1SQ0B

Crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
265
structure length
265
Chain Sequence
b'HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNDLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor (vWF) [Contains: Von Willebrand antige
publication title Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 66
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1sq0B00
2OMTA 3M19A 4R6FA 1O6VA 3M18A 5D3IA 4Q3IA 5GMGA 2BEXA 2P1PB 3WPHA 4FHOA 4KXFB 2UZYA 5B4PA 1ZIWA 4R0AA 5IYXC 2Z62A 1A9NA 4L3AA 4Y61B 4Z8GA 4Q62A 4M7EC 2FT3A 5A5CA 3RIZA 1FQVA 4XSQA 3ULVA 4ARRA 3ZYNA 4ARNA 5AWCA 3RFEA 4XOSA 1M0ZA 1A4YA 2WQUA 4BSUA 3DZEA 3WPIA 3OJAB 3JB9j 4R6AA 1PGVA 4RCWA 4PERA 2O6QA 4WYKA 1DFJI 4Z94G 2P1OB 2P1QB 3KJ4A 4FDWA 4QBZA 3RGZA 3UL7A 2ASTB 4GT6A 5GQRK 4YEBB 3CIGA 3WPCA 2RR6A 3OJAA 3PMHG 3C6OB 3WPFA 4AW4A 1SQ0B 2ASSB 4R6GA 3VQ2A 5IJBA 2Z82A 2WQWA 2P1NB 4HQ1A 1OZNA 2IFGA 1OTNA 2RA8A 4FMZA 5AZ5A 4WP6A 4ECOA 3G3AA 1G9UA 3G3BA 4UFRA 3UL9A 1XKUA 1KOHA 1P8TA 1OOKG 2V9TB 3G04C 1Z7XW 4PSJA 3SB4A 2OMVA 3E4GA 1M9SA 2XWTC 4R58A 3FXIA 5HZLB 4CILA 4RCAB 3OGKB 4R08A 4Q3GA 2JE0A 3TSRE 4BSSA 1O6TA 2WFHA 1D0BA 1U0ND 3OGMB 3ULUA 4LSCA 4MN8B 4FCGA 4KT1A 1FS2A 2JQDA 1P9AG 4L3FA 2ID5A 1QYYA 5CMNA 5B0NA 2Z7XA 4ECNA 3WN4A 4CC4A 1GWBA 2JE1A 4U09A 4I6JB 1P8VA 4G8AA 3E6JA 1FO1A 5GS2B 4U06A 1OTOA 3WPGA 2V70A 1FT8A 5IJCA 1XEUA 2O6SA 4LI1A 3W3JA 4V2EA 5AWDA 3E3ZA 4Z79A 3O53A 3UL8A 4BV4R 2R9UA 1M10B 4AY9X 4PQ8A 1H6UA 4PKIG 4NKGA 2Z64A 4QC0A 3CIYA 2OMYA 4B8CD 4GLPA 5GMHA 4R09A 2UZXA 5AWBA 3REZA 1XWDC 4CNCA 1K5DC 3OGLB 4PEQB 1O6SA 2CA6A 4CNMA 2Z81A 2XOTA 4V2DA 4NKHA 4IM6A 3ZYOA 4MQWX 4C2BB 3G39A 5FTTB 3RFJA 2Z66A 3RW7A 1XCDA 2V9SA 5CMPA 3WPDA 5AWAA 1WWLA 1DCEA 4LSXA 4LXSA 3RGXA 5LFNA 5B0TA 3RFSA 1LTXA 4Z64C 4R07A 4KNGA 2Y5QA 1OGQA 2OMZA 4CC4C 2Z7XB 3RJ0A 4R5CA 3A79B 2OMXA 3W3NA 2BNHA 5GMFA 4LXRA 4U7LA 1OTMA 3UN9A 1K5GC 4BSRA 4FD0A 3P72A 4J0MA 3BZ5A 3ZYJA 3W3MA 3GOZA 3CVRA 1KOOA 4FS7A 1XECA 2WQVA 4V2CA 4LI2A 3WPBA 3W3KA 1M9LA 2OMUA 1IO0A 1YRGA 2Z65A 5IJDA 4RWTC 1H6TA 4P91A 4P8SA 2Z63A 4K17A 4R5DA 4XGOA 3W3LA 4U08A 1JL5A 4QXEA 3E2JA 4TZHA 4CP6A 4M7EA 3VQ1A 2O6RA 4R6JA 4LSXC 3W3GA 1DS9A 5HDHA 3RW6A 4Z61C 4H09A 4EZGA 3O6NA 5GS0A 3ZYIA 4C2AB 3C6NB 3C6PB 1W8AA 4OQTA 3ULAA 2ELLA 3G06A 2A0ZA 4LSAA 3WPEA 2Q4GW 2OMWA 2P1MB 4J4LA 2WQXA
chains in the Genus database with same CATH superfamily
2OMTA 3M19A 4R6FA 1O6VA 3M18A 5D3IA 4Q3IA 5GMGA 2BEXA 2P1PB 3WPHA 4FHOA 4KXFB 2UZYA 5B4PA 1ZIWA 4R0AA 5IYXC 2Z62A 1A9NA 4L3AA 4Y61B 4Z8GA 4Q62A 4M7EC 2FT3A 5A5CA 3RIZA 1FQVA 4XSQA 3ULVA 4ARRA 3ZYNA 4ARNA 5AWCA 3RFEA 4XOSA 1M0ZA 1A4YA 2WQUA 4BSUA 3DZEA 3WPIA 3OJAB 3JB9j 4R6AA 1PGVA 4RCWA 4PERA 2O6QA 4WYKA 1DFJI 4Z94G 2P1OB 2P1QB 3KJ4A 4FDWA 4QBZA 3RGZA 3UL7A 2ASTB 4GT6A 5GQRK 4YEBB 3CIGA 3WPCA 2RR6A 3OJAA 3PMHG 3C6OB 3WPFA 4AW4A 1SQ0B 2ASSB 4R6GA 3VQ2A 5IJBA 2Z82A 2WQWA 2P1NB 4HQ1A 1OZNA 2IFGA 1OTNA 2RA8A 4FMZA 5AZ5A 4WP6A 4ECOA 3G3AA 1G9UA 3G3BA 4UFRA 3UL9A 1XKUA 1KOHA 1P8TA 1OOKG 2V9TB 3G04C 1Z7XW 4PSJA 3SB4A 2OMVA 3E4GA 1M9SA 2XWTC 4R58A 3FXIA 5HZLB 4CILA 4RCAB 3OGKB 4R08A 4Q3GA 2JE0A 3TSRE 4BSSA 1O6TA 2WFHA 1D0BA 1U0ND 3OGMB 3ULUA 4LSCA 4MN8B 4FCGA 4KT1A 1FS2A 2JQDA 1P9AG 4L3FA 2ID5A 1QYYA 5CMNA 5B0NA 2Z7XA 4ECNA 3WN4A 4CC4A 1GWBA 2JE1A 4U09A 4I6JB 1P8VA 4G8AA 3E6JA 1FO1A 5GS2B 4U06A 1OTOA 3WPGA 2V70A 1FT8A 5IJCA 1XEUA 2O6SA 4LI1A 3W3JA 4V2EA 5AWDA 3E3ZA 4Z79A 3O53A 3UL8A 4BV4R 2R9UA 1M10B 4AY9X 4PQ8A 1H6UA 4PKIG 4NKGA 2Z64A 4QC0A 3CIYA 2OMYA 4B8CD 4GLPA 5GMHA 4R09A 2UZXA 5AWBA 3REZA 1XWDC 4CNCA 1K5DC 3OGLB 4PEQB 1O6SA 2CA6A 4CNMA 2Z81A 2XOTA 4V2DA 4NKHA 4IM6A 3ZYOA 4MQWX 4C2BB 3G39A 5FTTB 3RFJA 2Z66A 3RW7A 1XCDA 2V9SA 5CMPA 3WPDA 5AWAA 1WWLA 1DCEA 4LSXA 4LXSA 3RGXA 5LFNA 5B0TA 3RFSA 1LTXA 4Z64C 4R07A 4KNGA 2Y5QA 1OGQA 2OMZA 4CC4C 2Z7XB 3RJ0A 4R5CA 3A79B 2OMXA 3W3NA 2BNHA 5GMFA 4LXRA 4U7LA 1OTMA 3UN9A 1K5GC 4BSRA 4FD0A 4NZRM 3P72A 4J0MA 3BZ5A 4NZTM 3ZYJA 3W3MA 3GOZA 3CVRA 1KOOA 4FS7A 1XECA 2WQVA 4V2CA 4LI2A 3WPBA 3W3KA 1M9LA 2OMUA 1IO0A 1YRGA 2Z65A 5IJDA 4RWTC 1H6TA 4P91A 4P8SA 2Z63A 4K17A 4R5DA 4XGOA 3W3LA 4U08A 1JL5A 4QXEA 3E2JA 4TZHA 4CP6A 4M7EA 3VQ1A 2O6RA 4R6JA 4LSXC 3W3GA 1DS9A 5HDHA 3RW6A 4Z61C 4H09A 4EZGA 3O6NA 5GS0A 3ZYIA 4C2AB 3C6NB 3C6PB 1W8AA 4OQTA 3ULAA 2ELLA 3G06A 2A0ZA 4LSAA 3WPEA 2Q4GW 2OMWA 2P1MB 4J4LA 2WQXA
chains in the Genus database with same CATH topology
2OMTA 3M19A 4R6FA 1O6VA 3M18A 5D3IA 4Q3IA 5GMGA 2BEXA 2P1PB 3WPHA 4FHOA 4KXFB 2UZYA 5B4PA 1ZIWA 4R0AA 5IYXC 2Z62A 1A9NA 4L3AA 4Y61B 4Z8GA 4Q62A 4M7EC 2FT3A 5A5CA 3RIZA 1FQVA 4XSQA 3ULVA 4ARRA 3ZYNA 4ARNA 5AWCA 3RFEA 4XOSA 1M0ZA 1A4YA 2WQUA 4BSUA 3DZEA 3WPIA 3OJAB 3JB9j 4R6AA 1PGVA 4RCWA 4PERA 2O6QA 4WYKA 1DFJI 4Z94G 2P1OB 2P1QB 3KJ4A 4FDWA 4QBZA 3RGZA 3UL7A 2ASTB 4GT6A 5GQRK 4YEBB 3CIGA 3WPCA 2RR6A 3OJAA 3PMHG 3C6OB 3WPFA 4AW4A 1SQ0B 2ASSB 4R6GA 3VQ2A 5IJBA 2Z82A 2WQWA 2P1NB 4HQ1A 1OZNA 2IFGA 1OTNA 2RA8A 4FMZA 5AZ5A 4WP6A 4ECOA 3G3AA 1G9UA 3G3BA 4UFRA 3UL9A 1XKUA 1KOHA 1P8TA 1OOKG 2V9TB 3G04C 1Z7XW 4PSJA 3SB4A 2OMVA 3E4GA 1M9SA 2XWTC 4R58A 3FXIA 5HZLB 4CILA 4RCAB 3OGKB 4R08A 4Q3GA 2JE0A 3TSRE 4BSSA 1O6TA 2WFHA 1D0BA 1U0ND 3OGMB 3ULUA 4LSCA 4MN8B 4FCGA 4KT1A 1FS2A 2JQDA 1P9AG 4L3FA 2ID5A 1QYYA 5CMNA 5B0NA 2Z7XA 4ECNA 3WN4A 4CC4A 1GWBA 2JE1A 4U09A 4I6JB 1P8VA 4G8AA 3E6JA 1FO1A 5GS2B 4U06A 1OTOA 3WPGA 2V70A 1FT8A 5IJCA 1XEUA 2O6SA 4LI1A 3W3JA 4V2EA 5AWDA 3E3ZA 4Z79A 3O53A 3UL8A 4BV4R 2R9UA 1M10B 4AY9X 4PQ8A 1H6UA 4PKIG 4NKGA 2Z64A 4QC0A 3CIYA 2OMYA 4B8CD 4GLPA 5GMHA 4R09A 2UZXA 5AWBA 3REZA 1XWDC 4CNCA 1K5DC 3OGLB 4PEQB 1O6SA 2CA6A 4CNMA 2Z81A 2XOTA 4V2DA 4NKHA 4IM6A 3ZYOA 4MQWX 4C2BB 3G39A 5FTTB 3RFJA 2Z66A 3RW7A 1XCDA 2V9SA 5CMPA 3WPDA 5AWAA 1WWLA 1DCEA 4LSXA 4LXSA 3RGXA 5LFNA 5B0TA 3RFSA 1LTXA 4Z64C 4R07A 4KNGA 2Y5QA 1OGQA 2OMZA 4CC4C 2Z7XB 3RJ0A 4R5CA 3A79B 2OMXA 3W3NA 2BNHA 5GMFA 4LXRA 4U7LA 1OTMA 3UN9A 1K5GC 4BSRA 4FD0A 3P72A 4J0MA 3BZ5A 3ZYJA 3W3MA 3GOZA 3CVRA 1KOOA 4FS7A 1XECA 2WQVA 4V2CA 4LI2A 3WPBA 3W3KA 1M9LA 2OMUA 1IO0A 1YRGA 2Z65A 5IJDA 4RWTC 1H6TA 4P91A 4P8SA 2Z63A 4K17A 4R5DA 4XGOA 3W3LA 4U08A 1JL5A 4QXEA 3E2JA 4TZHA 4CP6A 4M7EA 3VQ1A 2O6RA 4R6JA 4LSXC 3W3GA 1DS9A 5HDHA 3RW6A 4Z61C 4H09A 4EZGA 3O6NA 5GS0A 3ZYIA 4C2AB 3C6NB 3C6PB 1W8AA 4OQTA 3ULAA 2ELLA 3G06A 2A0ZA 4LSAA 3WPEA 2Q4GW 2OMWA 2P1MB 4J4LA 2WQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMT A;  3M19 A;  4R6F A;  1O6V A;  3M18 A;  5D3I A;  4Q3I A;  5GMG A;  2BEX A;  2P1P B;  3WPH A;  4FHO A;  4KXF B;  2UZY A;  5B4P A;  1ZIW A;  4R0A A;  5IYX C;  2Z62 A;  1A9N A;  4L3A A;  4Y61 B;  4Z8G A;  4Q62 A;  4M7E C;  2FT3 A;  5A5C A;  3RIZ A;  1FQV A;  4XSQ A;  3ULV A;  4ARR A;  3ZYN A;  4ARN A;  5AWC A;  3RFE A;  4XOS A;  1M0Z A;  1A4Y A;  2WQU A;  4BSU A;  3DZE A;  3WPI A;  3OJA B;  3JB9 j;  4R6A A;  1PGV A;  4RCW A;  4PER A;  2O6Q A;  4WYK A;  1DFJ I;  4Z94 G;  2P1O B;  2P1Q B;  3KJ4 A;  4FDW A;  4QBZ A;  3RGZ A;  3UL7 A;  2AST B;  4GT6 A;  5GQR K;  4YEB B;  3CIG A;  3WPC A;  2RR6 A;  3OJA A;  3PMH G;  3C6O B;  3WPF A;  4AW4 A;  1SQ0 B;  2ASS B;  4R6G A;  3VQ2 A;  5IJB A;  2Z82 A;  2WQW A;  2P1N B;  4HQ1 A;  1OZN A;  2IFG A;  1OTN A;  2RA8 A;  4FMZ A;  5AZ5 A;  4WP6 A;  4ECO A;  3G3A A;  1G9U A;  3G3B A;  4UFR A;  3UL9 A;  1XKU A;  1KOH A;  1P8T A;  1OOK G;  2V9T B;  3G04 C;  1Z7X W;  4PSJ A;  3SB4 A;  2OMV A;  3E4G A;  1M9S A;  2XWT C;  4R58 A;  3FXI A;  5HZL B;  4CIL A;  4RCA B;  3OGK B;  4R08 A;  4Q3G A;  2JE0 A;  3TSR E;  4BSS A;  1O6T A;  2WFH A;  1D0B A;  1U0N D;  3OGM B;  3ULU A;  4LSC A;  4MN8 B;  4FCG A;  4KT1 A;  1FS2 A;  2JQD A;  1P9A G;  4L3F A;  2ID5 A;  1QYY A;  5CMN A;  5B0N A;  2Z7X A;  4ECN A;  3WN4 A;  4CC4 A;  1GWB A;  2JE1 A;  4U09 A;  4I6J B;  1P8V A;  4G8A A;  3E6J A;  1FO1 A;  5GS2 B;  4U06 A;  1OTO A;  3WPG A;  2V70 A;  1FT8 A;  5IJC A;  1XEU A;  2O6S A;  4LI1 A;  3W3J A;  4V2E A;  5AWD A;  3E3Z A;  4Z79 A;  3O53 A;  3UL8 A;  4BV4 R;  2R9U A;  1M10 B;  4AY9 X;  4PQ8 A;  1H6U A;  4PKI G;  4NKG A;  2Z64 A;  4QC0 A;  3CIY A;  2OMY A;  4B8C D;  4GLP A;  5GMH A;  4R09 A;  2UZX A;  5AWB A;  3REZ A;  1XWD C;  4CNC A;  1K5D C;  3OGL B;  4PEQ B;  1O6S A;  2CA6 A;  4CNM A;  2Z81 A;  2XOT A;  4V2D A;  4NKH A;  4IM6 A;  3ZYO A;  4MQW X;  4C2B B;  3G39 A;  5FTT B;  3RFJ A;  2Z66 A;  3RW7 A;  1XCD A;  2V9S A;  5CMP A;  3WPD A;  5AWA A;  1WWL A;  1DCE A;  4LSX A;  4LXS A;  3RGX A;  5LFN A;  5B0T A;  3RFS A;  1LTX A;  4Z64 C;  4R07 A;  4KNG A;  2Y5Q A;  1OGQ A;  2OMZ A;  4CC4 C;  2Z7X B;  3RJ0 A;  4R5C A;  3A79 B;  2OMX A;  3W3N A;  2BNH A;  5GMF A;  4LXR A;  4U7L A;  1OTM A;  3UN9 A;  1K5G C;  4BSR A;  4FD0 A;  3P72 A;  4J0M A;  3BZ5 A;  3ZYJ A;  3W3M A;  3GOZ A;  3CVR A;  1KOO A;  4FS7 A;  1XEC A;  2WQV A;  4V2C A;  4LI2 A;  3WPB A;  3W3K A;  1M9L A;  2OMU A;  1IO0 A;  1YRG A;  2Z65 A;  5IJD A;  4RWT C;  1H6T A;  4P91 A;  4P8S A;  2Z63 A;  4K17 A;  4R5D A;  4XGO A;  3W3L A;  4U08 A;  1JL5 A;  4QXE A;  3E2J A;  4TZH A;  4CP6 A;  4M7E A;  3VQ1 A;  2O6R A;  4R6J A;  4LSX C;  3W3G A;  1DS9 A;  5HDH A;  3RW6 A;  4Z61 C;  4H09 A;  4EZG A;  3O6N A;  5GS0 A;  3ZYI A;  4C2A B;  3C6N B;  3C6P B;  1W8A A;  4OQT A;  3ULA A;  2ELL A;  3G06 A;  2A0Z A;  4LSA A;  3WPE A;  2Q4G W;  2OMW A;  2P1M B;  4J4L A;  2WQX A; 
#chains in the Genus database with same CATH topology
 2OMT A;  3M19 A;  4R6F A;  1O6V A;  3M18 A;  5D3I A;  4Q3I A;  5GMG A;  2BEX A;  2P1P B;  3WPH A;  4FHO A;  4KXF B;  2UZY A;  5B4P A;  1ZIW A;  4R0A A;  5IYX C;  2Z62 A;  1A9N A;  4L3A A;  4Y61 B;  4Z8G A;  4Q62 A;  4M7E C;  2FT3 A;  5A5C A;  3RIZ A;  1FQV A;  4XSQ A;  3ULV A;  4ARR A;  3ZYN A;  4ARN A;  5AWC A;  3RFE A;  4XOS A;  1M0Z A;  1A4Y A;  2WQU A;  4BSU A;  3DZE A;  3WPI A;  3OJA B;  3JB9 j;  4R6A A;  1PGV A;  4RCW A;  4PER A;  2O6Q A;  4WYK A;  1DFJ I;  4Z94 G;  2P1O B;  2P1Q B;  3KJ4 A;  4FDW A;  4QBZ A;  3RGZ A;  3UL7 A;  2AST B;  4GT6 A;  5GQR K;  4YEB B;  3CIG A;  3WPC A;  2RR6 A;  3OJA A;  3PMH G;  3C6O B;  3WPF A;  4AW4 A;  1SQ0 B;  2ASS B;  4R6G A;  3VQ2 A;  5IJB A;  2Z82 A;  2WQW A;  2P1N B;  4HQ1 A;  1OZN A;  2IFG A;  1OTN A;  2RA8 A;  4FMZ A;  5AZ5 A;  4WP6 A;  4ECO A;  3G3A A;  1G9U A;  3G3B A;  4UFR A;  3UL9 A;  1XKU A;  1KOH A;  1P8T A;  1OOK G;  2V9T B;  3G04 C;  1Z7X W;  4PSJ A;  3SB4 A;  2OMV A;  3E4G A;  1M9S A;  2XWT C;  4R58 A;  3FXI A;  5HZL B;  4CIL A;  4RCA B;  3OGK B;  4R08 A;  4Q3G A;  2JE0 A;  3TSR E;  4BSS A;  1O6T A;  2WFH A;  1D0B A;  1U0N D;  3OGM B;  3ULU A;  4LSC A;  4MN8 B;  4FCG A;  4KT1 A;  1FS2 A;  2JQD A;  1P9A G;  4L3F A;  2ID5 A;  1QYY A;  5CMN A;  5B0N A;  2Z7X A;  4ECN A;  3WN4 A;  4CC4 A;  1GWB A;  2JE1 A;  4U09 A;  4I6J B;  1P8V A;  4G8A A;  3E6J A;  1FO1 A;  5GS2 B;  4U06 A;  1OTO A;  3WPG A;  2V70 A;  1FT8 A;  5IJC A;  1XEU A;  2O6S A;  4LI1 A;  3W3J A;  4V2E A;  5AWD A;  3E3Z A;  4Z79 A;  3O53 A;  3UL8 A;  4BV4 R;  2R9U A;  1M10 B;  4AY9 X;  4PQ8 A;  1H6U A;  4PKI G;  4NKG A;  2Z64 A;  4QC0 A;  3CIY A;  2OMY A;  4B8C D;  4GLP A;  5GMH A;  4R09 A;  2UZX A;  5AWB A;  3REZ A;  1XWD C;  4CNC A;  1K5D C;  3OGL B;  4PEQ B;  1O6S A;  2CA6 A;  4CNM A;  2Z81 A;  2XOT A;  4V2D A;  4NKH A;  4IM6 A;  3ZYO A;  4MQW X;  4C2B B;  3G39 A;  5FTT B;  3RFJ A;  2Z66 A;  3RW7 A;  1XCD A;  2V9S A;  5CMP A;  3WPD A;  5AWA A;  1WWL A;  1DCE A;  4LSX A;  4LXS A;  3RGX A;  5LFN A;  5B0T A;  3RFS A;  1LTX A;  4Z64 C;  4R07 A;  4KNG A;  2Y5Q A;  1OGQ A;  2OMZ A;  4CC4 C;  2Z7X B;  3RJ0 A;  4R5C A;  3A79 B;  2OMX A;  3W3N A;  2BNH A;  5GMF A;  4LXR A;  4U7L A;  1OTM A;  3UN9 A;  1K5G C;  4BSR A;  4FD0 A;  4NZR M;  3P72 A;  4J0M A;  3BZ5 A;  4NZT M;  3ZYJ A;  3W3M A;  3GOZ A;  3CVR A;  1KOO A;  4FS7 A;  1XEC A;  2WQV A;  4V2C A;  4LI2 A;  3WPB A;  3W3K A;  1M9L A;  2OMU A;  1IO0 A;  1YRG A;  2Z65 A;  5IJD A;  4RWT C;  1H6T A;  4P91 A;  4P8S A;  2Z63 A;  4K17 A;  4R5D A;  4XGO A;  3W3L A;  4U08 A;  1JL5 A;  4QXE A;  3E2J A;  4TZH A;  4CP6 A;  4M7E A;  3VQ1 A;  2O6R A;  4R6J A;  4LSX C;  3W3G A;  1DS9 A;  5HDH A;  3RW6 A;  4Z61 C;  4H09 A;  4EZG A;  3O6N A;  5GS0 A;  3ZYI A;  4C2A B;  3C6N B;  3C6P B;  1W8A A;  4OQT A;  3ULA A;  2ELL A;  3G06 A;  2A0Z A;  4LSA A;  3WPE A;  2Q4G W;  2OMW A;  2P1M B;  4J4L A;  2WQX A; 
#chains in the Genus database with same CATH homology
 2OMT A;  3M19 A;  4R6F A;  1O6V A;  3M18 A;  5D3I A;  4Q3I A;  5GMG A;  2BEX A;  2P1P B;  3WPH A;  4FHO A;  4KXF B;  2UZY A;  5B4P A;  1ZIW A;  4R0A A;  5IYX C;  2Z62 A;  1A9N A;  4L3A A;  4Y61 B;  4Z8G A;  4Q62 A;  4M7E C;  2FT3 A;  5A5C A;  3RIZ A;  1FQV A;  4XSQ A;  3ULV A;  4ARR A;  3ZYN A;  4ARN A;  5AWC A;  3RFE A;  4XOS A;  1M0Z A;  1A4Y A;  2WQU A;  4BSU A;  3DZE A;  3WPI A;  3OJA B;  3JB9 j;  4R6A A;  1PGV A;  4RCW A;  4PER A;  2O6Q A;  4WYK A;  1DFJ I;  4Z94 G;  2P1O B;  2P1Q B;  3KJ4 A;  4FDW A;  4QBZ A;  3RGZ A;  3UL7 A;  2AST B;  4GT6 A;  5GQR K;  4YEB B;  3CIG A;  3WPC A;  2RR6 A;  3OJA A;  3PMH G;  3C6O B;  3WPF A;  4AW4 A;  1SQ0 B;  2ASS B;  4R6G A;  3VQ2 A;  5IJB A;  2Z82 A;  2WQW A;  2P1N B;  4HQ1 A;  1OZN A;  2IFG A;  1OTN A;  2RA8 A;  4FMZ A;  5AZ5 A;  4WP6 A;  4ECO A;  3G3A A;  1G9U A;  3G3B A;  4UFR A;  3UL9 A;  1XKU A;  1KOH A;  1P8T A;  1OOK G;  2V9T B;  3G04 C;  1Z7X W;  4PSJ A;  3SB4 A;  2OMV A;  3E4G A;  1M9S A;  2XWT C;  4R58 A;  3FXI A;  5HZL B;  4CIL A;  4RCA B;  3OGK B;  4R08 A;  4Q3G A;  2JE0 A;  3TSR E;  4BSS A;  1O6T A;  2WFH A;  1D0B A;  1U0N D;  3OGM B;  3ULU A;  4LSC A;  4MN8 B;  4FCG A;  4KT1 A;  1FS2 A;  2JQD A;  1P9A G;  4L3F A;  2ID5 A;  1QYY A;  5CMN A;  5B0N A;  2Z7X A;  4ECN A;  3WN4 A;  4CC4 A;  1GWB A;  2JE1 A;  4U09 A;  4I6J B;  1P8V A;  4G8A A;  3E6J A;  1FO1 A;  5GS2 B;  4U06 A;  1OTO A;  3WPG A;  2V70 A;  1FT8 A;  5IJC A;  1XEU A;  2O6S A;  4LI1 A;  3W3J A;  4V2E A;  5AWD A;  3E3Z A;  4Z79 A;  3O53 A;  3UL8 A;  4BV4 R;  2R9U A;  1M10 B;  4AY9 X;  4PQ8 A;  1H6U A;  4PKI G;  4NKG A;  2Z64 A;  4QC0 A;  3CIY A;  2OMY A;  4B8C D;  4GLP A;  5GMH A;  4R09 A;  2UZX A;  5AWB A;  3REZ A;  1XWD C;  4CNC A;  1K5D C;  3OGL B;  4PEQ B;  1O6S A;  2CA6 A;  4CNM A;  2Z81 A;  2XOT A;  4V2D A;  4NKH A;  4IM6 A;  3ZYO A;  4MQW X;  4C2B B;  3G39 A;  5FTT B;  3RFJ A;  2Z66 A;  3RW7 A;  1XCD A;  2V9S A;  5CMP A;  3WPD A;  5AWA A;  1WWL A;  1DCE A;  4LSX A;  4LXS A;  3RGX A;  5LFN A;  5B0T A;  3RFS A;  1LTX A;  4Z64 C;  4R07 A;  4KNG A;  2Y5Q A;  1OGQ A;  2OMZ A;  4CC4 C;  2Z7X B;  3RJ0 A;  4R5C A;  3A79 B;  2OMX A;  3W3N A;  2BNH A;  5GMF A;  4LXR A;  4U7L A;  1OTM A;  3UN9 A;  1K5G C;  4BSR A;  4FD0 A;  3P72 A;  4J0M A;  3BZ5 A;  3ZYJ A;  3W3M A;  3GOZ A;  3CVR A;  1KOO A;  4FS7 A;  1XEC A;  2WQV A;  4V2C A;  4LI2 A;  3WPB A;  3W3K A;  1M9L A;  2OMU A;  1IO0 A;  1YRG A;  2Z65 A;  5IJD A;  4RWT C;  1H6T A;  4P91 A;  4P8S A;  2Z63 A;  4K17 A;  4R5D A;  4XGO A;  3W3L A;  4U08 A;  1JL5 A;  4QXE A;  3E2J A;  4TZH A;  4CP6 A;  4M7E A;  3VQ1 A;  2O6R A;  4R6J A;  4LSX C;  3W3G A;  1DS9 A;  5HDH A;  3RW6 A;  4Z61 C;  4H09 A;  4EZG A;  3O6N A;  5GS0 A;  3ZYI A;  4C2A B;  3C6N B;  3C6P B;  1W8A A;  4OQT A;  3ULA A;  2ELL A;  3G06 A;  2A0Z A;  4LSA A;  3WPE A;  2Q4G W;  2OMW A;  2P1M B;  4J4L A;  2WQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...