5GMHA

Crystal structure of monkey tlr7 in complex with r848
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
809
structure length
772
Chain Sequence
ARWFPKTLPCDVTLDVSKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPVLEQLYYFRYDKYARSCSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
total genus 267
structure length 772
sequence length 809
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmhA00
3E3ZA 5AWBA 2JE1A 4K17A 3JB9j 1GWBA 1WWLA 1W8AA 3CIYA 4LI1A 5FTTB 4RCAB 4R08A 2Z82A 2ELLA 4YEBB 4PERA 4WYKA 4ARNA 1DS9A 4M7EA 2P1PB 4I6JB 3C6OB 2WQXA 4BSSA 4QC0A 2Z63A 2ASTB 4BSUA 2OMWA 3ULUA 1JL5A 1M9LA 4J0MA 5AWCA 3RGZA 3OJAB 4XOSA 3ULAA 4CNCA 4PEQB 4U09A 1M0ZA 3REZA 4R58A 3W3KA 3UL7A 3OGLB 3W3MA 1A4YA 3W3NA 4L3FA 2Z62A 2OMTA 4P8SA 3WN4A 2XOTA 1XCDA 5GMHA 3RW6A 3WPCA 4IM6A 2CA6A 3PMHG 4FHOA 3OJAA 1OGQA 1O6SA 3GOZA 4V2CA 4R0AA 3E6JA 4EZGA 1K5DC 3RFSA 1OZNA 1KOHA 2BEXA 1XECA 1OTMA 3WPGA 4G8AA 5IJBA 5IJDA 3M19A 1DFJI 4KXFB 1KOOA 1FT8A 4LSCA 1OOKG 4U7LA 4FD0A 3RIZA 5GMGA 3UL9A 3WPFA 4M7EC 1IO0A 3WPBA 4R09A 2WQUA 4NKGA 1O6TA 5B0TA 2ID5A 5B4PA 2V9TB 5LFNA 4V2DA 4R6FA 4LSXA 3ZYIA 3E2JA 4KNGA 4FMZA 3C6NB 2Z65A 4Z94G 1FQVA 2OMVA 4Q3IA 4R07A 2O6RA 2Z7XB 1O6VA 4L3AA 2V9SA 4ECNA 5AWDA 1H6TA 2OMXA 1ZIWA 1YRGA 3ULVA 4TZHA 4LSAA 1U0ND 2V70A 3VQ2A 2O6QA 4ECOA 1FO1A 1P8VA 4Z64C 2P1MB 4U08A 1LTXA 4HQ1A 1QYYA 3CVRA 4Z79A 4P91A 2RA8A 2WFHA 1SQ0B 1M10B 4LXRA 5A5CA 4LI2A 2XWTC 2OMYA 3OGMB 2Z7XA 4CILA 3E4GA 3ZYJA 4RCWA 3O53A 4UFRA 2R9UA 2UZYA 4NKHA 1XEUA 4KT1A 4Q3GA 2ASSB 3WPDA 4BV4R 5GQRK 4R5CA 4PSJA 4CC4A 2WQVA 3C6PB 4FCGA 3KJ4A 2WQWA 3BZ5A 4PKIG 4V2EA 2UZXA 3WPHA 1XWDC 5GMFA 4R5DA 4C2BB 4C2AB 2Z81A 2RR6A 3W3LA 4AW4A 4Z8GA 2P1QB 5IJCA 1OTOA 3DZEA 3OGKB 3A79B 2FT3A 2O6SA 4QXEA 4BSRA 4LSXC 2JE0A 1XKUA 4B8CD 5AWAA 3G39A 5CMPA 5CMNA 3M18A 4LXSA 3G06A 2Q4GW 3VQ1A 4Z61C 1Z7XW 4R6AA 3TSRE 2BNHA 3RW7A 1PGVA 5D3IA 1OTNA 1G9UA 3P72A 4ARRA 2IFGA 2Z66A 2Z64A 1P8TA 4J4LA 2OMZA 3W3GA 1D0BA 3ZYOA 5HDHA 3WPEA 1FS2A 4AY9X 4Y61B 3WPIA 1A9NA 4RWTC 4R6JA 3RFJA 2JQDA 3UN9A 3FXIA 5B0NA 3SB4A 4Q62A 2OMUA 1H6UA 3RJ0A 5IYXC 4GT6A 5GS0A 4FDWA 4QBZA 5HZLB 3G3AA 4U06A 4R6GA 3CIGA 3G3BA 3G04C 4CC4C 5GS2B 4CNMA 4CP6A 2Y5QA 3O6NA 3W3JA 4PQ8A 3ZYNA 3RFEA 1DCEA 1P9AG 5AZ5A 2A0ZA 3RGXA 4XSQA 4FS7A 2P1OB 2P1NB 4MN8B 4MQWX 4OQTA 1K5GC 4H09A 3UL8A 1M9SA 4WP6A 4XGOA 4GLPA
chains in the Genus database with same CATH superfamily
3E3ZA 5AWBA 2JE1A 4K17A 3JB9j 1GWBA 1WWLA 1W8AA 3CIYA 4LI1A 5FTTB 4RCAB 4R08A 2Z82A 2ELLA 4YEBB 4PERA 4WYKA 4ARNA 1DS9A 4M7EA 2P1PB 4I6JB 3C6OB 2WQXA 4BSSA 4QC0A 2Z63A 2ASTB 4BSUA 2OMWA 3ULUA 1JL5A 1M9LA 4J0MA 5AWCA 3RGZA 3OJAB 4XOSA 3ULAA 4CNCA 4PEQB 4U09A 1M0ZA 3REZA 4R58A 3W3KA 3UL7A 3OGLB 3W3MA 1A4YA 3W3NA 4L3FA 2Z62A 2OMTA 4P8SA 3WN4A 2XOTA 1XCDA 5GMHA 3RW6A 3WPCA 4IM6A 2CA6A 3PMHG 4FHOA 3OJAA 1OGQA 1O6SA 3GOZA 4V2CA 4R0AA 3E6JA 4EZGA 1K5DC 3RFSA 1OZNA 1KOHA 2BEXA 1XECA 1OTMA 3WPGA 4G8AA 5IJBA 5IJDA 3M19A 1DFJI 4KXFB 1KOOA 1FT8A 4LSCA 1OOKG 4U7LA 4FD0A 3RIZA 5GMGA 3UL9A 3WPFA 4M7EC 1IO0A 3WPBA 4R09A 2WQUA 4NKGA 1O6TA 5B0TA 2ID5A 5B4PA 2V9TB 5LFNA 4V2DA 4R6FA 4LSXA 3ZYIA 3E2JA 4KNGA 4FMZA 4NZTM 3C6NB 2Z65A 4Z94G 1FQVA 2OMVA 4Q3IA 4R07A 2O6RA 2Z7XB 1O6VA 4L3AA 2V9SA 4ECNA 5AWDA 1H6TA 2OMXA 1ZIWA 1YRGA 3ULVA 4TZHA 4LSAA 1U0ND 2V70A 3VQ2A 2O6QA 4ECOA 1FO1A 1P8VA 4Z64C 2P1MB 4U08A 1LTXA 4HQ1A 1QYYA 3CVRA 4Z79A 4P91A 2RA8A 2WFHA 1SQ0B 1M10B 4LXRA 5A5CA 4LI2A 2XWTC 2OMYA 3OGMB 2Z7XA 4CILA 3E4GA 3ZYJA 4RCWA 3O53A 4UFRA 2R9UA 2UZYA 4NKHA 1XEUA 4KT1A 4Q3GA 2ASSB 3WPDA 4BV4R 5GQRK 4R5CA 4PSJA 4CC4A 2WQVA 3C6PB 4FCGA 3KJ4A 2WQWA 3BZ5A 4PKIG 4V2EA 2UZXA 3WPHA 1XWDC 5GMFA 4R5DA 4C2BB 4C2AB 2Z81A 2RR6A 3W3LA 4AW4A 4Z8GA 2P1QB 5IJCA 1OTOA 3DZEA 3OGKB 3A79B 2FT3A 2O6SA 4QXEA 4BSRA 4LSXC 2JE0A 1XKUA 4B8CD 5AWAA 3G39A 5CMPA 5CMNA 3M18A 4LXSA 3G06A 2Q4GW 3VQ1A 4Z61C 1Z7XW 4R6AA 3TSRE 2BNHA 3RW7A 1PGVA 5D3IA 1OTNA 1G9UA 3P72A 4ARRA 2IFGA 2Z66A 2Z64A 4NZRM 1P8TA 4J4LA 2OMZA 3W3GA 1D0BA 3ZYOA 5HDHA 3WPEA 1FS2A 4AY9X 4Y61B 3WPIA 1A9NA 4RWTC 4R6JA 3RFJA 2JQDA 3UN9A 3FXIA 5B0NA 3SB4A 4Q62A 2OMUA 1H6UA 3RJ0A 5IYXC 4GT6A 5GS0A 4FDWA 4QBZA 5HZLB 3G3AA 4U06A 4R6GA 3CIGA 3G3BA 3G04C 4CC4C 5GS2B 4CNMA 4CP6A 2Y5QA 3O6NA 3W3JA 4PQ8A 3ZYNA 3RFEA 1DCEA 1P9AG 5AZ5A 2A0ZA 3RGXA 4XSQA 4FS7A 2P1OB 2P1NB 4MN8B 4MQWX 4OQTA 1K5GC 4H09A 3UL8A 1M9SA 4WP6A 4XGOA 4GLPA
chains in the Genus database with same CATH topology
3E3ZA 5AWBA 2JE1A 4K17A 3JB9j 1GWBA 1WWLA 1W8AA 3CIYA 4LI1A 5FTTB 4RCAB 4R08A 2Z82A 2ELLA 4YEBB 4PERA 4WYKA 4ARNA 1DS9A 4M7EA 2P1PB 4I6JB 3C6OB 2WQXA 4BSSA 4QC0A 2Z63A 2ASTB 4BSUA 2OMWA 3ULUA 1JL5A 1M9LA 4J0MA 5AWCA 3RGZA 3OJAB 4XOSA 3ULAA 4CNCA 4PEQB 4U09A 1M0ZA 3REZA 4R58A 3W3KA 3UL7A 3OGLB 3W3MA 1A4YA 3W3NA 4L3FA 2Z62A 2OMTA 4P8SA 3WN4A 2XOTA 1XCDA 5GMHA 3RW6A 3WPCA 4IM6A 2CA6A 3PMHG 4FHOA 3OJAA 1OGQA 1O6SA 3GOZA 4V2CA 4R0AA 3E6JA 4EZGA 1K5DC 3RFSA 1OZNA 1KOHA 2BEXA 1XECA 1OTMA 3WPGA 4G8AA 5IJBA 5IJDA 3M19A 1DFJI 4KXFB 1KOOA 1FT8A 4LSCA 1OOKG 4U7LA 4FD0A 3RIZA 5GMGA 3UL9A 3WPFA 4M7EC 1IO0A 3WPBA 4R09A 2WQUA 4NKGA 1O6TA 5B0TA 2ID5A 5B4PA 2V9TB 5LFNA 4V2DA 4R6FA 4LSXA 3ZYIA 3E2JA 4KNGA 4FMZA 3C6NB 2Z65A 4Z94G 1FQVA 2OMVA 4Q3IA 4R07A 2O6RA 2Z7XB 1O6VA 4L3AA 2V9SA 4ECNA 5AWDA 1H6TA 2OMXA 1ZIWA 1YRGA 3ULVA 4TZHA 4LSAA 1U0ND 2V70A 3VQ2A 2O6QA 4ECOA 1FO1A 1P8VA 4Z64C 2P1MB 4U08A 1LTXA 4HQ1A 1QYYA 3CVRA 4Z79A 4P91A 2RA8A 2WFHA 1SQ0B 1M10B 4LXRA 5A5CA 4LI2A 2XWTC 2OMYA 3OGMB 2Z7XA 4CILA 3E4GA 3ZYJA 4RCWA 3O53A 4UFRA 2R9UA 2UZYA 4NKHA 1XEUA 4KT1A 4Q3GA 2ASSB 3WPDA 4BV4R 5GQRK 4R5CA 4PSJA 4CC4A 2WQVA 3C6PB 4FCGA 3KJ4A 2WQWA 3BZ5A 4PKIG 4V2EA 2UZXA 3WPHA 1XWDC 5GMFA 4R5DA 4C2BB 4C2AB 2Z81A 2RR6A 3W3LA 4AW4A 4Z8GA 2P1QB 5IJCA 1OTOA 3DZEA 3OGKB 3A79B 2FT3A 2O6SA 4QXEA 4BSRA 4LSXC 2JE0A 1XKUA 4B8CD 5AWAA 3G39A 5CMPA 5CMNA 3M18A 4LXSA 3G06A 2Q4GW 3VQ1A 4Z61C 1Z7XW 4R6AA 3TSRE 2BNHA 3RW7A 1PGVA 5D3IA 1OTNA 1G9UA 3P72A 4ARRA 2IFGA 2Z66A 2Z64A 1P8TA 4J4LA 2OMZA 3W3GA 1D0BA 3ZYOA 5HDHA 3WPEA 1FS2A 4AY9X 4Y61B 3WPIA 1A9NA 4RWTC 4R6JA 3RFJA 2JQDA 3UN9A 3FXIA 5B0NA 3SB4A 4Q62A 2OMUA 1H6UA 3RJ0A 5IYXC 4GT6A 5GS0A 4FDWA 4QBZA 5HZLB 3G3AA 4U06A 4R6GA 3CIGA 3G3BA 3G04C 4CC4C 5GS2B 4CNMA 4CP6A 2Y5QA 3O6NA 3W3JA 4PQ8A 3ZYNA 3RFEA 1DCEA 1P9AG 5AZ5A 2A0ZA 3RGXA 4XSQA 4FS7A 2P1OB 2P1NB 4MN8B 4MQWX 4OQTA 1K5GC 4H09A 3UL8A 1M9SA 4WP6A 4XGOA 4GLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3Z A;  5AWB A;  2JE1 A;  4K17 A;  3JB9 j;  1GWB A;  1WWL A;  1W8A A;  3CIY A;  4LI1 A;  5FTT B;  4RCA B;  4R08 A;  2Z82 A;  2ELL A;  4YEB B;  4PER A;  4WYK A;  4ARN A;  1DS9 A;  4M7E A;  2P1P B;  4I6J B;  3C6O B;  2WQX A;  4BSS A;  4QC0 A;  2Z63 A;  2AST B;  4BSU A;  2OMW A;  3ULU A;  1JL5 A;  1M9L A;  4J0M A;  5AWC A;  3RGZ A;  3OJA B;  4XOS A;  3ULA A;  4CNC A;  4PEQ B;  4U09 A;  1M0Z A;  3REZ A;  4R58 A;  3W3K A;  3UL7 A;  3OGL B;  3W3M A;  1A4Y A;  3W3N A;  4L3F A;  2Z62 A;  2OMT A;  4P8S A;  3WN4 A;  2XOT A;  1XCD A;  5GMH A;  3RW6 A;  3WPC A;  4IM6 A;  2CA6 A;  3PMH G;  4FHO A;  3OJA A;  1OGQ A;  1O6S A;  3GOZ A;  4V2C A;  4R0A A;  3E6J A;  4EZG A;  1K5D C;  3RFS A;  1OZN A;  1KOH A;  2BEX A;  1XEC A;  1OTM A;  3WPG A;  4G8A A;  5IJB A;  5IJD A;  3M19 A;  1DFJ I;  4KXF B;  1KOO A;  1FT8 A;  4LSC A;  1OOK G;  4U7L A;  4FD0 A;  3RIZ A;  5GMG A;  3UL9 A;  3WPF A;  4M7E C;  1IO0 A;  3WPB A;  4R09 A;  2WQU A;  4NKG A;  1O6T A;  5B0T A;  2ID5 A;  5B4P A;  2V9T B;  5LFN A;  4V2D A;  4R6F A;  4LSX A;  3ZYI A;  3E2J A;  4KNG A;  4FMZ A;  3C6N B;  2Z65 A;  4Z94 G;  1FQV A;  2OMV A;  4Q3I A;  4R07 A;  2O6R A;  2Z7X B;  1O6V A;  4L3A A;  2V9S A;  4ECN A;  5AWD A;  1H6T A;  2OMX A;  1ZIW A;  1YRG A;  3ULV A;  4TZH A;  4LSA A;  1U0N D;  2V70 A;  3VQ2 A;  2O6Q A;  4ECO A;  1FO1 A;  1P8V A;  4Z64 C;  2P1M B;  4U08 A;  1LTX A;  4HQ1 A;  1QYY A;  3CVR A;  4Z79 A;  4P91 A;  2RA8 A;  2WFH A;  1SQ0 B;  1M10 B;  4LXR A;  5A5C A;  4LI2 A;  2XWT C;  2OMY A;  3OGM B;  2Z7X A;  4CIL A;  3E4G A;  3ZYJ A;  4RCW A;  3O53 A;  4UFR A;  2R9U A;  2UZY A;  4NKH A;  1XEU A;  4KT1 A;  4Q3G A;  2ASS B;  3WPD A;  4BV4 R;  5GQR K;  4R5C A;  4PSJ A;  4CC4 A;  2WQV A;  3C6P B;  4FCG A;  3KJ4 A;  2WQW A;  3BZ5 A;  4PKI G;  4V2E A;  2UZX A;  3WPH A;  1XWD C;  5GMF A;  4R5D A;  4C2B B;  4C2A B;  2Z81 A;  2RR6 A;  3W3L A;  4AW4 A;  4Z8G A;  2P1Q B;  5IJC A;  1OTO A;  3DZE A;  3OGK B;  3A79 B;  2FT3 A;  2O6S A;  4QXE A;  4BSR A;  4LSX C;  2JE0 A;  1XKU A;  4B8C D;  5AWA A;  3G39 A;  5CMP A;  5CMN A;  3M18 A;  4LXS A;  3G06 A;  2Q4G W;  3VQ1 A;  4Z61 C;  1Z7X W;  4R6A A;  3TSR E;  2BNH A;  3RW7 A;  1PGV A;  5D3I A;  1OTN A;  1G9U A;  3P72 A;  4ARR A;  2IFG A;  2Z66 A;  2Z64 A;  1P8T A;  4J4L A;  2OMZ A;  3W3G A;  1D0B A;  3ZYO A;  5HDH A;  3WPE A;  1FS2 A;  4AY9 X;  4Y61 B;  3WPI A;  1A9N A;  4RWT C;  4R6J A;  3RFJ A;  2JQD A;  3UN9 A;  3FXI A;  5B0N A;  3SB4 A;  4Q62 A;  2OMU A;  1H6U A;  3RJ0 A;  5IYX C;  4GT6 A;  5GS0 A;  4FDW A;  4QBZ A;  5HZL B;  3G3A A;  4U06 A;  4R6G A;  3CIG A;  3G3B A;  3G04 C;  4CC4 C;  5GS2 B;  4CNM A;  4CP6 A;  2Y5Q A;  3O6N A;  3W3J A;  4PQ8 A;  3ZYN A;  3RFE A;  1DCE A;  1P9A G;  5AZ5 A;  2A0Z A;  3RGX A;  4XSQ A;  4FS7 A;  2P1O B;  2P1N B;  4MN8 B;  4MQW X;  4OQT A;  1K5G C;  4H09 A;  3UL8 A;  1M9S A;  4WP6 A;  4XGO A;  4GLP A; 
#chains in the Genus database with same CATH topology
 3E3Z A;  5AWB A;  2JE1 A;  4K17 A;  3JB9 j;  1GWB A;  1WWL A;  1W8A A;  3CIY A;  4LI1 A;  5FTT B;  4RCA B;  4R08 A;  2Z82 A;  2ELL A;  4YEB B;  4PER A;  4WYK A;  4ARN A;  1DS9 A;  4M7E A;  2P1P B;  4I6J B;  3C6O B;  2WQX A;  4BSS A;  4QC0 A;  2Z63 A;  2AST B;  4BSU A;  2OMW A;  3ULU A;  1JL5 A;  1M9L A;  4J0M A;  5AWC A;  3RGZ A;  3OJA B;  4XOS A;  3ULA A;  4CNC A;  4PEQ B;  4U09 A;  1M0Z A;  3REZ A;  4R58 A;  3W3K A;  3UL7 A;  3OGL B;  3W3M A;  1A4Y A;  3W3N A;  4L3F A;  2Z62 A;  2OMT A;  4P8S A;  3WN4 A;  2XOT A;  1XCD A;  5GMH A;  3RW6 A;  3WPC A;  4IM6 A;  2CA6 A;  3PMH G;  4FHO A;  3OJA A;  1OGQ A;  1O6S A;  3GOZ A;  4V2C A;  4R0A A;  3E6J A;  4EZG A;  1K5D C;  3RFS A;  1OZN A;  1KOH A;  2BEX A;  1XEC A;  1OTM A;  3WPG A;  4G8A A;  5IJB A;  5IJD A;  3M19 A;  1DFJ I;  4KXF B;  1KOO A;  1FT8 A;  4LSC A;  1OOK G;  4U7L A;  4FD0 A;  3RIZ A;  5GMG A;  3UL9 A;  3WPF A;  4M7E C;  1IO0 A;  3WPB A;  4R09 A;  2WQU A;  4NKG A;  1O6T A;  5B0T A;  2ID5 A;  5B4P A;  2V9T B;  5LFN A;  4V2D A;  4R6F A;  4LSX A;  3ZYI A;  3E2J A;  4KNG A;  4FMZ A;  4NZT M;  3C6N B;  2Z65 A;  4Z94 G;  1FQV A;  2OMV A;  4Q3I A;  4R07 A;  2O6R A;  2Z7X B;  1O6V A;  4L3A A;  2V9S A;  4ECN A;  5AWD A;  1H6T A;  2OMX A;  1ZIW A;  1YRG A;  3ULV A;  4TZH A;  4LSA A;  1U0N D;  2V70 A;  3VQ2 A;  2O6Q A;  4ECO A;  1FO1 A;  1P8V A;  4Z64 C;  2P1M B;  4U08 A;  1LTX A;  4HQ1 A;  1QYY A;  3CVR A;  4Z79 A;  4P91 A;  2RA8 A;  2WFH A;  1SQ0 B;  1M10 B;  4LXR A;  5A5C A;  4LI2 A;  2XWT C;  2OMY A;  3OGM B;  2Z7X A;  4CIL A;  3E4G A;  3ZYJ A;  4RCW A;  3O53 A;  4UFR A;  2R9U A;  2UZY A;  4NKH A;  1XEU A;  4KT1 A;  4Q3G A;  2ASS B;  3WPD A;  4BV4 R;  5GQR K;  4R5C A;  4PSJ A;  4CC4 A;  2WQV A;  3C6P B;  4FCG A;  3KJ4 A;  2WQW A;  3BZ5 A;  4PKI G;  4V2E A;  2UZX A;  3WPH A;  1XWD C;  5GMF A;  4R5D A;  4C2B B;  4C2A B;  2Z81 A;  2RR6 A;  3W3L A;  4AW4 A;  4Z8G A;  2P1Q B;  5IJC A;  1OTO A;  3DZE A;  3OGK B;  3A79 B;  2FT3 A;  2O6S A;  4QXE A;  4BSR A;  4LSX C;  2JE0 A;  1XKU A;  4B8C D;  5AWA A;  3G39 A;  5CMP A;  5CMN A;  3M18 A;  4LXS A;  3G06 A;  2Q4G W;  3VQ1 A;  4Z61 C;  1Z7X W;  4R6A A;  3TSR E;  2BNH A;  3RW7 A;  1PGV A;  5D3I A;  1OTN A;  1G9U A;  3P72 A;  4ARR A;  2IFG A;  2Z66 A;  2Z64 A;  4NZR M;  1P8T A;  4J4L A;  2OMZ A;  3W3G A;  1D0B A;  3ZYO A;  5HDH A;  3WPE A;  1FS2 A;  4AY9 X;  4Y61 B;  3WPI A;  1A9N A;  4RWT C;  4R6J A;  3RFJ A;  2JQD A;  3UN9 A;  3FXI A;  5B0N A;  3SB4 A;  4Q62 A;  2OMU A;  1H6U A;  3RJ0 A;  5IYX C;  4GT6 A;  5GS0 A;  4FDW A;  4QBZ A;  5HZL B;  3G3A A;  4U06 A;  4R6G A;  3CIG A;  3G3B A;  3G04 C;  4CC4 C;  5GS2 B;  4CNM A;  4CP6 A;  2Y5Q A;  3O6N A;  3W3J A;  4PQ8 A;  3ZYN A;  3RFE A;  1DCE A;  1P9A G;  5AZ5 A;  2A0Z A;  3RGX A;  4XSQ A;  4FS7 A;  2P1O B;  2P1N B;  4MN8 B;  4MQW X;  4OQT A;  1K5G C;  4H09 A;  3UL8 A;  1M9S A;  4WP6 A;  4XGO A;  4GLP A; 
#chains in the Genus database with same CATH homology
 3E3Z A;  5AWB A;  2JE1 A;  4K17 A;  3JB9 j;  1GWB A;  1WWL A;  1W8A A;  3CIY A;  4LI1 A;  5FTT B;  4RCA B;  4R08 A;  2Z82 A;  2ELL A;  4YEB B;  4PER A;  4WYK A;  4ARN A;  1DS9 A;  4M7E A;  2P1P B;  4I6J B;  3C6O B;  2WQX A;  4BSS A;  4QC0 A;  2Z63 A;  2AST B;  4BSU A;  2OMW A;  3ULU A;  1JL5 A;  1M9L A;  4J0M A;  5AWC A;  3RGZ A;  3OJA B;  4XOS A;  3ULA A;  4CNC A;  4PEQ B;  4U09 A;  1M0Z A;  3REZ A;  4R58 A;  3W3K A;  3UL7 A;  3OGL B;  3W3M A;  1A4Y A;  3W3N A;  4L3F A;  2Z62 A;  2OMT A;  4P8S A;  3WN4 A;  2XOT A;  1XCD A;  5GMH A;  3RW6 A;  3WPC A;  4IM6 A;  2CA6 A;  3PMH G;  4FHO A;  3OJA A;  1OGQ A;  1O6S A;  3GOZ A;  4V2C A;  4R0A A;  3E6J A;  4EZG A;  1K5D C;  3RFS A;  1OZN A;  1KOH A;  2BEX A;  1XEC A;  1OTM A;  3WPG A;  4G8A A;  5IJB A;  5IJD A;  3M19 A;  1DFJ I;  4KXF B;  1KOO A;  1FT8 A;  4LSC A;  1OOK G;  4U7L A;  4FD0 A;  3RIZ A;  5GMG A;  3UL9 A;  3WPF A;  4M7E C;  1IO0 A;  3WPB A;  4R09 A;  2WQU A;  4NKG A;  1O6T A;  5B0T A;  2ID5 A;  5B4P A;  2V9T B;  5LFN A;  4V2D A;  4R6F A;  4LSX A;  3ZYI A;  3E2J A;  4KNG A;  4FMZ A;  3C6N B;  2Z65 A;  4Z94 G;  1FQV A;  2OMV A;  4Q3I A;  4R07 A;  2O6R A;  2Z7X B;  1O6V A;  4L3A A;  2V9S A;  4ECN A;  5AWD A;  1H6T A;  2OMX A;  1ZIW A;  1YRG A;  3ULV A;  4TZH A;  4LSA A;  1U0N D;  2V70 A;  3VQ2 A;  2O6Q A;  4ECO A;  1FO1 A;  1P8V A;  4Z64 C;  2P1M B;  4U08 A;  1LTX A;  4HQ1 A;  1QYY A;  3CVR A;  4Z79 A;  4P91 A;  2RA8 A;  2WFH A;  1SQ0 B;  1M10 B;  4LXR A;  5A5C A;  4LI2 A;  2XWT C;  2OMY A;  3OGM B;  2Z7X A;  4CIL A;  3E4G A;  3ZYJ A;  4RCW A;  3O53 A;  4UFR A;  2R9U A;  2UZY A;  4NKH A;  1XEU A;  4KT1 A;  4Q3G A;  2ASS B;  3WPD A;  4BV4 R;  5GQR K;  4R5C A;  4PSJ A;  4CC4 A;  2WQV A;  3C6P B;  4FCG A;  3KJ4 A;  2WQW A;  3BZ5 A;  4PKI G;  4V2E A;  2UZX A;  3WPH A;  1XWD C;  5GMF A;  4R5D A;  4C2B B;  4C2A B;  2Z81 A;  2RR6 A;  3W3L A;  4AW4 A;  4Z8G A;  2P1Q B;  5IJC A;  1OTO A;  3DZE A;  3OGK B;  3A79 B;  2FT3 A;  2O6S A;  4QXE A;  4BSR A;  4LSX C;  2JE0 A;  1XKU A;  4B8C D;  5AWA A;  3G39 A;  5CMP A;  5CMN A;  3M18 A;  4LXS A;  3G06 A;  2Q4G W;  3VQ1 A;  4Z61 C;  1Z7X W;  4R6A A;  3TSR E;  2BNH A;  3RW7 A;  1PGV A;  5D3I A;  1OTN A;  1G9U A;  3P72 A;  4ARR A;  2IFG A;  2Z66 A;  2Z64 A;  1P8T A;  4J4L A;  2OMZ A;  3W3G A;  1D0B A;  3ZYO A;  5HDH A;  3WPE A;  1FS2 A;  4AY9 X;  4Y61 B;  3WPI A;  1A9N A;  4RWT C;  4R6J A;  3RFJ A;  2JQD A;  3UN9 A;  3FXI A;  5B0N A;  3SB4 A;  4Q62 A;  2OMU A;  1H6U A;  3RJ0 A;  5IYX C;  4GT6 A;  5GS0 A;  4FDW A;  4QBZ A;  5HZL B;  3G3A A;  4U06 A;  4R6G A;  3CIG A;  3G3B A;  3G04 C;  4CC4 C;  5GS2 B;  4CNM A;  4CP6 A;  2Y5Q A;  3O6N A;  3W3J A;  4PQ8 A;  3ZYN A;  3RFE A;  1DCE A;  1P9A G;  5AZ5 A;  2A0Z A;  3RGX A;  4XSQ A;  4FS7 A;  2P1O B;  2P1N B;  4MN8 B;  4MQW X;  4OQT A;  1K5G C;  4H09 A;  3UL8 A;  1M9S A;  4WP6 A;  4XGO A;  4GLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...