5GMHA

Crystal structure of monkey tlr7 in complex with r848
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
809
structure length
772
Chain Sequence
ARWFPKTLPCDVTLDVSKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPVLEQLYYFRYDKYARSCSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 267
structure length 772
sequence length 809
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmhA00
4R5CA 3WN4A 1FS2A 4BSUA 4KXFB 1H6UA 2ID5A 4Z94G 1A9NA 5IJDA 3ZYOA 4CP6A 1W8AA 5AZ5A 2P1NB 4V2CA 1A4YA 1G9UA 3RJ0A 4BSSA 4WYKA 4QC0A 1P8TA 2A0ZA 4R6JA 2ELLA 1FQVA 4GT6A 2UZYA 5CMPA 3RW7A 5AWAA 4RCAB 2Z64A 2RR6A 4LSCA 4OQTA 1OTMA 3VQ1A 1PGVA 5IJCA 1OTOA 3E3ZA 4G8AA 2V9TB 1SQ0B 4PERA 4PKIG 4U08A 4NKHA 4FCGA 5AWBA 3JB9j 4MQWX 4CNCA 4R5DA 4U06A 4L3AA 4PEQB 4CC4A 3G39A 4NKGA 5FTTB 3SB4A 4P91A 4KNGA 2Z66A 1M10B 3OGLB 4R09A 3GOZA 4KT1A 1FT8A 1DFJI 2IFGA 2JE0A 1H6TA 4LSXA 1GWBA 1DCEA 1DS9A 2OMUA 3ULVA 4Z8GA 4C2AB 4PSJA 3FXIA 4R6GA 4P8SA 4ARRA 4GLPA 4EZGA 1XWDC 3WPGA 4Q3IA 1OZNA 2JQDA 2Z63A 5LFNA 3W3NA 2P1MB 4Z79A 3W3GA 3G3BA 5IJBA 3E2JA 3KJ4A 2WFHA 3RGZA 5GMHA 4U7LA 4QBZA 2BNHA 2ASSB 4LSAA 1D0BA 1IO0A 4V2EA 2OMTA 4FDWA 3CIGA 4TZHA 3M19A 1O6VA 5IYXC 1XKUA 4FHOA 3CIYA 4M7EC 5HDHA 4K17A 4YEBB 2Z82A 3G3AA 4CNMA 4I6JB 2P1QB 3OGMB 2Q4GW 4WP6A 3OJAA 3CVRA 3P72A 4ECNA 3ZYIA 3ULAA 4HQ1A 4C2BB 4RCWA 1M9SA 3UL7A 2Y5QA 4XSQA 3OJAB 3ZYNA 4H09A 2OMXA 3TSRE 4U09A 5D3IA 1OGQA 4PQ8A 5CMNA 3DZEA 3M18A 5HZLB 5B4PA 4Q3GA 5AWCA 5GMGA 2FT3A 3PMHG 3UL8A 3O6NA 1KOHA 3WPCA 4L3FA 4FS7A 4R08A 2XWTC 1O6TA 2WQUA 3WPBA 3RFJA 1KOOA 2UZXA 3BZ5A 1ZIWA 1WWLA 4XOSA 2V9SA 5GS0A 1O6SA 3RFEA 2CA6A 1FO1A 5B0NA 3UL9A 1K5GC 2Z7XA 4MN8B 3WPIA 3RW6A 3WPDA 1LTXA 1K5DC 5B0TA 4AW4A 4FMZA 1XEUA 2Z7XB 4QXEA 1M0ZA 2WQVA 3ULUA 3REZA 4R6AA 2V70A 1OOKG 4IM6A 4R0AA 4UFRA 1XECA 3RIZA 1OTNA 1JL5A 3RFSA 3C6NB 4BSRA 2R9UA 4Q62A 1QYYA 4XGOA 4LXSA 2O6QA 1P9AG 2P1PB 4R07A 1YRGA 4V2DA 3VQ2A 4R6FA 4CILA 2OMYA 2WQXA 5GQRK 2O6SA 3E4GA 3WPHA 1XCDA 4CC4C 4LI2A 2Z81A 4LXRA 3A79B 4RWTC 1U0ND 2JE1A 3E6JA 3RGXA 3C6OB 3C6PB 2OMWA 3OGKB 3W3MA 4Z61C 4J0MA 3G06A 4BV4R 4LSXC 4J4LA 4LI1A 4R58A 3W3JA 3WPFA 4Y61B 2XOTA 3G04C 5AWDA 4B8CD 2O6RA 4M7EA 3UN9A 3ZYJA 3W3LA 1Z7XW 2OMVA 2OMZA 5GS2B 5GMFA 2BEXA 3O53A 2ASTB 4FD0A 4ECOA 2Z65A 2WQWA 2RA8A 2Z62A 3WPEA 4AY9X 5A5CA 4ARNA 3W3KA 1P8VA 2P1OB 4Z64C 1M9LA
chains in the Genus database with same CATH superfamily
4R5CA 3WN4A 1FS2A 4BSUA 4KXFB 1H6UA 2ID5A 4Z94G 1A9NA 5IJDA 3ZYOA 4CP6A 1W8AA 5AZ5A 2P1NB 4V2CA 1A4YA 1G9UA 3RJ0A 4BSSA 4WYKA 4QC0A 1P8TA 2A0ZA 4R6JA 2ELLA 1FQVA 4GT6A 2UZYA 5CMPA 3RW7A 5AWAA 4RCAB 2Z64A 2RR6A 4LSCA 4OQTA 1OTMA 3VQ1A 1PGVA 5IJCA 1OTOA 3E3ZA 4G8AA 2V9TB 1SQ0B 4PERA 4PKIG 4U08A 4NKHA 4FCGA 5AWBA 3JB9j 4MQWX 4CNCA 4R5DA 4U06A 4L3AA 4PEQB 4CC4A 3G39A 4NKGA 5FTTB 3SB4A 4P91A 4KNGA 2Z66A 1M10B 3OGLB 4R09A 3GOZA 4KT1A 1FT8A 1DFJI 2IFGA 2JE0A 1H6TA 4LSXA 1GWBA 1DCEA 1DS9A 2OMUA 3ULVA 4Z8GA 4C2AB 4PSJA 3FXIA 4R6GA 4P8SA 4ARRA 4GLPA 4EZGA 1XWDC 3WPGA 4Q3IA 1OZNA 2JQDA 2Z63A 5LFNA 3W3NA 2P1MB 4Z79A 3W3GA 3G3BA 5IJBA 3E2JA 3KJ4A 2WFHA 3RGZA 5GMHA 4U7LA 4QBZA 2BNHA 2ASSB 4LSAA 1D0BA 1IO0A 4V2EA 2OMTA 4FDWA 3CIGA 4TZHA 3M19A 1O6VA 5IYXC 1XKUA 4FHOA 3CIYA 4M7EC 5HDHA 4K17A 4YEBB 2Z82A 3G3AA 4CNMA 4I6JB 2P1QB 3OGMB 2Q4GW 4WP6A 3OJAA 3CVRA 3P72A 4ECNA 3ZYIA 3ULAA 4HQ1A 4C2BB 4RCWA 1M9SA 3UL7A 2Y5QA 4XSQA 3OJAB 4NZRM 4H09A 3ZYNA 2OMXA 3TSRE 4U09A 5D3IA 1OGQA 4PQ8A 5CMNA 3DZEA 3M18A 5HZLB 5B4PA 4Q3GA 5AWCA 5GMGA 2FT3A 3PMHG 3UL8A 3O6NA 1KOHA 3WPCA 4L3FA 4FS7A 4R08A 2XWTC 1O6TA 2WQUA 3WPBA 3RFJA 1KOOA 2UZXA 3BZ5A 1ZIWA 1WWLA 4XOSA 2V9SA 4NZTM 5GS0A 1O6SA 3RFEA 2CA6A 1FO1A 5B0NA 3UL9A 1K5GC 2Z7XA 4MN8B 3WPIA 3RW6A 3WPDA 1LTXA 1K5DC 5B0TA 4AW4A 4FMZA 1XEUA 2Z7XB 4QXEA 1M0ZA 2WQVA 3ULUA 3REZA 4R6AA 2V70A 1OOKG 4IM6A 4R0AA 4UFRA 1XECA 3RIZA 1OTNA 1JL5A 3RFSA 3C6NB 4BSRA 2R9UA 4Q62A 1QYYA 4XGOA 4LXSA 2O6QA 1P9AG 2P1PB 4R07A 1YRGA 4V2DA 3VQ2A 4R6FA 4CILA 2OMYA 2WQXA 5GQRK 2O6SA 3E4GA 3WPHA 1XCDA 4CC4C 4LI2A 2Z81A 4LXRA 3A79B 4RWTC 1U0ND 2JE1A 3E6JA 3RGXA 3C6OB 3C6PB 2OMWA 3OGKB 3W3MA 4Z61C 4J0MA 3G06A 4BV4R 4LSXC 4J4LA 4LI1A 4R58A 3W3JA 3WPFA 4Y61B 2XOTA 3G04C 5AWDA 4B8CD 2O6RA 4M7EA 3UN9A 3ZYJA 3W3LA 1Z7XW 2OMVA 2OMZA 5GS2B 5GMFA 2BEXA 3O53A 2ASTB 4FD0A 4ECOA 2Z65A 2WQWA 2RA8A 2Z62A 3WPEA 4AY9X 5A5CA 4ARNA 3W3KA 1P8VA 2P1OB 4Z64C 1M9LA
chains in the Genus database with same CATH topology
4R5CA 3WN4A 1FS2A 4BSUA 4KXFB 1H6UA 2ID5A 4Z94G 1A9NA 5IJDA 3ZYOA 4CP6A 1W8AA 5AZ5A 2P1NB 4V2CA 1A4YA 1G9UA 3RJ0A 4BSSA 4WYKA 4QC0A 1P8TA 2A0ZA 4R6JA 2ELLA 1FQVA 4GT6A 2UZYA 5CMPA 3RW7A 5AWAA 4RCAB 2Z64A 2RR6A 4LSCA 4OQTA 1OTMA 3VQ1A 1PGVA 5IJCA 1OTOA 3E3ZA 4G8AA 2V9TB 1SQ0B 4PERA 4PKIG 4U08A 4NKHA 4FCGA 5AWBA 3JB9j 4MQWX 4CNCA 4R5DA 4U06A 4L3AA 4PEQB 4CC4A 3G39A 4NKGA 5FTTB 3SB4A 4P91A 4KNGA 2Z66A 1M10B 3OGLB 4R09A 3GOZA 4KT1A 1FT8A 1DFJI 2IFGA 2JE0A 1H6TA 4LSXA 1GWBA 1DCEA 1DS9A 2OMUA 3ULVA 4Z8GA 4C2AB 4PSJA 3FXIA 4R6GA 4P8SA 4ARRA 4GLPA 4EZGA 1XWDC 3WPGA 4Q3IA 1OZNA 2JQDA 2Z63A 5LFNA 3W3NA 2P1MB 4Z79A 3W3GA 3G3BA 5IJBA 3E2JA 3KJ4A 2WFHA 3RGZA 5GMHA 4U7LA 4QBZA 2BNHA 2ASSB 4LSAA 1D0BA 1IO0A 4V2EA 2OMTA 4FDWA 3CIGA 4TZHA 3M19A 1O6VA 5IYXC 1XKUA 4FHOA 3CIYA 4M7EC 5HDHA 4K17A 4YEBB 2Z82A 3G3AA 4CNMA 4I6JB 2P1QB 3OGMB 2Q4GW 4WP6A 3OJAA 3CVRA 3P72A 4ECNA 3ZYIA 3ULAA 4HQ1A 4C2BB 4RCWA 1M9SA 3UL7A 2Y5QA 4XSQA 3OJAB 3ZYNA 4H09A 2OMXA 3TSRE 4U09A 5D3IA 1OGQA 4PQ8A 5CMNA 3DZEA 3M18A 5HZLB 5B4PA 4Q3GA 5AWCA 5GMGA 2FT3A 3PMHG 3UL8A 3O6NA 1KOHA 3WPCA 4L3FA 4FS7A 4R08A 2XWTC 1O6TA 2WQUA 3WPBA 3RFJA 1KOOA 2UZXA 3BZ5A 1ZIWA 1WWLA 4XOSA 2V9SA 5GS0A 1O6SA 3RFEA 2CA6A 1FO1A 5B0NA 3UL9A 1K5GC 2Z7XA 4MN8B 3WPIA 3RW6A 3WPDA 1LTXA 1K5DC 5B0TA 4AW4A 4FMZA 1XEUA 2Z7XB 4QXEA 1M0ZA 2WQVA 3ULUA 3REZA 4R6AA 2V70A 1OOKG 4IM6A 4R0AA 4UFRA 1XECA 3RIZA 1OTNA 1JL5A 3RFSA 3C6NB 4BSRA 2R9UA 4Q62A 1QYYA 4XGOA 4LXSA 2O6QA 1P9AG 2P1PB 4R07A 1YRGA 4V2DA 3VQ2A 4R6FA 4CILA 2OMYA 2WQXA 5GQRK 2O6SA 3E4GA 3WPHA 1XCDA 4CC4C 4LI2A 2Z81A 4LXRA 3A79B 4RWTC 1U0ND 2JE1A 3E6JA 3RGXA 3C6OB 3C6PB 2OMWA 3OGKB 3W3MA 4Z61C 4J0MA 3G06A 4BV4R 4LSXC 4J4LA 4LI1A 4R58A 3W3JA 3WPFA 4Y61B 2XOTA 3G04C 5AWDA 4B8CD 2O6RA 4M7EA 3UN9A 3ZYJA 3W3LA 1Z7XW 2OMVA 2OMZA 5GS2B 5GMFA 2BEXA 3O53A 2ASTB 4FD0A 4ECOA 2Z65A 2WQWA 2RA8A 2Z62A 3WPEA 4AY9X 5A5CA 4ARNA 3W3KA 1P8VA 2P1OB 4Z64C 1M9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5C A;  3WN4 A;  1FS2 A;  4BSU A;  4KXF B;  1H6U A;  2ID5 A;  4Z94 G;  1A9N A;  5IJD A;  3ZYO A;  4CP6 A;  1W8A A;  5AZ5 A;  2P1N B;  4V2C A;  1A4Y A;  1G9U A;  3RJ0 A;  4BSS A;  4WYK A;  4QC0 A;  1P8T A;  2A0Z A;  4R6J A;  2ELL A;  1FQV A;  4GT6 A;  2UZY A;  5CMP A;  3RW7 A;  5AWA A;  4RCA B;  2Z64 A;  2RR6 A;  4LSC A;  4OQT A;  1OTM A;  3VQ1 A;  1PGV A;  5IJC A;  1OTO A;  3E3Z A;  4G8A A;  2V9T B;  1SQ0 B;  4PER A;  4PKI G;  4U08 A;  4NKH A;  4FCG A;  5AWB A;  3JB9 j;  4MQW X;  4CNC A;  4R5D A;  4U06 A;  4L3A A;  4PEQ B;  4CC4 A;  3G39 A;  4NKG A;  5FTT B;  3SB4 A;  4P91 A;  4KNG A;  2Z66 A;  1M10 B;  3OGL B;  4R09 A;  3GOZ A;  4KT1 A;  1FT8 A;  1DFJ I;  2IFG A;  2JE0 A;  1H6T A;  4LSX A;  1GWB A;  1DCE A;  1DS9 A;  2OMU A;  3ULV A;  4Z8G A;  4C2A B;  4PSJ A;  3FXI A;  4R6G A;  4P8S A;  4ARR A;  4GLP A;  4EZG A;  1XWD C;  3WPG A;  4Q3I A;  1OZN A;  2JQD A;  2Z63 A;  5LFN A;  3W3N A;  2P1M B;  4Z79 A;  3W3G A;  3G3B A;  5IJB A;  3E2J A;  3KJ4 A;  2WFH A;  3RGZ A;  5GMH A;  4U7L A;  4QBZ A;  2BNH A;  2ASS B;  4LSA A;  1D0B A;  1IO0 A;  4V2E A;  2OMT A;  4FDW A;  3CIG A;  4TZH A;  3M19 A;  1O6V A;  5IYX C;  1XKU A;  4FHO A;  3CIY A;  4M7E C;  5HDH A;  4K17 A;  4YEB B;  2Z82 A;  3G3A A;  4CNM A;  4I6J B;  2P1Q B;  3OGM B;  2Q4G W;  4WP6 A;  3OJA A;  3CVR A;  3P72 A;  4ECN A;  3ZYI A;  3ULA A;  4HQ1 A;  4C2B B;  4RCW A;  1M9S A;  3UL7 A;  2Y5Q A;  4XSQ A;  3OJA B;  3ZYN A;  4H09 A;  2OMX A;  3TSR E;  4U09 A;  5D3I A;  1OGQ A;  4PQ8 A;  5CMN A;  3DZE A;  3M18 A;  5HZL B;  5B4P A;  4Q3G A;  5AWC A;  5GMG A;  2FT3 A;  3PMH G;  3UL8 A;  3O6N A;  1KOH A;  3WPC A;  4L3F A;  4FS7 A;  4R08 A;  2XWT C;  1O6T A;  2WQU A;  3WPB A;  3RFJ A;  1KOO A;  2UZX A;  3BZ5 A;  1ZIW A;  1WWL A;  4XOS A;  2V9S A;  5GS0 A;  1O6S A;  3RFE A;  2CA6 A;  1FO1 A;  5B0N A;  3UL9 A;  1K5G C;  2Z7X A;  4MN8 B;  3WPI A;  3RW6 A;  3WPD A;  1LTX A;  1K5D C;  5B0T A;  4AW4 A;  4FMZ A;  1XEU A;  2Z7X B;  4QXE A;  1M0Z A;  2WQV A;  3ULU A;  3REZ A;  4R6A A;  2V70 A;  1OOK G;  4IM6 A;  4R0A A;  4UFR A;  1XEC A;  3RIZ A;  1OTN A;  1JL5 A;  3RFS A;  3C6N B;  4BSR A;  2R9U A;  4Q62 A;  1QYY A;  4XGO A;  4LXS A;  2O6Q A;  1P9A G;  2P1P B;  4R07 A;  1YRG A;  4V2D A;  3VQ2 A;  4R6F A;  4CIL A;  2OMY A;  2WQX A;  5GQR K;  2O6S A;  3E4G A;  3WPH A;  1XCD A;  4CC4 C;  4LI2 A;  2Z81 A;  4LXR A;  3A79 B;  4RWT C;  1U0N D;  2JE1 A;  3E6J A;  3RGX A;  3C6O B;  3C6P B;  2OMW A;  3OGK B;  3W3M A;  4Z61 C;  4J0M A;  3G06 A;  4BV4 R;  4LSX C;  4J4L A;  4LI1 A;  4R58 A;  3W3J A;  3WPF A;  4Y61 B;  2XOT A;  3G04 C;  5AWD A;  4B8C D;  2O6R A;  4M7E A;  3UN9 A;  3ZYJ A;  3W3L A;  1Z7X W;  2OMV A;  2OMZ A;  5GS2 B;  5GMF A;  2BEX A;  3O53 A;  2AST B;  4FD0 A;  4ECO A;  2Z65 A;  2WQW A;  2RA8 A;  2Z62 A;  3WPE A;  4AY9 X;  5A5C A;  4ARN A;  3W3K A;  1P8V A;  2P1O B;  4Z64 C;  1M9L A; 
#chains in the Genus database with same CATH topology
 4R5C A;  3WN4 A;  1FS2 A;  4BSU A;  4KXF B;  1H6U A;  2ID5 A;  4Z94 G;  1A9N A;  5IJD A;  3ZYO A;  4CP6 A;  1W8A A;  5AZ5 A;  2P1N B;  4V2C A;  1A4Y A;  1G9U A;  3RJ0 A;  4BSS A;  4WYK A;  4QC0 A;  1P8T A;  2A0Z A;  4R6J A;  2ELL A;  1FQV A;  4GT6 A;  2UZY A;  5CMP A;  3RW7 A;  5AWA A;  4RCA B;  2Z64 A;  2RR6 A;  4LSC A;  4OQT A;  1OTM A;  3VQ1 A;  1PGV A;  5IJC A;  1OTO A;  3E3Z A;  4G8A A;  2V9T B;  1SQ0 B;  4PER A;  4PKI G;  4U08 A;  4NKH A;  4FCG A;  5AWB A;  3JB9 j;  4MQW X;  4CNC A;  4R5D A;  4U06 A;  4L3A A;  4PEQ B;  4CC4 A;  3G39 A;  4NKG A;  5FTT B;  3SB4 A;  4P91 A;  4KNG A;  2Z66 A;  1M10 B;  3OGL B;  4R09 A;  3GOZ A;  4KT1 A;  1FT8 A;  1DFJ I;  2IFG A;  2JE0 A;  1H6T A;  4LSX A;  1GWB A;  1DCE A;  1DS9 A;  2OMU A;  3ULV A;  4Z8G A;  4C2A B;  4PSJ A;  3FXI A;  4R6G A;  4P8S A;  4ARR A;  4GLP A;  4EZG A;  1XWD C;  3WPG A;  4Q3I A;  1OZN A;  2JQD A;  2Z63 A;  5LFN A;  3W3N A;  2P1M B;  4Z79 A;  3W3G A;  3G3B A;  5IJB A;  3E2J A;  3KJ4 A;  2WFH A;  3RGZ A;  5GMH A;  4U7L A;  4QBZ A;  2BNH A;  2ASS B;  4LSA A;  1D0B A;  1IO0 A;  4V2E A;  2OMT A;  4FDW A;  3CIG A;  4TZH A;  3M19 A;  1O6V A;  5IYX C;  1XKU A;  4FHO A;  3CIY A;  4M7E C;  5HDH A;  4K17 A;  4YEB B;  2Z82 A;  3G3A A;  4CNM A;  4I6J B;  2P1Q B;  3OGM B;  2Q4G W;  4WP6 A;  3OJA A;  3CVR A;  3P72 A;  4ECN A;  3ZYI A;  3ULA A;  4HQ1 A;  4C2B B;  4RCW A;  1M9S A;  3UL7 A;  2Y5Q A;  4XSQ A;  3OJA B;  4NZR M;  4H09 A;  3ZYN A;  2OMX A;  3TSR E;  4U09 A;  5D3I A;  1OGQ A;  4PQ8 A;  5CMN A;  3DZE A;  3M18 A;  5HZL B;  5B4P A;  4Q3G A;  5AWC A;  5GMG A;  2FT3 A;  3PMH G;  3UL8 A;  3O6N A;  1KOH A;  3WPC A;  4L3F A;  4FS7 A;  4R08 A;  2XWT C;  1O6T A;  2WQU A;  3WPB A;  3RFJ A;  1KOO A;  2UZX A;  3BZ5 A;  1ZIW A;  1WWL A;  4XOS A;  2V9S A;  4NZT M;  5GS0 A;  1O6S A;  3RFE A;  2CA6 A;  1FO1 A;  5B0N A;  3UL9 A;  1K5G C;  2Z7X A;  4MN8 B;  3WPI A;  3RW6 A;  3WPD A;  1LTX A;  1K5D C;  5B0T A;  4AW4 A;  4FMZ A;  1XEU A;  2Z7X B;  4QXE A;  1M0Z A;  2WQV A;  3ULU A;  3REZ A;  4R6A A;  2V70 A;  1OOK G;  4IM6 A;  4R0A A;  4UFR A;  1XEC A;  3RIZ A;  1OTN A;  1JL5 A;  3RFS A;  3C6N B;  4BSR A;  2R9U A;  4Q62 A;  1QYY A;  4XGO A;  4LXS A;  2O6Q A;  1P9A G;  2P1P B;  4R07 A;  1YRG A;  4V2D A;  3VQ2 A;  4R6F A;  4CIL A;  2OMY A;  2WQX A;  5GQR K;  2O6S A;  3E4G A;  3WPH A;  1XCD A;  4CC4 C;  4LI2 A;  2Z81 A;  4LXR A;  3A79 B;  4RWT C;  1U0N D;  2JE1 A;  3E6J A;  3RGX A;  3C6O B;  3C6P B;  2OMW A;  3OGK B;  3W3M A;  4Z61 C;  4J0M A;  3G06 A;  4BV4 R;  4LSX C;  4J4L A;  4LI1 A;  4R58 A;  3W3J A;  3WPF A;  4Y61 B;  2XOT A;  3G04 C;  5AWD A;  4B8C D;  2O6R A;  4M7E A;  3UN9 A;  3ZYJ A;  3W3L A;  1Z7X W;  2OMV A;  2OMZ A;  5GS2 B;  5GMF A;  2BEX A;  3O53 A;  2AST B;  4FD0 A;  4ECO A;  2Z65 A;  2WQW A;  2RA8 A;  2Z62 A;  3WPE A;  4AY9 X;  5A5C A;  4ARN A;  3W3K A;  1P8V A;  2P1O B;  4Z64 C;  1M9L A; 
#chains in the Genus database with same CATH homology
 4R5C A;  3WN4 A;  1FS2 A;  4BSU A;  4KXF B;  1H6U A;  2ID5 A;  4Z94 G;  1A9N A;  5IJD A;  3ZYO A;  4CP6 A;  1W8A A;  5AZ5 A;  2P1N B;  4V2C A;  1A4Y A;  1G9U A;  3RJ0 A;  4BSS A;  4WYK A;  4QC0 A;  1P8T A;  2A0Z A;  4R6J A;  2ELL A;  1FQV A;  4GT6 A;  2UZY A;  5CMP A;  3RW7 A;  5AWA A;  4RCA B;  2Z64 A;  2RR6 A;  4LSC A;  4OQT A;  1OTM A;  3VQ1 A;  1PGV A;  5IJC A;  1OTO A;  3E3Z A;  4G8A A;  2V9T B;  1SQ0 B;  4PER A;  4PKI G;  4U08 A;  4NKH A;  4FCG A;  5AWB A;  3JB9 j;  4MQW X;  4CNC A;  4R5D A;  4U06 A;  4L3A A;  4PEQ B;  4CC4 A;  3G39 A;  4NKG A;  5FTT B;  3SB4 A;  4P91 A;  4KNG A;  2Z66 A;  1M10 B;  3OGL B;  4R09 A;  3GOZ A;  4KT1 A;  1FT8 A;  1DFJ I;  2IFG A;  2JE0 A;  1H6T A;  4LSX A;  1GWB A;  1DCE A;  1DS9 A;  2OMU A;  3ULV A;  4Z8G A;  4C2A B;  4PSJ A;  3FXI A;  4R6G A;  4P8S A;  4ARR A;  4GLP A;  4EZG A;  1XWD C;  3WPG A;  4Q3I A;  1OZN A;  2JQD A;  2Z63 A;  5LFN A;  3W3N A;  2P1M B;  4Z79 A;  3W3G A;  3G3B A;  5IJB A;  3E2J A;  3KJ4 A;  2WFH A;  3RGZ A;  5GMH A;  4U7L A;  4QBZ A;  2BNH A;  2ASS B;  4LSA A;  1D0B A;  1IO0 A;  4V2E A;  2OMT A;  4FDW A;  3CIG A;  4TZH A;  3M19 A;  1O6V A;  5IYX C;  1XKU A;  4FHO A;  3CIY A;  4M7E C;  5HDH A;  4K17 A;  4YEB B;  2Z82 A;  3G3A A;  4CNM A;  4I6J B;  2P1Q B;  3OGM B;  2Q4G W;  4WP6 A;  3OJA A;  3CVR A;  3P72 A;  4ECN A;  3ZYI A;  3ULA A;  4HQ1 A;  4C2B B;  4RCW A;  1M9S A;  3UL7 A;  2Y5Q A;  4XSQ A;  3OJA B;  3ZYN A;  4H09 A;  2OMX A;  3TSR E;  4U09 A;  5D3I A;  1OGQ A;  4PQ8 A;  5CMN A;  3DZE A;  3M18 A;  5HZL B;  5B4P A;  4Q3G A;  5AWC A;  5GMG A;  2FT3 A;  3PMH G;  3UL8 A;  3O6N A;  1KOH A;  3WPC A;  4L3F A;  4FS7 A;  4R08 A;  2XWT C;  1O6T A;  2WQU A;  3WPB A;  3RFJ A;  1KOO A;  2UZX A;  3BZ5 A;  1ZIW A;  1WWL A;  4XOS A;  2V9S A;  5GS0 A;  1O6S A;  3RFE A;  2CA6 A;  1FO1 A;  5B0N A;  3UL9 A;  1K5G C;  2Z7X A;  4MN8 B;  3WPI A;  3RW6 A;  3WPD A;  1LTX A;  1K5D C;  5B0T A;  4AW4 A;  4FMZ A;  1XEU A;  2Z7X B;  4QXE A;  1M0Z A;  2WQV A;  3ULU A;  3REZ A;  4R6A A;  2V70 A;  1OOK G;  4IM6 A;  4R0A A;  4UFR A;  1XEC A;  3RIZ A;  1OTN A;  1JL5 A;  3RFS A;  3C6N B;  4BSR A;  2R9U A;  4Q62 A;  1QYY A;  4XGO A;  4LXS A;  2O6Q A;  1P9A G;  2P1P B;  4R07 A;  1YRG A;  4V2D A;  3VQ2 A;  4R6F A;  4CIL A;  2OMY A;  2WQX A;  5GQR K;  2O6S A;  3E4G A;  3WPH A;  1XCD A;  4CC4 C;  4LI2 A;  2Z81 A;  4LXR A;  3A79 B;  4RWT C;  1U0N D;  2JE1 A;  3E6J A;  3RGX A;  3C6O B;  3C6P B;  2OMW A;  3OGK B;  3W3M A;  4Z61 C;  4J0M A;  3G06 A;  4BV4 R;  4LSX C;  4J4L A;  4LI1 A;  4R58 A;  3W3J A;  3WPF A;  4Y61 B;  2XOT A;  3G04 C;  5AWD A;  4B8C D;  2O6R A;  4M7E A;  3UN9 A;  3ZYJ A;  3W3L A;  1Z7X W;  2OMV A;  2OMZ A;  5GS2 B;  5GMF A;  2BEX A;  3O53 A;  2AST B;  4FD0 A;  4ECO A;  2Z65 A;  2WQW A;  2RA8 A;  2Z62 A;  3WPE A;  4AY9 X;  5A5C A;  4ARN A;  3W3K A;  1P8V A;  2P1O B;  4Z64 C;  1M9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...