4IM6A

Lrr domain from human nlrp1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
198
structure length
197
Chain Sequence
VTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSKLQRLQLVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQLLIFSRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords NACHT, LRR and PYD domains-containing protein 1
source organism Homo sapiens
total genus 83
structure length 197
sequence length 198
ec nomenclature
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4im6A00
5CMPA 2P1PB 5B0NA 3RGXA 3FXIA 2Z7XA 4KXFB 4M7EA 5GS0A 3OJAA 4BSRA 3WPGA 4FMZA 4LSCA 1FO1A 1P9AG 3GOZA 1IO0A 1A4YA 3G04C 3RFEA 2JQDA 3ZYJA 2ID5A 1PGVA 3CIGA 3UL7A 3REZA 5GMFA 4FDWA 3W3NA 4V2DA 3TSRE 4CILA 4CC4A 3E2JA 3WPHA 2ELLA 2RA8A 4EZGA 4V2EA 2Z64A 4PQ8A 4C2AB 3RGZA 5GMHA 2WQXA 1G9UA 4QC0A 1OZNA 2CA6A 2Z7XB 3OJAB 3ZYNA 4LSXC 2OMZA 3UL8A 4MN8B 4L3AA 2Z63A 1O6VA 2ASTB 2V9SA 2OMTA 5LFNA 4K17A 4AY9X 3WPCA 1KOHA 4Z94G 4Q3GA 4BV4R 2V70A 1K5GC 4C2BB 1FQVA 4RWTC 4PERA 5GS2B 4U06A 4XSQA 3RJ0A 4Z61C 1D0BA 4Y61B 3VQ2A 3WPEA 4QBZA 5AWDA 5CMNA 2P1NB 1Z7XW 4FS7A 4XGOA 1H6UA 3C6NB 4Z8GA 2O6SA 4ECOA 4IM6A 4P8SA 2UZXA 2A0ZA 1YRGA 5FTTB 4R5DA 5AZ5A 1KOOA 4PKIG 4B8CD 5HDHA 4XOSA 1DCEA 4MQWX 2JE1A 4GT6A 3CIYA 3P72A 4J4LA 3W3LA 1DS9A 4LSXA 1OTNA 4ECNA 3RIZA 2P1MB 4R0AA 5AWAA 2Z82A 1DFJI 2OMYA 4Z79A 3E3ZA 1XCDA 1K5DC 4LSAA 4G8AA 1M9LA 3ULUA 4KNGA 2XOTA 4I6JB 1M10B 1P8VA 5IYXC 4BSUA 3BZ5A 1LTXA 1W8AA 2Y5QA 4WP6A 1U0ND 1ZIWA 3W3MA 4R6GA 4R09A 4FHOA 4RCWA 4QXEA 4ARRA 2OMVA 2Z65A 3A79B 3KJ4A 2P1QB 3UL9A 3CVRA 5B4PA 2WQVA 4Z64C 1XKUA 4FD0A 3E4GA 2OMUA 1WWLA 4OQTA 2FT3A 2OMXA 4Q3IA 1P8TA 4CNCA 4NKHA 3WPFA 4KT1A 4TZHA 5IJBA 1H6TA 2UZYA 4HQ1A 3VQ1A 1OOKG 3W3GA 3UN9A 4L3FA 3DZEA 4U09A 1FT8A 3ULAA 4LXSA 2R9UA 2P1OB 2OMWA 5D3IA 2Z62A 4R07A 2IFGA 3G06A 3RFSA 4ARNA 1XEUA 4YEBB 4R6AA 4U7LA 3JB9j 1O6TA 3O6NA 3RFJA 2WQUA 3OGLB 3G3BA 1XECA 2ASSB 1M0ZA 1XWDC 1M9SA 2WFHA 4PEQB 4GLPA 4RCAB 3W3JA 3O53A 3ULVA 3WPIA 2Z81A 4R58A 3OGKB 4PSJA 3SB4A 4FCGA 3WPDA 3RW7A 4U08A 5IJDA 1OTMA 3ZYOA 4LXRA 4LI2A 4V2CA 5GQRK 3M19A 4R5CA 3W3KA 2JE0A 4P91A 3C6OB 2XWTC 2BNHA 1QYYA 3WN4A 4BSSA 1OTOA 4M7EC 4LI1A 1OGQA 3G39A 2BEXA 2O6RA 4H09A 5AWBA 1O6SA 2RR6A 2V9TB 4CNMA 1JL5A 4R6JA 1SQ0B 5A5CA 5AWCA 5GMGA 1GWBA 2O6QA 4R6FA 4J0MA 2Q4GW 4CP6A 3E6JA 4NKGA 4CC4C 4UFRA 3WPBA 4AW4A 3C6PB 3G3AA 4Q62A 2WQWA 3M18A 4R08A 1A9NA 3ZYIA 5B0TA 3RW6A 5IJCA 5HZLB 4WYKA 3PMHG 2Z66A 3OGMB 1FS2A
chains in the Genus database with same CATH superfamily
5CMPA 2P1PB 5B0NA 3RGXA 3FXIA 2Z7XA 4KXFB 4M7EA 5GS0A 3OJAA 4BSRA 3WPGA 4FMZA 4LSCA 1FO1A 1P9AG 3GOZA 1IO0A 1A4YA 3G04C 3RFEA 2JQDA 3ZYJA 2ID5A 1PGVA 3CIGA 3UL7A 3REZA 5GMFA 4FDWA 3W3NA 4V2DA 3TSRE 4CILA 4CC4A 3E2JA 3WPHA 2ELLA 2RA8A 4EZGA 4V2EA 2Z64A 4PQ8A 4C2AB 3RGZA 5GMHA 2WQXA 1G9UA 4QC0A 1OZNA 2CA6A 2Z7XB 3OJAB 3ZYNA 4LSXC 2OMZA 3UL8A 4MN8B 4L3AA 2Z63A 1O6VA 2ASTB 2V9SA 2OMTA 5LFNA 4K17A 4AY9X 3WPCA 1KOHA 4Z94G 4Q3GA 4BV4R 2V70A 1K5GC 4C2BB 1FQVA 4RWTC 4PERA 5GS2B 4U06A 4XSQA 3RJ0A 4Z61C 1D0BA 4Y61B 3VQ2A 3WPEA 4QBZA 5AWDA 5CMNA 2P1NB 1Z7XW 4FS7A 4XGOA 1H6UA 3C6NB 4Z8GA 2O6SA 4ECOA 4IM6A 4P8SA 2UZXA 2A0ZA 1YRGA 5FTTB 4R5DA 5AZ5A 1KOOA 4PKIG 4B8CD 5HDHA 4XOSA 1DCEA 4MQWX 2JE1A 4GT6A 3CIYA 3P72A 4J4LA 3W3LA 1DS9A 4LSXA 1OTNA 4ECNA 3RIZA 2P1MB 4R0AA 5AWAA 2Z82A 1DFJI 2OMYA 4Z79A 3E3ZA 1XCDA 1K5DC 4LSAA 4G8AA 1M9LA 3ULUA 4KNGA 2XOTA 4I6JB 1M10B 1P8VA 5IYXC 4BSUA 3BZ5A 1LTXA 1W8AA 2Y5QA 4WP6A 1U0ND 1ZIWA 3W3MA 4R6GA 4R09A 4FHOA 4RCWA 4QXEA 4ARRA 2OMVA 2Z65A 3A79B 3KJ4A 2P1QB 3UL9A 3CVRA 5B4PA 2WQVA 4Z64C 1XKUA 4FD0A 3E4GA 2OMUA 1WWLA 4OQTA 2FT3A 2OMXA 4Q3IA 1P8TA 4CNCA 4NKHA 3WPFA 4KT1A 4TZHA 5IJBA 1H6TA 2UZYA 4HQ1A 3VQ1A 1OOKG 3W3GA 3UN9A 4L3FA 3DZEA 4U09A 1FT8A 3ULAA 4LXSA 2R9UA 2P1OB 2OMWA 5D3IA 2Z62A 4R07A 2IFGA 3G06A 3RFSA 4ARNA 1XEUA 4YEBB 4R6AA 4U7LA 3JB9j 1O6TA 3O6NA 3RFJA 2WQUA 3OGLB 3G3BA 4NZRM 1XECA 2ASSB 1M0ZA 1XWDC 1M9SA 2WFHA 4PEQB 4GLPA 4RCAB 3W3JA 3O53A 3ULVA 3WPIA 2Z81A 4R58A 3OGKB 4PSJA 3SB4A 4FCGA 3WPDA 3RW7A 4U08A 5IJDA 1OTMA 3ZYOA 4LXRA 4LI2A 4V2CA 5GQRK 3M19A 4R5CA 3W3KA 2JE0A 4P91A 3C6OB 2XWTC 2BNHA 1QYYA 3WN4A 4BSSA 1OTOA 4M7EC 4LI1A 1OGQA 3G39A 2BEXA 2O6RA 4H09A 5AWBA 1O6SA 2RR6A 2V9TB 4CNMA 1JL5A 4R6JA 1SQ0B 5A5CA 5AWCA 5GMGA 1GWBA 2O6QA 4R6FA 4J0MA 2Q4GW 4CP6A 3E6JA 4NKGA 4CC4C 4UFRA 3WPBA 4AW4A 3C6PB 3G3AA 4Q62A 2WQWA 3M18A 4R08A 1A9NA 3ZYIA 5B0TA 3RW6A 5IJCA 5HZLB 4WYKA 3PMHG 2Z66A 4NZTM 3OGMB 1FS2A
chains in the Genus database with same CATH topology
5CMPA 2P1PB 5B0NA 3RGXA 3FXIA 2Z7XA 4KXFB 4M7EA 5GS0A 3OJAA 4BSRA 3WPGA 4FMZA 4LSCA 1FO1A 1P9AG 3GOZA 1IO0A 1A4YA 3G04C 3RFEA 2JQDA 3ZYJA 2ID5A 1PGVA 3CIGA 3UL7A 3REZA 5GMFA 4FDWA 3W3NA 4V2DA 3TSRE 4CILA 4CC4A 3E2JA 3WPHA 2ELLA 2RA8A 4EZGA 4V2EA 2Z64A 4PQ8A 4C2AB 3RGZA 5GMHA 2WQXA 1G9UA 4QC0A 1OZNA 2CA6A 2Z7XB 3OJAB 3ZYNA 4LSXC 2OMZA 3UL8A 4MN8B 4L3AA 2Z63A 1O6VA 2ASTB 2V9SA 2OMTA 5LFNA 4K17A 4AY9X 3WPCA 1KOHA 4Z94G 4Q3GA 4BV4R 2V70A 1K5GC 4C2BB 1FQVA 4RWTC 4PERA 5GS2B 4U06A 4XSQA 3RJ0A 4Z61C 1D0BA 4Y61B 3VQ2A 3WPEA 4QBZA 5AWDA 5CMNA 2P1NB 1Z7XW 4FS7A 4XGOA 1H6UA 3C6NB 4Z8GA 2O6SA 4ECOA 4IM6A 4P8SA 2UZXA 2A0ZA 1YRGA 5FTTB 4R5DA 5AZ5A 1KOOA 4PKIG 4B8CD 5HDHA 4XOSA 1DCEA 4MQWX 2JE1A 4GT6A 3CIYA 3P72A 4J4LA 3W3LA 1DS9A 4LSXA 1OTNA 4ECNA 3RIZA 2P1MB 4R0AA 5AWAA 2Z82A 1DFJI 2OMYA 4Z79A 3E3ZA 1XCDA 1K5DC 4LSAA 4G8AA 1M9LA 3ULUA 4KNGA 2XOTA 4I6JB 1M10B 1P8VA 5IYXC 4BSUA 3BZ5A 1LTXA 1W8AA 2Y5QA 4WP6A 1U0ND 1ZIWA 3W3MA 4R6GA 4R09A 4FHOA 4RCWA 4QXEA 4ARRA 2OMVA 2Z65A 3A79B 3KJ4A 2P1QB 3UL9A 3CVRA 5B4PA 2WQVA 4Z64C 1XKUA 4FD0A 3E4GA 2OMUA 1WWLA 4OQTA 2FT3A 2OMXA 4Q3IA 1P8TA 4CNCA 4NKHA 3WPFA 4KT1A 4TZHA 5IJBA 1H6TA 2UZYA 4HQ1A 3VQ1A 1OOKG 3W3GA 3UN9A 4L3FA 3DZEA 4U09A 1FT8A 3ULAA 4LXSA 2R9UA 2P1OB 2OMWA 5D3IA 2Z62A 4R07A 2IFGA 3G06A 3RFSA 4ARNA 1XEUA 4YEBB 4R6AA 4U7LA 3JB9j 1O6TA 3O6NA 3RFJA 2WQUA 3OGLB 3G3BA 1XECA 2ASSB 1M0ZA 1XWDC 1M9SA 2WFHA 4PEQB 4GLPA 4RCAB 3W3JA 3O53A 3ULVA 3WPIA 2Z81A 4R58A 3OGKB 4PSJA 3SB4A 4FCGA 3WPDA 3RW7A 4U08A 5IJDA 1OTMA 3ZYOA 4LXRA 4LI2A 4V2CA 5GQRK 3M19A 4R5CA 3W3KA 2JE0A 4P91A 3C6OB 2XWTC 2BNHA 1QYYA 3WN4A 4BSSA 1OTOA 4M7EC 4LI1A 1OGQA 3G39A 2BEXA 2O6RA 4H09A 5AWBA 1O6SA 2RR6A 2V9TB 4CNMA 1JL5A 4R6JA 1SQ0B 5A5CA 5AWCA 5GMGA 1GWBA 2O6QA 4R6FA 4J0MA 2Q4GW 4CP6A 3E6JA 4NKGA 4CC4C 4UFRA 3WPBA 4AW4A 3C6PB 3G3AA 4Q62A 2WQWA 3M18A 4R08A 1A9NA 3ZYIA 5B0TA 3RW6A 5IJCA 5HZLB 4WYKA 3PMHG 2Z66A 3OGMB 1FS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMP A;  2P1P B;  5B0N A;  3RGX A;  3FXI A;  2Z7X A;  4KXF B;  4M7E A;  5GS0 A;  3OJA A;  4BSR A;  3WPG A;  4FMZ A;  4LSC A;  1FO1 A;  1P9A G;  3GOZ A;  1IO0 A;  1A4Y A;  3G04 C;  3RFE A;  2JQD A;  3ZYJ A;  2ID5 A;  1PGV A;  3CIG A;  3UL7 A;  3REZ A;  5GMF A;  4FDW A;  3W3N A;  4V2D A;  3TSR E;  4CIL A;  4CC4 A;  3E2J A;  3WPH A;  2ELL A;  2RA8 A;  4EZG A;  4V2E A;  2Z64 A;  4PQ8 A;  4C2A B;  3RGZ A;  5GMH A;  2WQX A;  1G9U A;  4QC0 A;  1OZN A;  2CA6 A;  2Z7X B;  3OJA B;  3ZYN A;  4LSX C;  2OMZ A;  3UL8 A;  4MN8 B;  4L3A A;  2Z63 A;  1O6V A;  2AST B;  2V9S A;  2OMT A;  5LFN A;  4K17 A;  4AY9 X;  3WPC A;  1KOH A;  4Z94 G;  4Q3G A;  4BV4 R;  2V70 A;  1K5G C;  4C2B B;  1FQV A;  4RWT C;  4PER A;  5GS2 B;  4U06 A;  4XSQ A;  3RJ0 A;  4Z61 C;  1D0B A;  4Y61 B;  3VQ2 A;  3WPE A;  4QBZ A;  5AWD A;  5CMN A;  2P1N B;  1Z7X W;  4FS7 A;  4XGO A;  1H6U A;  3C6N B;  4Z8G A;  2O6S A;  4ECO A;  4IM6 A;  4P8S A;  2UZX A;  2A0Z A;  1YRG A;  5FTT B;  4R5D A;  5AZ5 A;  1KOO A;  4PKI G;  4B8C D;  5HDH A;  4XOS A;  1DCE A;  4MQW X;  2JE1 A;  4GT6 A;  3CIY A;  3P72 A;  4J4L A;  3W3L A;  1DS9 A;  4LSX A;  1OTN A;  4ECN A;  3RIZ A;  2P1M B;  4R0A A;  5AWA A;  2Z82 A;  1DFJ I;  2OMY A;  4Z79 A;  3E3Z A;  1XCD A;  1K5D C;  4LSA A;  4G8A A;  1M9L A;  3ULU A;  4KNG A;  2XOT A;  4I6J B;  1M10 B;  1P8V A;  5IYX C;  4BSU A;  3BZ5 A;  1LTX A;  1W8A A;  2Y5Q A;  4WP6 A;  1U0N D;  1ZIW A;  3W3M A;  4R6G A;  4R09 A;  4FHO A;  4RCW A;  4QXE A;  4ARR A;  2OMV A;  2Z65 A;  3A79 B;  3KJ4 A;  2P1Q B;  3UL9 A;  3CVR A;  5B4P A;  2WQV A;  4Z64 C;  1XKU A;  4FD0 A;  3E4G A;  2OMU A;  1WWL A;  4OQT A;  2FT3 A;  2OMX A;  4Q3I A;  1P8T A;  4CNC A;  4NKH A;  3WPF A;  4KT1 A;  4TZH A;  5IJB A;  1H6T A;  2UZY A;  4HQ1 A;  3VQ1 A;  1OOK G;  3W3G A;  3UN9 A;  4L3F A;  3DZE A;  4U09 A;  1FT8 A;  3ULA A;  4LXS A;  2R9U A;  2P1O B;  2OMW A;  5D3I A;  2Z62 A;  4R07 A;  2IFG A;  3G06 A;  3RFS A;  4ARN A;  1XEU A;  4YEB B;  4R6A A;  4U7L A;  3JB9 j;  1O6T A;  3O6N A;  3RFJ A;  2WQU A;  3OGL B;  3G3B A;  1XEC A;  2ASS B;  1M0Z A;  1XWD C;  1M9S A;  2WFH A;  4PEQ B;  4GLP A;  4RCA B;  3W3J A;  3O53 A;  3ULV A;  3WPI A;  2Z81 A;  4R58 A;  3OGK B;  4PSJ A;  3SB4 A;  4FCG A;  3WPD A;  3RW7 A;  4U08 A;  5IJD A;  1OTM A;  3ZYO A;  4LXR A;  4LI2 A;  4V2C A;  5GQR K;  3M19 A;  4R5C A;  3W3K A;  2JE0 A;  4P91 A;  3C6O B;  2XWT C;  2BNH A;  1QYY A;  3WN4 A;  4BSS A;  1OTO A;  4M7E C;  4LI1 A;  1OGQ A;  3G39 A;  2BEX A;  2O6R A;  4H09 A;  5AWB A;  1O6S A;  2RR6 A;  2V9T B;  4CNM A;  1JL5 A;  4R6J A;  1SQ0 B;  5A5C A;  5AWC A;  5GMG A;  1GWB A;  2O6Q A;  4R6F A;  4J0M A;  2Q4G W;  4CP6 A;  3E6J A;  4NKG A;  4CC4 C;  4UFR A;  3WPB A;  4AW4 A;  3C6P B;  3G3A A;  4Q62 A;  2WQW A;  3M18 A;  4R08 A;  1A9N A;  3ZYI A;  5B0T A;  3RW6 A;  5IJC A;  5HZL B;  4WYK A;  3PMH G;  2Z66 A;  3OGM B;  1FS2 A; 
#chains in the Genus database with same CATH topology
 5CMP A;  2P1P B;  5B0N A;  3RGX A;  3FXI A;  2Z7X A;  4KXF B;  4M7E A;  5GS0 A;  3OJA A;  4BSR A;  3WPG A;  4FMZ A;  4LSC A;  1FO1 A;  1P9A G;  3GOZ A;  1IO0 A;  1A4Y A;  3G04 C;  3RFE A;  2JQD A;  3ZYJ A;  2ID5 A;  1PGV A;  3CIG A;  3UL7 A;  3REZ A;  5GMF A;  4FDW A;  3W3N A;  4V2D A;  3TSR E;  4CIL A;  4CC4 A;  3E2J A;  3WPH A;  2ELL A;  2RA8 A;  4EZG A;  4V2E A;  2Z64 A;  4PQ8 A;  4C2A B;  3RGZ A;  5GMH A;  2WQX A;  1G9U A;  4QC0 A;  1OZN A;  2CA6 A;  2Z7X B;  3OJA B;  3ZYN A;  4LSX C;  2OMZ A;  3UL8 A;  4MN8 B;  4L3A A;  2Z63 A;  1O6V A;  2AST B;  2V9S A;  2OMT A;  5LFN A;  4K17 A;  4AY9 X;  3WPC A;  1KOH A;  4Z94 G;  4Q3G A;  4BV4 R;  2V70 A;  1K5G C;  4C2B B;  1FQV A;  4RWT C;  4PER A;  5GS2 B;  4U06 A;  4XSQ A;  3RJ0 A;  4Z61 C;  1D0B A;  4Y61 B;  3VQ2 A;  3WPE A;  4QBZ A;  5AWD A;  5CMN A;  2P1N B;  1Z7X W;  4FS7 A;  4XGO A;  1H6U A;  3C6N B;  4Z8G A;  2O6S A;  4ECO A;  4IM6 A;  4P8S A;  2UZX A;  2A0Z A;  1YRG A;  5FTT B;  4R5D A;  5AZ5 A;  1KOO A;  4PKI G;  4B8C D;  5HDH A;  4XOS A;  1DCE A;  4MQW X;  2JE1 A;  4GT6 A;  3CIY A;  3P72 A;  4J4L A;  3W3L A;  1DS9 A;  4LSX A;  1OTN A;  4ECN A;  3RIZ A;  2P1M B;  4R0A A;  5AWA A;  2Z82 A;  1DFJ I;  2OMY A;  4Z79 A;  3E3Z A;  1XCD A;  1K5D C;  4LSA A;  4G8A A;  1M9L A;  3ULU A;  4KNG A;  2XOT A;  4I6J B;  1M10 B;  1P8V A;  5IYX C;  4BSU A;  3BZ5 A;  1LTX A;  1W8A A;  2Y5Q A;  4WP6 A;  1U0N D;  1ZIW A;  3W3M A;  4R6G A;  4R09 A;  4FHO A;  4RCW A;  4QXE A;  4ARR A;  2OMV A;  2Z65 A;  3A79 B;  3KJ4 A;  2P1Q B;  3UL9 A;  3CVR A;  5B4P A;  2WQV A;  4Z64 C;  1XKU A;  4FD0 A;  3E4G A;  2OMU A;  1WWL A;  4OQT A;  2FT3 A;  2OMX A;  4Q3I A;  1P8T A;  4CNC A;  4NKH A;  3WPF A;  4KT1 A;  4TZH A;  5IJB A;  1H6T A;  2UZY A;  4HQ1 A;  3VQ1 A;  1OOK G;  3W3G A;  3UN9 A;  4L3F A;  3DZE A;  4U09 A;  1FT8 A;  3ULA A;  4LXS A;  2R9U A;  2P1O B;  2OMW A;  5D3I A;  2Z62 A;  4R07 A;  2IFG A;  3G06 A;  3RFS A;  4ARN A;  1XEU A;  4YEB B;  4R6A A;  4U7L A;  3JB9 j;  1O6T A;  3O6N A;  3RFJ A;  2WQU A;  3OGL B;  3G3B A;  4NZR M;  1XEC A;  2ASS B;  1M0Z A;  1XWD C;  1M9S A;  2WFH A;  4PEQ B;  4GLP A;  4RCA B;  3W3J A;  3O53 A;  3ULV A;  3WPI A;  2Z81 A;  4R58 A;  3OGK B;  4PSJ A;  3SB4 A;  4FCG A;  3WPD A;  3RW7 A;  4U08 A;  5IJD A;  1OTM A;  3ZYO A;  4LXR A;  4LI2 A;  4V2C A;  5GQR K;  3M19 A;  4R5C A;  3W3K A;  2JE0 A;  4P91 A;  3C6O B;  2XWT C;  2BNH A;  1QYY A;  3WN4 A;  4BSS A;  1OTO A;  4M7E C;  4LI1 A;  1OGQ A;  3G39 A;  2BEX A;  2O6R A;  4H09 A;  5AWB A;  1O6S A;  2RR6 A;  2V9T B;  4CNM A;  1JL5 A;  4R6J A;  1SQ0 B;  5A5C A;  5AWC A;  5GMG A;  1GWB A;  2O6Q A;  4R6F A;  4J0M A;  2Q4G W;  4CP6 A;  3E6J A;  4NKG A;  4CC4 C;  4UFR A;  3WPB A;  4AW4 A;  3C6P B;  3G3A A;  4Q62 A;  2WQW A;  3M18 A;  4R08 A;  1A9N A;  3ZYI A;  5B0T A;  3RW6 A;  5IJC A;  5HZL B;  4WYK A;  3PMH G;  2Z66 A;  4NZT M;  3OGM B;  1FS2 A; 
#chains in the Genus database with same CATH homology
 5CMP A;  2P1P B;  5B0N A;  3RGX A;  3FXI A;  2Z7X A;  4KXF B;  4M7E A;  5GS0 A;  3OJA A;  4BSR A;  3WPG A;  4FMZ A;  4LSC A;  1FO1 A;  1P9A G;  3GOZ A;  1IO0 A;  1A4Y A;  3G04 C;  3RFE A;  2JQD A;  3ZYJ A;  2ID5 A;  1PGV A;  3CIG A;  3UL7 A;  3REZ A;  5GMF A;  4FDW A;  3W3N A;  4V2D A;  3TSR E;  4CIL A;  4CC4 A;  3E2J A;  3WPH A;  2ELL A;  2RA8 A;  4EZG A;  4V2E A;  2Z64 A;  4PQ8 A;  4C2A B;  3RGZ A;  5GMH A;  2WQX A;  1G9U A;  4QC0 A;  1OZN A;  2CA6 A;  2Z7X B;  3OJA B;  3ZYN A;  4LSX C;  2OMZ A;  3UL8 A;  4MN8 B;  4L3A A;  2Z63 A;  1O6V A;  2AST B;  2V9S A;  2OMT A;  5LFN A;  4K17 A;  4AY9 X;  3WPC A;  1KOH A;  4Z94 G;  4Q3G A;  4BV4 R;  2V70 A;  1K5G C;  4C2B B;  1FQV A;  4RWT C;  4PER A;  5GS2 B;  4U06 A;  4XSQ A;  3RJ0 A;  4Z61 C;  1D0B A;  4Y61 B;  3VQ2 A;  3WPE A;  4QBZ A;  5AWD A;  5CMN A;  2P1N B;  1Z7X W;  4FS7 A;  4XGO A;  1H6U A;  3C6N B;  4Z8G A;  2O6S A;  4ECO A;  4IM6 A;  4P8S A;  2UZX A;  2A0Z A;  1YRG A;  5FTT B;  4R5D A;  5AZ5 A;  1KOO A;  4PKI G;  4B8C D;  5HDH A;  4XOS A;  1DCE A;  4MQW X;  2JE1 A;  4GT6 A;  3CIY A;  3P72 A;  4J4L A;  3W3L A;  1DS9 A;  4LSX A;  1OTN A;  4ECN A;  3RIZ A;  2P1M B;  4R0A A;  5AWA A;  2Z82 A;  1DFJ I;  2OMY A;  4Z79 A;  3E3Z A;  1XCD A;  1K5D C;  4LSA A;  4G8A A;  1M9L A;  3ULU A;  4KNG A;  2XOT A;  4I6J B;  1M10 B;  1P8V A;  5IYX C;  4BSU A;  3BZ5 A;  1LTX A;  1W8A A;  2Y5Q A;  4WP6 A;  1U0N D;  1ZIW A;  3W3M A;  4R6G A;  4R09 A;  4FHO A;  4RCW A;  4QXE A;  4ARR A;  2OMV A;  2Z65 A;  3A79 B;  3KJ4 A;  2P1Q B;  3UL9 A;  3CVR A;  5B4P A;  2WQV A;  4Z64 C;  1XKU A;  4FD0 A;  3E4G A;  2OMU A;  1WWL A;  4OQT A;  2FT3 A;  2OMX A;  4Q3I A;  1P8T A;  4CNC A;  4NKH A;  3WPF A;  4KT1 A;  4TZH A;  5IJB A;  1H6T A;  2UZY A;  4HQ1 A;  3VQ1 A;  1OOK G;  3W3G A;  3UN9 A;  4L3F A;  3DZE A;  4U09 A;  1FT8 A;  3ULA A;  4LXS A;  2R9U A;  2P1O B;  2OMW A;  5D3I A;  2Z62 A;  4R07 A;  2IFG A;  3G06 A;  3RFS A;  4ARN A;  1XEU A;  4YEB B;  4R6A A;  4U7L A;  3JB9 j;  1O6T A;  3O6N A;  3RFJ A;  2WQU A;  3OGL B;  3G3B A;  1XEC A;  2ASS B;  1M0Z A;  1XWD C;  1M9S A;  2WFH A;  4PEQ B;  4GLP A;  4RCA B;  3W3J A;  3O53 A;  3ULV A;  3WPI A;  2Z81 A;  4R58 A;  3OGK B;  4PSJ A;  3SB4 A;  4FCG A;  3WPD A;  3RW7 A;  4U08 A;  5IJD A;  1OTM A;  3ZYO A;  4LXR A;  4LI2 A;  4V2C A;  5GQR K;  3M19 A;  4R5C A;  3W3K A;  2JE0 A;  4P91 A;  3C6O B;  2XWT C;  2BNH A;  1QYY A;  3WN4 A;  4BSS A;  1OTO A;  4M7E C;  4LI1 A;  1OGQ A;  3G39 A;  2BEX A;  2O6R A;  4H09 A;  5AWB A;  1O6S A;  2RR6 A;  2V9T B;  4CNM A;  1JL5 A;  4R6J A;  1SQ0 B;  5A5C A;  5AWC A;  5GMG A;  1GWB A;  2O6Q A;  4R6F A;  4J0M A;  2Q4G W;  4CP6 A;  3E6J A;  4NKG A;  4CC4 C;  4UFR A;  3WPB A;  4AW4 A;  3C6P B;  3G3A A;  4Q62 A;  2WQW A;  3M18 A;  4R08 A;  1A9N A;  3ZYI A;  5B0T A;  3RW6 A;  5IJC A;  5HZL B;  4WYK A;  3PMH G;  2Z66 A;  3OGM B;  1FS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...