4IM6A

Lrr domain from human nlrp1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
198
structure length
197
Chain Sequence
b'VTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSKLQRLQLVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQLLIFSRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NACHT, LRR and PYD domains-containing protein 1
source organism Homo sapiens
molecule tags Structural protein
total genus 83
structure length 197
sequence length 198
ec nomenclature
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4im6A00
4U08A 1OZNA 4Q3GA 4QBZA 4I6JB 2P1OB 3M18A 4FMZA 4AY9X 4ARRA 2V9SA 3UN9A 5AWDA 4R58A 5IJDA 2WQVA 1KOHA 5B0NA 3ZYJA 5HZLB 4CP6A 2WQXA 1FQVA 1M9SA 4L3AA 2ELLA 2V9TB 2JE0A 2OMTA 1FO1A 2O6QA 5LFNA 3BZ5A 4Z61C 3VQ1A 3C6NB 4FS7A 4MQWX 4J4LA 4NKHA 4LXSA 4AW4A 3W3JA 4J0MA 3G04C 4R0AA 4R07A 4GT6A 1U0ND 2RA8A 2Z81A 2Y5QA 3W3NA 1WWLA 3W3KA 2WQUA 4V2DA 4G8AA 1KOOA 2UZXA 3O6NA 4KXFB 3RGXA 1P9AG 2BNHA 3DZEA 1FS2A 1XEUA 1QYYA 1XKUA 4V2CA 5A5CA 2P1MB 4FHOA 3E4GA 1K5GC 2WQWA 1A4YA 3P72A 2Z66A 4RCWA 5GMHA 5GMFA 3SB4A 1OTOA 4FDWA 4LSAA 5FTTB 5GMGA 3OGLB 5B4PA 2Z82A 1JL5A 3W3GA 4QXEA 2WFHA 3E2JA 4ECOA 3RGZA 3RFEA 3OGKB 4CC4A 4L3FA 2BEXA 3ULAA 3KJ4A 3PMHG 1D0BA 1XCDA 2Q4GW 4FD0A 4LSCA 4P91A 3CIGA 5IJCA 4EZGA 4M7EA 1M10B 4R6AA 1DFJI 4WP6A 4ARNA 1O6TA 2XOTA 4KNGA 4PSJA 5B0TA 2OMVA 1M9LA 4BSSA 3WPCA 3RFSA 2JE1A 4U7LA 3WPIA 4Z64C 4RCAB 2FT3A 4U06A 4R6GA 1O6VA 4CNMA 2CA6A 3E6JA 1ZIWA 4PERA 5AWBA 1FT8A 4Q3IA 2OMZA 4XGOA 4R6JA 2V70A 4CNCA 4LXRA 4BSRA 3WPDA 2ID5A 5IJBA 1YRGA 4LSXC 5AZ5A 5AWCA 4H09A 3UL8A 3E3ZA 1LTXA 2R9UA 4C2AB 4TZHA 2UZYA 3OJAB 3G3BA 5GS2B 1XECA 3CIYA 3WPGA 3WN4A 3ULVA 4UFRA 3RW6A 3WPHA 3WPFA 1A9NA 3RFJA 3JB9j 2Z7XB 2ASTB 2Z63A 3G06A 2A0ZA 4Y61B 4P8SA 3REZA 3TSRE 3ULUA 4HQ1A 2XWTC 3G39A 4XOSA 2P1NB 3C6OB 1H6UA 4MN8B 4NKGA 1PGVA 1P8TA 2Z65A 3G3AA 2RR6A 1OOKG 1OTMA 4FCGA 3WPEA 3VQ2A 2Z7XA 4RWTC 2P1QB 4CILA 4WYKA 1W8AA 4ECNA 2IFGA 1P8VA 1OGQA 3RW7A 1DCEA 4R5DA 1H6TA 1OTNA 4R5CA 3RIZA 4LI2A 1XWDC 3OGMB 1G9UA 4PQ8A 4Z94G 2OMXA 5AWAA 5CMNA 4QC0A 2O6SA 4K17A 3UL7A 4Z8GA 1O6SA 4OQTA 4V2EA 2OMUA 3WPBA 1SQ0B 4PEQB 3ZYOA 4YEBB 1K5DC 3W3LA 3C6PB 4Z79A 5HDHA 4BSUA 4U09A 5IYXC 2ASSB 4C2BB 2Z62A 2O6RA 4GLPA 5GS0A 4R6FA 2P1PB 3M19A 3CVRA 4XSQA 3ZYIA 3FXIA 2Z64A 3GOZA 3A79B 4CC4C 3RJ0A 1IO0A 2OMWA 3UL9A 2JQDA 4PKIG 4B8CD 5D3IA 4R08A 4Q62A 4LSXA 4BV4R 4R09A 4IM6A 5GQRK 3OJAA 1DS9A 1M0ZA 3ZYNA 5CMPA 1GWBA 4M7EC 4KT1A 1Z7XW 3W3MA 4LI1A 3O53A 2OMYA
chains in the Genus database with same CATH superfamily
4U08A 1OZNA 4Q3GA 4QBZA 4I6JB 2P1OB 3M18A 4FMZA 4AY9X 4ARRA 2V9SA 3UN9A 5AWDA 4R58A 5IJDA 2WQVA 1KOHA 5B0NA 3ZYJA 5HZLB 4CP6A 2WQXA 1FQVA 1M9SA 4L3AA 2ELLA 2V9TB 2JE0A 2OMTA 1FO1A 2O6QA 5LFNA 3BZ5A 4Z61C 3VQ1A 3C6NB 4FS7A 4MQWX 4J4LA 4NKHA 4LXSA 4AW4A 3W3JA 4J0MA 3G04C 4R0AA 4R07A 4GT6A 1U0ND 2RA8A 2Z81A 2Y5QA 3W3NA 1WWLA 3W3KA 2WQUA 4V2DA 4G8AA 1KOOA 2UZXA 3O6NA 4KXFB 3RGXA 1P9AG 2BNHA 3DZEA 1FS2A 1XEUA 1QYYA 1XKUA 4V2CA 5A5CA 2P1MB 4FHOA 3E4GA 1K5GC 2WQWA 1A4YA 3P72A 2Z66A 4RCWA 5GMHA 5GMFA 3SB4A 1OTOA 4FDWA 4LSAA 5FTTB 5GMGA 3OGLB 5B4PA 2Z82A 1JL5A 3W3GA 4QXEA 2WFHA 3E2JA 4ECOA 3RGZA 3RFEA 3OGKB 4CC4A 4L3FA 2BEXA 3ULAA 3KJ4A 3PMHG 1D0BA 1XCDA 2Q4GW 4FD0A 4LSCA 4P91A 3CIGA 5IJCA 4EZGA 4M7EA 1M10B 4R6AA 1DFJI 4WP6A 4ARNA 4NZTM 1O6TA 2XOTA 4KNGA 4PSJA 5B0TA 2OMVA 1M9LA 4NZRM 4BSSA 3WPCA 3RFSA 2JE1A 4U7LA 3WPIA 4Z64C 4RCAB 2FT3A 4U06A 4R6GA 1O6VA 4CNMA 2CA6A 3E6JA 1ZIWA 4PERA 5AWBA 1FT8A 4Q3IA 2OMZA 4XGOA 4R6JA 2V70A 4CNCA 4LXRA 4BSRA 3WPDA 2ID5A 5IJBA 1YRGA 4LSXC 5AZ5A 5AWCA 4H09A 3UL8A 3E3ZA 1LTXA 2R9UA 4C2AB 4TZHA 2UZYA 3OJAB 3G3BA 5GS2B 1XECA 3CIYA 3WPGA 3WN4A 3ULVA 4UFRA 3RW6A 3WPHA 3WPFA 1A9NA 3RFJA 3JB9j 2Z7XB 2ASTB 2Z63A 3G06A 2A0ZA 4Y61B 4P8SA 3REZA 3TSRE 3ULUA 4HQ1A 2XWTC 3G39A 4XOSA 2P1NB 3C6OB 1H6UA 4MN8B 4NKGA 1PGVA 1P8TA 2Z65A 3G3AA 2RR6A 1OOKG 1OTMA 4FCGA 3WPEA 3VQ2A 2Z7XA 4RWTC 2P1QB 4CILA 4WYKA 1W8AA 4ECNA 2IFGA 1P8VA 1OGQA 3RW7A 1DCEA 4R5DA 1H6TA 1OTNA 4R5CA 3RIZA 4LI2A 1XWDC 3OGMB 1G9UA 4PQ8A 4Z94G 2OMXA 5AWAA 5CMNA 4QC0A 2O6SA 4K17A 3UL7A 4Z8GA 1O6SA 4OQTA 4V2EA 2OMUA 3WPBA 1SQ0B 4PEQB 3ZYOA 4YEBB 1K5DC 3W3LA 3C6PB 4Z79A 5HDHA 4BSUA 4U09A 5IYXC 2ASSB 4C2BB 2Z62A 2O6RA 4GLPA 5GS0A 4R6FA 2P1PB 3M19A 3CVRA 4XSQA 3ZYIA 3FXIA 2Z64A 3GOZA 3A79B 4CC4C 3RJ0A 1IO0A 2OMWA 3UL9A 2JQDA 4PKIG 4B8CD 5D3IA 4R08A 4Q62A 4LSXA 4BV4R 4R09A 4IM6A 5GQRK 3OJAA 1DS9A 1M0ZA 3ZYNA 5CMPA 1GWBA 4M7EC 4KT1A 1Z7XW 3W3MA 4LI1A 3O53A 2OMYA
chains in the Genus database with same CATH topology
4U08A 1OZNA 4Q3GA 4QBZA 4I6JB 2P1OB 3M18A 4FMZA 4AY9X 4ARRA 2V9SA 3UN9A 5AWDA 4R58A 5IJDA 2WQVA 1KOHA 5B0NA 3ZYJA 5HZLB 4CP6A 2WQXA 1FQVA 1M9SA 4L3AA 2ELLA 2V9TB 2JE0A 2OMTA 1FO1A 2O6QA 5LFNA 3BZ5A 4Z61C 3VQ1A 3C6NB 4FS7A 4MQWX 4J4LA 4NKHA 4LXSA 4AW4A 3W3JA 4J0MA 3G04C 4R0AA 4R07A 4GT6A 1U0ND 2RA8A 2Z81A 2Y5QA 3W3NA 1WWLA 3W3KA 2WQUA 4V2DA 4G8AA 1KOOA 2UZXA 3O6NA 4KXFB 3RGXA 1P9AG 2BNHA 3DZEA 1FS2A 1XEUA 1QYYA 1XKUA 4V2CA 5A5CA 2P1MB 4FHOA 3E4GA 1K5GC 2WQWA 1A4YA 3P72A 2Z66A 4RCWA 5GMHA 5GMFA 3SB4A 1OTOA 4FDWA 4LSAA 5FTTB 5GMGA 3OGLB 5B4PA 2Z82A 1JL5A 3W3GA 4QXEA 2WFHA 3E2JA 4ECOA 3RGZA 3RFEA 3OGKB 4CC4A 4L3FA 2BEXA 3ULAA 3KJ4A 3PMHG 1D0BA 1XCDA 2Q4GW 4FD0A 4LSCA 4P91A 3CIGA 5IJCA 4EZGA 4M7EA 1M10B 4R6AA 1DFJI 4WP6A 4ARNA 1O6TA 2XOTA 4KNGA 4PSJA 5B0TA 2OMVA 1M9LA 4BSSA 3WPCA 3RFSA 2JE1A 4U7LA 3WPIA 4Z64C 4RCAB 2FT3A 4U06A 4R6GA 1O6VA 4CNMA 2CA6A 3E6JA 1ZIWA 4PERA 5AWBA 1FT8A 4Q3IA 2OMZA 4XGOA 4R6JA 2V70A 4CNCA 4LXRA 4BSRA 3WPDA 2ID5A 5IJBA 1YRGA 4LSXC 5AZ5A 5AWCA 4H09A 3UL8A 3E3ZA 1LTXA 2R9UA 4C2AB 4TZHA 2UZYA 3OJAB 3G3BA 5GS2B 1XECA 3CIYA 3WPGA 3WN4A 3ULVA 4UFRA 3RW6A 3WPHA 3WPFA 1A9NA 3RFJA 3JB9j 2Z7XB 2ASTB 2Z63A 3G06A 2A0ZA 4Y61B 4P8SA 3REZA 3TSRE 3ULUA 4HQ1A 2XWTC 3G39A 4XOSA 2P1NB 3C6OB 1H6UA 4MN8B 4NKGA 1PGVA 1P8TA 2Z65A 3G3AA 2RR6A 1OOKG 1OTMA 4FCGA 3WPEA 3VQ2A 2Z7XA 4RWTC 2P1QB 4CILA 4WYKA 1W8AA 4ECNA 2IFGA 1P8VA 1OGQA 3RW7A 1DCEA 4R5DA 1H6TA 1OTNA 4R5CA 3RIZA 4LI2A 1XWDC 3OGMB 1G9UA 4PQ8A 4Z94G 2OMXA 5AWAA 5CMNA 4QC0A 2O6SA 4K17A 3UL7A 4Z8GA 1O6SA 4OQTA 4V2EA 2OMUA 3WPBA 1SQ0B 4PEQB 3ZYOA 4YEBB 1K5DC 3W3LA 3C6PB 4Z79A 5HDHA 4BSUA 4U09A 5IYXC 2ASSB 4C2BB 2Z62A 2O6RA 4GLPA 5GS0A 4R6FA 2P1PB 3M19A 3CVRA 4XSQA 3ZYIA 3FXIA 2Z64A 3GOZA 3A79B 4CC4C 3RJ0A 1IO0A 2OMWA 3UL9A 2JQDA 4PKIG 4B8CD 5D3IA 4R08A 4Q62A 4LSXA 4BV4R 4R09A 4IM6A 5GQRK 3OJAA 1DS9A 1M0ZA 3ZYNA 5CMPA 1GWBA 4M7EC 4KT1A 1Z7XW 3W3MA 4LI1A 3O53A 2OMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U08 A;  1OZN A;  4Q3G A;  4QBZ A;  4I6J B;  2P1O B;  3M18 A;  4FMZ A;  4AY9 X;  4ARR A;  2V9S A;  3UN9 A;  5AWD A;  4R58 A;  5IJD A;  2WQV A;  1KOH A;  5B0N A;  3ZYJ A;  5HZL B;  4CP6 A;  2WQX A;  1FQV A;  1M9S A;  4L3A A;  2ELL A;  2V9T B;  2JE0 A;  2OMT A;  1FO1 A;  2O6Q A;  5LFN A;  3BZ5 A;  4Z61 C;  3VQ1 A;  3C6N B;  4FS7 A;  4MQW X;  4J4L A;  4NKH A;  4LXS A;  4AW4 A;  3W3J A;  4J0M A;  3G04 C;  4R0A A;  4R07 A;  4GT6 A;  1U0N D;  2RA8 A;  2Z81 A;  2Y5Q A;  3W3N A;  1WWL A;  3W3K A;  2WQU A;  4V2D A;  4G8A A;  1KOO A;  2UZX A;  3O6N A;  4KXF B;  3RGX A;  1P9A G;  2BNH A;  3DZE A;  1FS2 A;  1XEU A;  1QYY A;  1XKU A;  4V2C A;  5A5C A;  2P1M B;  4FHO A;  3E4G A;  1K5G C;  2WQW A;  1A4Y A;  3P72 A;  2Z66 A;  4RCW A;  5GMH A;  5GMF A;  3SB4 A;  1OTO A;  4FDW A;  4LSA A;  5FTT B;  5GMG A;  3OGL B;  5B4P A;  2Z82 A;  1JL5 A;  3W3G A;  4QXE A;  2WFH A;  3E2J A;  4ECO A;  3RGZ A;  3RFE A;  3OGK B;  4CC4 A;  4L3F A;  2BEX A;  3ULA A;  3KJ4 A;  3PMH G;  1D0B A;  1XCD A;  2Q4G W;  4FD0 A;  4LSC A;  4P91 A;  3CIG A;  5IJC A;  4EZG A;  4M7E A;  1M10 B;  4R6A A;  1DFJ I;  4WP6 A;  4ARN A;  1O6T A;  2XOT A;  4KNG A;  4PSJ A;  5B0T A;  2OMV A;  1M9L A;  4BSS A;  3WPC A;  3RFS A;  2JE1 A;  4U7L A;  3WPI A;  4Z64 C;  4RCA B;  2FT3 A;  4U06 A;  4R6G A;  1O6V A;  4CNM A;  2CA6 A;  3E6J A;  1ZIW A;  4PER A;  5AWB A;  1FT8 A;  4Q3I A;  2OMZ A;  4XGO A;  4R6J A;  2V70 A;  4CNC A;  4LXR A;  4BSR A;  3WPD A;  2ID5 A;  5IJB A;  1YRG A;  4LSX C;  5AZ5 A;  5AWC A;  4H09 A;  3UL8 A;  3E3Z A;  1LTX A;  2R9U A;  4C2A B;  4TZH A;  2UZY A;  3OJA B;  3G3B A;  5GS2 B;  1XEC A;  3CIY A;  3WPG A;  3WN4 A;  3ULV A;  4UFR A;  3RW6 A;  3WPH A;  3WPF A;  1A9N A;  3RFJ A;  3JB9 j;  2Z7X B;  2AST B;  2Z63 A;  3G06 A;  2A0Z A;  4Y61 B;  4P8S A;  3REZ A;  3TSR E;  3ULU A;  4HQ1 A;  2XWT C;  3G39 A;  4XOS A;  2P1N B;  3C6O B;  1H6U A;  4MN8 B;  4NKG A;  1PGV A;  1P8T A;  2Z65 A;  3G3A A;  2RR6 A;  1OOK G;  1OTM A;  4FCG A;  3WPE A;  3VQ2 A;  2Z7X A;  4RWT C;  2P1Q B;  4CIL A;  4WYK A;  1W8A A;  4ECN A;  2IFG A;  1P8V A;  1OGQ A;  3RW7 A;  1DCE A;  4R5D A;  1H6T A;  1OTN A;  4R5C A;  3RIZ A;  4LI2 A;  1XWD C;  3OGM B;  1G9U A;  4PQ8 A;  4Z94 G;  2OMX A;  5AWA A;  5CMN A;  4QC0 A;  2O6S A;  4K17 A;  3UL7 A;  4Z8G A;  1O6S A;  4OQT A;  4V2E A;  2OMU A;  3WPB A;  1SQ0 B;  4PEQ B;  3ZYO A;  4YEB B;  1K5D C;  3W3L A;  3C6P B;  4Z79 A;  5HDH A;  4BSU A;  4U09 A;  5IYX C;  2ASS B;  4C2B B;  2Z62 A;  2O6R A;  4GLP A;  5GS0 A;  4R6F A;  2P1P B;  3M19 A;  3CVR A;  4XSQ A;  3ZYI A;  3FXI A;  2Z64 A;  3GOZ A;  3A79 B;  4CC4 C;  3RJ0 A;  1IO0 A;  2OMW A;  3UL9 A;  2JQD A;  4PKI G;  4B8C D;  5D3I A;  4R08 A;  4Q62 A;  4LSX A;  4BV4 R;  4R09 A;  4IM6 A;  5GQR K;  3OJA A;  1DS9 A;  1M0Z A;  3ZYN A;  5CMP A;  1GWB A;  4M7E C;  4KT1 A;  1Z7X W;  3W3M A;  4LI1 A;  3O53 A;  2OMY A; 
#chains in the Genus database with same CATH topology
 4U08 A;  1OZN A;  4Q3G A;  4QBZ A;  4I6J B;  2P1O B;  3M18 A;  4FMZ A;  4AY9 X;  4ARR A;  2V9S A;  3UN9 A;  5AWD A;  4R58 A;  5IJD A;  2WQV A;  1KOH A;  5B0N A;  3ZYJ A;  5HZL B;  4CP6 A;  2WQX A;  1FQV A;  1M9S A;  4L3A A;  2ELL A;  2V9T B;  2JE0 A;  2OMT A;  1FO1 A;  2O6Q A;  5LFN A;  3BZ5 A;  4Z61 C;  3VQ1 A;  3C6N B;  4FS7 A;  4MQW X;  4J4L A;  4NKH A;  4LXS A;  4AW4 A;  3W3J A;  4J0M A;  3G04 C;  4R0A A;  4R07 A;  4GT6 A;  1U0N D;  2RA8 A;  2Z81 A;  2Y5Q A;  3W3N A;  1WWL A;  3W3K A;  2WQU A;  4V2D A;  4G8A A;  1KOO A;  2UZX A;  3O6N A;  4KXF B;  3RGX A;  1P9A G;  2BNH A;  3DZE A;  1FS2 A;  1XEU A;  1QYY A;  1XKU A;  4V2C A;  5A5C A;  2P1M B;  4FHO A;  3E4G A;  1K5G C;  2WQW A;  1A4Y A;  3P72 A;  2Z66 A;  4RCW A;  5GMH A;  5GMF A;  3SB4 A;  1OTO A;  4FDW A;  4LSA A;  5FTT B;  5GMG A;  3OGL B;  5B4P A;  2Z82 A;  1JL5 A;  3W3G A;  4QXE A;  2WFH A;  3E2J A;  4ECO A;  3RGZ A;  3RFE A;  3OGK B;  4CC4 A;  4L3F A;  2BEX A;  3ULA A;  3KJ4 A;  3PMH G;  1D0B A;  1XCD A;  2Q4G W;  4FD0 A;  4LSC A;  4P91 A;  3CIG A;  5IJC A;  4EZG A;  4M7E A;  1M10 B;  4R6A A;  1DFJ I;  4WP6 A;  4ARN A;  4NZT M;  1O6T A;  2XOT A;  4KNG A;  4PSJ A;  5B0T A;  2OMV A;  1M9L A;  4NZR M;  4BSS A;  3WPC A;  3RFS A;  2JE1 A;  4U7L A;  3WPI A;  4Z64 C;  4RCA B;  2FT3 A;  4U06 A;  4R6G A;  1O6V A;  4CNM A;  2CA6 A;  3E6J A;  1ZIW A;  4PER A;  5AWB A;  1FT8 A;  4Q3I A;  2OMZ A;  4XGO A;  4R6J A;  2V70 A;  4CNC A;  4LXR A;  4BSR A;  3WPD A;  2ID5 A;  5IJB A;  1YRG A;  4LSX C;  5AZ5 A;  5AWC A;  4H09 A;  3UL8 A;  3E3Z A;  1LTX A;  2R9U A;  4C2A B;  4TZH A;  2UZY A;  3OJA B;  3G3B A;  5GS2 B;  1XEC A;  3CIY A;  3WPG A;  3WN4 A;  3ULV A;  4UFR A;  3RW6 A;  3WPH A;  3WPF A;  1A9N A;  3RFJ A;  3JB9 j;  2Z7X B;  2AST B;  2Z63 A;  3G06 A;  2A0Z A;  4Y61 B;  4P8S A;  3REZ A;  3TSR E;  3ULU A;  4HQ1 A;  2XWT C;  3G39 A;  4XOS A;  2P1N B;  3C6O B;  1H6U A;  4MN8 B;  4NKG A;  1PGV A;  1P8T A;  2Z65 A;  3G3A A;  2RR6 A;  1OOK G;  1OTM A;  4FCG A;  3WPE A;  3VQ2 A;  2Z7X A;  4RWT C;  2P1Q B;  4CIL A;  4WYK A;  1W8A A;  4ECN A;  2IFG A;  1P8V A;  1OGQ A;  3RW7 A;  1DCE A;  4R5D A;  1H6T A;  1OTN A;  4R5C A;  3RIZ A;  4LI2 A;  1XWD C;  3OGM B;  1G9U A;  4PQ8 A;  4Z94 G;  2OMX A;  5AWA A;  5CMN A;  4QC0 A;  2O6S A;  4K17 A;  3UL7 A;  4Z8G A;  1O6S A;  4OQT A;  4V2E A;  2OMU A;  3WPB A;  1SQ0 B;  4PEQ B;  3ZYO A;  4YEB B;  1K5D C;  3W3L A;  3C6P B;  4Z79 A;  5HDH A;  4BSU A;  4U09 A;  5IYX C;  2ASS B;  4C2B B;  2Z62 A;  2O6R A;  4GLP A;  5GS0 A;  4R6F A;  2P1P B;  3M19 A;  3CVR A;  4XSQ A;  3ZYI A;  3FXI A;  2Z64 A;  3GOZ A;  3A79 B;  4CC4 C;  3RJ0 A;  1IO0 A;  2OMW A;  3UL9 A;  2JQD A;  4PKI G;  4B8C D;  5D3I A;  4R08 A;  4Q62 A;  4LSX A;  4BV4 R;  4R09 A;  4IM6 A;  5GQR K;  3OJA A;  1DS9 A;  1M0Z A;  3ZYN A;  5CMP A;  1GWB A;  4M7E C;  4KT1 A;  1Z7X W;  3W3M A;  4LI1 A;  3O53 A;  2OMY A; 
#chains in the Genus database with same CATH homology
 4U08 A;  1OZN A;  4Q3G A;  4QBZ A;  4I6J B;  2P1O B;  3M18 A;  4FMZ A;  4AY9 X;  4ARR A;  2V9S A;  3UN9 A;  5AWD A;  4R58 A;  5IJD A;  2WQV A;  1KOH A;  5B0N A;  3ZYJ A;  5HZL B;  4CP6 A;  2WQX A;  1FQV A;  1M9S A;  4L3A A;  2ELL A;  2V9T B;  2JE0 A;  2OMT A;  1FO1 A;  2O6Q A;  5LFN A;  3BZ5 A;  4Z61 C;  3VQ1 A;  3C6N B;  4FS7 A;  4MQW X;  4J4L A;  4NKH A;  4LXS A;  4AW4 A;  3W3J A;  4J0M A;  3G04 C;  4R0A A;  4R07 A;  4GT6 A;  1U0N D;  2RA8 A;  2Z81 A;  2Y5Q A;  3W3N A;  1WWL A;  3W3K A;  2WQU A;  4V2D A;  4G8A A;  1KOO A;  2UZX A;  3O6N A;  4KXF B;  3RGX A;  1P9A G;  2BNH A;  3DZE A;  1FS2 A;  1XEU A;  1QYY A;  1XKU A;  4V2C A;  5A5C A;  2P1M B;  4FHO A;  3E4G A;  1K5G C;  2WQW A;  1A4Y A;  3P72 A;  2Z66 A;  4RCW A;  5GMH A;  5GMF A;  3SB4 A;  1OTO A;  4FDW A;  4LSA A;  5FTT B;  5GMG A;  3OGL B;  5B4P A;  2Z82 A;  1JL5 A;  3W3G A;  4QXE A;  2WFH A;  3E2J A;  4ECO A;  3RGZ A;  3RFE A;  3OGK B;  4CC4 A;  4L3F A;  2BEX A;  3ULA A;  3KJ4 A;  3PMH G;  1D0B A;  1XCD A;  2Q4G W;  4FD0 A;  4LSC A;  4P91 A;  3CIG A;  5IJC A;  4EZG A;  4M7E A;  1M10 B;  4R6A A;  1DFJ I;  4WP6 A;  4ARN A;  1O6T A;  2XOT A;  4KNG A;  4PSJ A;  5B0T A;  2OMV A;  1M9L A;  4BSS A;  3WPC A;  3RFS A;  2JE1 A;  4U7L A;  3WPI A;  4Z64 C;  4RCA B;  2FT3 A;  4U06 A;  4R6G A;  1O6V A;  4CNM A;  2CA6 A;  3E6J A;  1ZIW A;  4PER A;  5AWB A;  1FT8 A;  4Q3I A;  2OMZ A;  4XGO A;  4R6J A;  2V70 A;  4CNC A;  4LXR A;  4BSR A;  3WPD A;  2ID5 A;  5IJB A;  1YRG A;  4LSX C;  5AZ5 A;  5AWC A;  4H09 A;  3UL8 A;  3E3Z A;  1LTX A;  2R9U A;  4C2A B;  4TZH A;  2UZY A;  3OJA B;  3G3B A;  5GS2 B;  1XEC A;  3CIY A;  3WPG A;  3WN4 A;  3ULV A;  4UFR A;  3RW6 A;  3WPH A;  3WPF A;  1A9N A;  3RFJ A;  3JB9 j;  2Z7X B;  2AST B;  2Z63 A;  3G06 A;  2A0Z A;  4Y61 B;  4P8S A;  3REZ A;  3TSR E;  3ULU A;  4HQ1 A;  2XWT C;  3G39 A;  4XOS A;  2P1N B;  3C6O B;  1H6U A;  4MN8 B;  4NKG A;  1PGV A;  1P8T A;  2Z65 A;  3G3A A;  2RR6 A;  1OOK G;  1OTM A;  4FCG A;  3WPE A;  3VQ2 A;  2Z7X A;  4RWT C;  2P1Q B;  4CIL A;  4WYK A;  1W8A A;  4ECN A;  2IFG A;  1P8V A;  1OGQ A;  3RW7 A;  1DCE A;  4R5D A;  1H6T A;  1OTN A;  4R5C A;  3RIZ A;  4LI2 A;  1XWD C;  3OGM B;  1G9U A;  4PQ8 A;  4Z94 G;  2OMX A;  5AWA A;  5CMN A;  4QC0 A;  2O6S A;  4K17 A;  3UL7 A;  4Z8G A;  1O6S A;  4OQT A;  4V2E A;  2OMU A;  3WPB A;  1SQ0 B;  4PEQ B;  3ZYO A;  4YEB B;  1K5D C;  3W3L A;  3C6P B;  4Z79 A;  5HDH A;  4BSU A;  4U09 A;  5IYX C;  2ASS B;  4C2B B;  2Z62 A;  2O6R A;  4GLP A;  5GS0 A;  4R6F A;  2P1P B;  3M19 A;  3CVR A;  4XSQ A;  3ZYI A;  3FXI A;  2Z64 A;  3GOZ A;  3A79 B;  4CC4 C;  3RJ0 A;  1IO0 A;  2OMW A;  3UL9 A;  2JQD A;  4PKI G;  4B8C D;  5D3I A;  4R08 A;  4Q62 A;  4LSX A;  4BV4 R;  4R09 A;  4IM6 A;  5GQR K;  3OJA A;  1DS9 A;  1M0Z A;  3ZYN A;  5CMP A;  1GWB A;  4M7E C;  4KT1 A;  1Z7X W;  3W3M A;  4LI1 A;  3O53 A;  2OMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...