMH G;  3M19 A;  2O6Q A;  2WQU A;  4AY9 X;  2AST B;  4R5C A;  1OGQ A;  1U0N D;  2V9S A;  4PSJ A;  5D3I A;  4LI1 A;  3RFJ A;  5HDH A;  5CMN A;  1QYY A;  3ZYO A;  2Y5Q A;  3ZYI A;  3RW7 A;  3C6P B;  3E3Z A;  3WN4 A;  1LTX A;  2JE0 A;  2R9U A;  4MN8 B;  4Z64 C;  5IJD A;  3UL8 A;  1H6T A;  4Z61 C;  4TZH A;  3FXI A;  3CVR A;  3OGL B;  4LXR A;  4U7L A;  3E2J A;  2JE1 A;  1M0Z A;  1XKU A;  4BSU A;  4BV4 R;  2P1M B;  3KJ4 A;  3W3G A;  1O6V A;  3G3B A;  5FTT B;  2ID5 A;  4Z8G A;  3A79 B;  3C6N B; 
#chains in the Genus database with same CATH topology
 4CIL A;  4CNM A;  3OJA B;  4L3F A;  4M7E A;  4WP6 A;  4ARN A;  1XWD C;  3JB9 j;  5AWB A;  3O6N A;  3OGK B;  3OGM B;  3OJA A;  4IM6 A;  2XWT C;  1H6U A;  4PER A;  4R6F A;  3RGZ A;  3W3M A;  3WPD A;  3G3A A;  3W3K A;  4CP6 A;  4G8A A;  2IFG A;  1OTO A;  4U09 A;  5B0T A;  4HQ1 A;  4Z79 A;  5GMH A;  4LSX A;  3RW6 A;  4OQT A;  1M9S A;  4J4L A;  4CC4 A;  4LXS A;  4V2D A;  4YEB B;  3W3N A;  4J0M A;  3W3L A;  3CIY A;  4PEQ B;  1K5G C;  4L3A A;  2BNH A;  4LSC A;  4NKH A;  4PQ8 A;  4RCA B;  4Q3I A;  4CC4 C;  1DFJ I;  1A4Y A;  4R6G A;  4RWT C;  4XOS A;  2WQV A;  4LI2 A;  3TSR E;  2WQW A;  2P1P B;  4P8S A;  2ASS B;  4BSS A;  4LSX C;  1K5D C;  4KNG A;  4ECN A;  1P8V A;  5HZL B;  3RJ0 A;  5GMG A;  2CA6 A;  4XSQ A;  4NKG A;  2UZY A;  1PGV A;  3ZYN A;  2FT3 A;  2WFH A;  2Z82 A;  3UL7 A;  4R08 A;  5AWA A;  3E6J A;  4FD0 A;  2OMU A;  4R07 A;  4R0A A;  3WPF A;  1D0B A;  3WPC A;  3REZ A;  4C2B B;  4GT6 A;  3M18 A;  2OMV A;  1FT8 A;  5LFN A;  5GS2 B;  3E4G A;  1FQV A;  2RA8 A;  2UZX A;  4R09 A;  1P9A G;  1YRG A;  3G39 A;  4UFR A;  4B8C D;  3WPG A;  1OOK G;  2Z62 A;  3ULU A;  1ZIW A;  1O6T A;  4FDW A;  5B4P A;  2JQD A;  1Z7X W;  1W8A A;  2BEX A;  1G9U A;  1XEU A;  2O6R A;  2Z7X A;  3UN9 A;  4EZG A;  3DZE A;  3RIZ A;  3G06 A;  5GS0 A;  2A0Z A;  4KT1 A;  4BSR A;  4R6A A;  4CNC A;  4LSA A;  1KOO A;  2Z7X B;  4V2C A;  4QBZ A;  2OMT A;  4GLP A;  3ZYJ A;  3WPE A;  5B0N A;  5A5C A;  1SQ0 B;  2OMZ A;  4ECO A;  4FS7 A;  3CIG A;  4I6J B;  2V9T B;  3BZ5 A;  4KXF B;  4Z94 G;  4R6J A;  3RFS A;  4Q3G A;  5AZ5 A;  3O53 A;  4PKI G;  5AWD A;  2OMW A;  4V2E A;  3VQ1 A;  2Z65 A;  4QXE A;  3GOZ A;  4P91 A;  4Y61 B;  2P1Q B;  3RFE A;  3RGX A;  4U06 A;  1M10 B;  1DCE A;  1O6S A;  2P1O B;  5AWC A;  5GMF A;  4NZR M;  1KOH A;  3ULA A;  4U08 A;  4C2A B;  3WPI A;  1WWL A;  1FO1 A;  1OTN A;  2XOT A;  2RR6 A;  4FCG A;  4RCW A;  3VQ2 A;  4QC0 A;  1FS2 A;  2ELL A;  3WPH A;  2OMY A;  1JL5 A;  1P8T A;  2Z64 A;  4FMZ A;  4M7E C;  3P72 A;  3W3J A;  3WPB A;  3SB4 A;  4R58 A;  1XEC A;  4Q62 A;  2Z81 A;  4AW4 A;  3ULV A;  4XGO A;  1DS9 A;  4R5D A;  1OTM A;  1XCD A;  2P1N B;  2V70 A;  3C6O B;  2OMX A;  4WYK A;  4MQW X;  3UL9 A;  5IJC A;  5CMP A;  2O6S A;  4K17 A;  5IYX C;  1OZN A;  1M9L A;  2WQX A;  4ARR A;  2Z66 A;  1A9N A;  2Q4G W;  2Z63 A;  4FHO A;  4H09 A;  5IJB A;  3G04 C;  5GQR K;  1GWB A;  1IO0 A;  3PMH G;  3M19 A;  2O6Q A;  2WQU A;  4AY9 X;  2AST B;  4R5C A;  1OGQ A;  1U0N D;  2V9S A;  4NZT M;  4PSJ A;  4LI1 A;  5D3I A;  3RFJ A;  5HDH A;  5CMN A;  1QYY A;  3ZYO A;  2Y5Q A;  3ZYI A;  3RW7 A;  3C6P B;  3E3Z A;  3WN4 A;  1LTX A;  2JE0 A;  2R9U A;  4MN8 B;  4Z64 C;  5IJD A;  3UL8 A;  1H6T A;  4Z61 C;  4TZH A;  3FXI A;  3CVR A;  3OGL B;  4LXR A;  4U7L A;  3E2J A;  2JE1 A;  1M0Z A;  1XKU A;  4BSU A;  4BV4 R;  2P1M B;  3KJ4 A;  3W3G A;  1O6V A;  3G3B A;  5FTT B;  2ID5 A;  4Z8G A;  3A79 B;  3C6N B; 
#chains in the Genus database with same CATH homology
 4CIL A;  4CNM A;  3OJA B;  4L3F A;  4M7E A;  4WP6 A;  4ARN A;  1XWD C;  3JB9 j;  5AWB A;  3O6N A;  3OGK B;  3OGM B;  3OJA A;  4IM6 A;  2XWT C;  1H6U A;  4PER A;  4R6F A;  3RGZ A;  3W3M A;  3WPD A;  3G3A A;  3W3K A;  4CP6 A;  4G8A A;  2IFG A;  1OTO A;  4U09 A;  5B0T A;  4HQ1 A;  4Z79 A;  5GMH A;  4LSX A;  3RW6 A;  4OQT A;  1M9S A;  4J4L A;  4CC4 A;  4LXS A;  4V2D A;  4YEB B;  3W3N A;  4J0M A;  3W3L A;  3CIY A;  4PEQ B;  1K5G C;  4L3A A;  2BNH A;  4LSC A;  4NKH A;  4PQ8 A;  4RCA B;  4Q3I A;  4CC4 C;  1DFJ I;  1A4Y A;  4R6G A;  4RWT C;  4XOS A;  2WQV A;  4LI2 A;  3TSR E;  2WQW A;  2P1P B;  4P8S A;  2ASS B;  4BSS A;  4LSX C;  1K5D C;  4KNG A;  4ECN A;  1P8V A;  5HZL B;  3RJ0 A;  5GMG A;  2CA6 A;  4XSQ A;  4NKG A;  2UZY A;  1PGV A;  3ZYN A;  2FT3 A;  2WFH A;  2Z82 A;  3UL7 A;  4R08 A;  5AWA A;  3E6J A;  4FD0 A;  2OMU A;  4R07 A;  4R0A A;  3WPF A;  1D0B A;  3WPC A;  3REZ A;  4C2B B;  4GT6 A;  3M18 A;  2OMV A;  1FT8 A;  5LFN A;  5GS2 B;  3E4G A;  1FQV A;  2RA8 A;  2UZX A;  4R09 A;  1P9A G;  1YRG A;  3G39 A;  4UFR A;  4B8C D;  3WPG A;  1OOK G;  2Z62 A;  3ULU A;  1ZIW A;  1O6T A;  4FDW A;  5B4P A;  2JQD A;  1Z7X W;  1W8A A;  2BEX A;  1G9U A;  1XEU A;  2O6R A;  2Z7X A;  3UN9 A;  4EZG A;  3DZE A;  3RIZ A;  3G06 A;  5GS0 A;  2A0Z A;  4KT1 A;  4BSR A;  4R6A A;  4CNC A;  4LSA A;  1KOO A;  2Z7X B;  4V2C A;  4QBZ A;  2OMT A;  4GLP A;  3ZYJ A;  3WPE A;  5B0N A;  5A5C A;  1SQ0 B;  2OMZ A;  4ECO A;  4FS7 A;  3CIG A;  4I6J B;  2V9T B;  3BZ5 A;  4KXF B;  4Z94 G;  4R6J A;  3RFS A;  4Q3G A;  5AZ5 A;  3O53 A;  4PKI G;  5AWD A;  2OMW A;  4V2E A;  3VQ1 A;  2Z65 A;  4QXE A;  3GOZ A;  4P91 A;  4Y61 B;  2P1Q B;  3RFE A;  3RGX A;  4U06 A;  1M10 B;  1DCE A;  1O6S A;  2P1O B;  5AWC A;  5GMF A;  3ULA A;  1KOH A;  4C2A B;  4U08 A;  3WPI A;  1WWL A;  1FO1 A;  1OTN A;  2XOT A;  2RR6 A;  4FCG A;  4RCW A;  3VQ2 A;  4QC0 A;  1FS2 A;  2ELL A;  3WPH A;  2OMY A;  1JL5 A;  1P8T A;  2Z64 A;  4FMZ A;  4M7E C;  3P72 A;  3W3J A;  3WPB A;  3SB4 A;  4R58 A;  1XEC A;  4Q62 A;  2Z81 A;  4AW4 A;  3ULV A;  4XGO A;  1DS9 A;  4R5D A;  1OTM A;  1XCD A;  2P1N B;  2V70 A;  3C6O B;  2OMX A;  4WYK A;  4MQW X;  3UL9 A;  5IJC A;  5CMP A;  2O6S A;  4K17 A;  5IYX C;  1OZN A;  1M9L A;  2WQX A;  4ARR A;  2Z66 A;  1A9N A;  2Q4G W;  2Z63 A;  4FHO A;  4H09 A;  5IJB A;  3G04 C;  5GQR K;  1GWB A;  1IO0 A;  3PMH G;  3M19 A;  2O6Q A;  2WQU A;  4AY9 X;  2AST B;  4R5C A;  1OGQ A;  1U0N D;  2V9S A;  4PSJ A;  5D3I A;  4LI1 A;  3RFJ A;  5HDH A;  5CMN A;  1QYY A;  3ZYO A;  2Y5Q A;  3ZYI A;  3RW7 A;  3C6P B;  3E3Z A;  3WN4 A;  1LTX A;  2JE0 A;  2R9U A;  4MN8 B;  4Z64 C;  5IJD A;  3UL8 A;  1H6T A;  4Z61 C;  4TZH A;  3FXI A;  3CVR A;  3OGL B;  4LXR A;  4U7L A;  3E2J A;  2JE1 A;  1M0Z A;  1XKU A;  4BSU A;  4BV4 R;  2P1M B;  3KJ4 A;  3W3G A;  1O6V A;  3G3B A;  5FTT B;  2ID5 A;  4Z8G A;  3A79 B;  3C6N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...