4MQWX

Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
339
structure length
288
Chain Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNSAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRICNKDDLCVDVTCSPKPDAFNPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Glycoprotein hormones, alpha polypeptide
publication title Evidence for Follicle-stimulating Hormone Receptor as a Functional Trimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 288
sequence length 339
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01462 LRRNT Leucine rich repeat N-terminal domain
X PF12369 GnHR_trans Gonadotropin hormone receptor transmembrane region
X PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4mqwX00
4WP6A 4U06A 4BSUA 3RGXA 1K5GC 4LXRA 2BNHA 4XGOA 5B0TA 2Z66A 4AY9X 3G04C 3PMHG 3ZYOA 4ARNA 2XWTC 4ECNA 4CILA 3WN4A 4PQ8A 4ARRA 3VQ2A 1OGQA 2ASTB 3DZEA 1M9LA 3ULUA 1M9SA 4BSSA 1XECA 4FS7A 4CNMA 2OMYA 5GMHA 2Y5QA 3RIZA 4P91A 1O6VA 4PSJA 3E2JA 1H6UA 4RWTC 2OMVA 4XOSA 1YRGA 4IM6A 3W3LA 4M7EA 3A79B 3RFJA 3UL8A 4K17A 4MQWX 4R6AA 4FDWA 1M0ZA 3REZA 1QYYA 4L3AA 3OJAB 4LSCA 4ECOA 4NKGA 2P1MB 2Z7XB 3C6OB 3UN9A 2Q4GW 5LFNA 4R58A 4NKHA 4Z64C 3WPEA 3E6JA 4YEBB 5GMFA 2P1NB 4UFRA 2WFHA 1LTXA 3RGZA 2OMTA 3OGLB 4R0AA 5AWDA 2ELLA 4J4LA 4L3FA 4KXFB 2RR6A 2WQVA 4OQTA 4RCAB 2ASSB 4FHOA 5AWAA 1O6TA 5AWBA 4TZHA 3E3ZA 3ULVA 2Z64A 5CMPA 1KOHA 1W8AA 4C2BB 2OMWA 3KJ4A 4CC4C 4Y61B 4P8SA 3ZYJA 3C6NB 1P8TA 1DS9A 4PKIG 4GT6A 4R5CA 3FXIA 3SB4A 5GS2B 2WQUA 5IJDA 2RA8A 2IFGA 4LXSA 1H6TA 4R08A 1U0ND 3OGKB 1A9NA 4QBZA 3E4GA 3RFEA 4R5DA 2XOTA 3M18A 2V9TB 4BV4R 1OTNA 1FS2A 5CMNA 1M10B 3WPFA 3G39A 2Z62A 4LSXC 1O6SA 3CIYA 3RFSA 4V2DA 3OJAA 2ID5A 2P1PB 3O6NA 4HQ1A 1DFJI 2R9UA 1P8VA 3W3MA 1SQ0B 4FCGA 2V70A 4Z79A 2O6QA 4CC4A 3WPBA 3ULAA 1D0BA 4QXEA 3CIGA 3W3GA 3O53A 2JE0A 3C6PB 5IJCA 1FO1A 4Z61C 2Z65A 3G06A 2FT3A 4MN8B 5GS0A 2Z63A 4V2CA 4LI2A 2OMZA 4M7EC 1ZIWA 4CP6A 3P72A 5GMGA 1WWLA 2P1QB 4R6JA 2UZXA 2WQWA 4KNGA 3UL9A 4J0MA 3WPDA 4FD0A 1OOKG 4I6JB 3WPIA 1XKUA 5HZLB 1JL5A 1FQVA 5D3IA 4CNCA 1IO0A 1XCDA 1XWDC 4V2EA 4KT1A 3TSRE 1Z7XW 3RJ0A 4R09A 3GOZA 4RCWA 2OMUA 5GQRK 4Q3IA 1OTMA 3CVRA 5B4PA 4R6FA 3G3AA 5A5CA 1OZNA 5AWCA 3ZYIA 1G9UA 4Z8GA 3JB9j 3M19A 2BEXA 1DCEA 1PGVA 5IYXC 3UL7A 5AZ5A 4LI1A 3W3KA 3W3JA 1K5DC 4R07A 1A4YA 3WPGA 5FTTB 2O6SA 2Z7XA 1XEUA 4U09A 4FMZA 1KOOA 3OGMB 3WPHA 4Q62A 4G8AA 2JE1A 3BZ5A 4XSQA 3WPCA 1P9AG 4B8CD 3VQ1A 1OTOA 2WQXA 4LSAA 2JQDA 5IJBA 3RW7A 2O6RA 4QC0A 3G3BA 4PERA 4H09A 4U08A 2OMXA 2UZYA 5B0NA 5HDHA 4WYKA 4AW4A 4U7LA 4R6GA 4PEQB 2V9SA 2A0ZA 3ZYNA 3RW6A 4EZGA 2CA6A 4BSRA 1GWBA 2Z81A 4Z94G 4C2AB 2Z82A 1FT8A 4GLPA 2P1OB 4Q3GA 3W3NA 4LSXA
chains in the Genus database with same CATH superfamily
4WP6A 4U06A 4BSUA 3RGXA 1K5GC 4LXRA 2BNHA 4XGOA 5B0TA 2Z66A 4AY9X 3G04C 3PMHG 3ZYOA 4ARNA 2XWTC 4ECNA 4CILA 3WN4A 4PQ8A 4ARRA 3VQ2A 1OGQA 2ASTB 3DZEA 1M9LA 3ULUA 1M9SA 4BSSA 1XECA 4FS7A 4CNMA 2OMYA 5GMHA 2Y5QA 3RIZA 4P91A 1O6VA 4PSJA 3E2JA 1H6UA 4RWTC 2OMVA 4XOSA 1YRGA 4IM6A 3W3LA 4M7EA 3A79B 3RFJA 3UL8A 4K17A 4MQWX 4R6AA 4FDWA 1M0ZA 3REZA 1QYYA 4L3AA 3OJAB 4LSCA 4ECOA 4NKGA 2P1MB 2Z7XB 3C6OB 3UN9A 2Q4GW 5LFNA 4R58A 4NKHA 4Z64C 3WPEA 3E6JA 4YEBB 5GMFA 2P1NB 4UFRA 2WFHA 1LTXA 3RGZA 2OMTA 3OGLB 4R0AA 5AWDA 2ELLA 4J4LA 4L3FA 4KXFB 2RR6A 2WQVA 4OQTA 4RCAB 2ASSB 4FHOA 5AWAA 1O6TA 5AWBA 4TZHA 3E3ZA 3ULVA 2Z64A 5CMPA 1KOHA 1W8AA 4C2BB 2OMWA 3KJ4A 4CC4C 4Y61B 4P8SA 3ZYJA 3C6NB 4NZTM 1P8TA 1DS9A 4PKIG 4GT6A 4R5CA 3FXIA 3SB4A 5GS2B 2WQUA 5IJDA 2RA8A 2IFGA 4LXSA 1H6TA 4R08A 1U0ND 3OGKB 1A9NA 4QBZA 3E4GA 3RFEA 4R5DA 2XOTA 3M18A 2V9TB 4BV4R 1OTNA 1FS2A 5CMNA 1M10B 3WPFA 3G39A 2Z62A 4LSXC 1O6SA 3CIYA 3RFSA 4V2DA 3OJAA 2ID5A 2P1PB 3O6NA 4HQ1A 1DFJI 2R9UA 1P8VA 3W3MA 1SQ0B 4FCGA 2V70A 4Z79A 2O6QA 4CC4A 3WPBA 3ULAA 1D0BA 4QXEA 3CIGA 3W3GA 3O53A 2JE0A 3C6PB 5IJCA 1FO1A 4Z61C 2Z65A 3G06A 2FT3A 4MN8B 5GS0A 2Z63A 4V2CA 4LI2A 2OMZA 4M7EC 1ZIWA 4CP6A 3P72A 5GMGA 1WWLA 2P1QB 4R6JA 2UZXA 2WQWA 4KNGA 3UL9A 4J0MA 3WPDA 4FD0A 1OOKG 4I6JB 3WPIA 1XKUA 5HZLB 1JL5A 1FQVA 5D3IA 4CNCA 1IO0A 1XCDA 1XWDC 4V2EA 4KT1A 3TSRE 1Z7XW 3RJ0A 4R09A 3GOZA 4RCWA 2OMUA 5GQRK 4Q3IA 1OTMA 3CVRA 5B4PA 4R6FA 3G3AA 5A5CA 1OZNA 5AWCA 3ZYIA 1G9UA 4Z8GA 3JB9j 3M19A 2BEXA 1DCEA 1PGVA 5IYXC 3UL7A 5AZ5A 4LI1A 3W3KA 3W3JA 1K5DC 4R07A 1A4YA 3WPGA 5FTTB 2O6SA 2Z7XA 1XEUA 4U09A 4FMZA 1KOOA 3OGMB 3WPHA 4Q62A 4G8AA 2JE1A 3BZ5A 4XSQA 3WPCA 1P9AG 4B8CD 3VQ1A 1OTOA 2WQXA 4LSAA 2JQDA 5IJBA 3RW7A 2O6RA 4QC0A 3G3BA 4PERA 4H09A 4U08A 2OMXA 2UZYA 5B0NA 5HDHA 4WYKA 4AW4A 4U7LA 4R6GA 4PEQB 2V9SA 2A0ZA 3ZYNA 3RW6A 4EZGA 4NZRM 2CA6A 4BSRA 1GWBA 2Z81A 4Z94G 4C2AB 2Z82A 1FT8A 4GLPA 2P1OB 4Q3GA 3W3NA 4LSXA
chains in the Genus database with same CATH topology
4WP6A 4U06A 4BSUA 3RGXA 1K5GC 4LXRA 2BNHA 4XGOA 5B0TA 2Z66A 4AY9X 3G04C 3PMHG 3ZYOA 4ARNA 2XWTC 4ECNA 4CILA 3WN4A 4PQ8A 4ARRA 3VQ2A 1OGQA 2ASTB 3DZEA 1M9LA 3ULUA 1M9SA 4BSSA 1XECA 4FS7A 4CNMA 2OMYA 5GMHA 2Y5QA 3RIZA 4P91A 1O6VA 4PSJA 3E2JA 1H6UA 4RWTC 2OMVA 4XOSA 1YRGA 4IM6A 3W3LA 4M7EA 3A79B 3RFJA 3UL8A 4K17A 4MQWX 4R6AA 4FDWA 1M0ZA 3REZA 1QYYA 4L3AA 3OJAB 4LSCA 4ECOA 4NKGA 2P1MB 2Z7XB 3C6OB 3UN9A 2Q4GW 5LFNA 4R58A 4NKHA 4Z64C 3WPEA 3E6JA 4YEBB 5GMFA 2P1NB 4UFRA 2WFHA 1LTXA 3RGZA 2OMTA 3OGLB 4R0AA 5AWDA 2ELLA 4J4LA 4L3FA 4KXFB 2RR6A 2WQVA 4OQTA 4RCAB 2ASSB 4FHOA 5AWAA 1O6TA 5AWBA 4TZHA 3E3ZA 3ULVA 2Z64A 5CMPA 1KOHA 1W8AA 4C2BB 2OMWA 3KJ4A 4CC4C 4Y61B 4P8SA 3ZYJA 3C6NB 1P8TA 1DS9A 4PKIG 4GT6A 4R5CA 3FXIA 3SB4A 5GS2B 2WQUA 5IJDA 2RA8A 2IFGA 4LXSA 1H6TA 4R08A 1U0ND 3OGKB 1A9NA 4QBZA 3E4GA 3RFEA 4R5DA 2XOTA 3M18A 2V9TB 4BV4R 1OTNA 1FS2A 5CMNA 1M10B 3WPFA 3G39A 2Z62A 4LSXC 1O6SA 3CIYA 3RFSA 4V2DA 3OJAA 2ID5A 2P1PB 3O6NA 4HQ1A 1DFJI 2R9UA 1P8VA 3W3MA 1SQ0B 4FCGA 2V70A 4Z79A 2O6QA 4CC4A 3WPBA 3ULAA 1D0BA 4QXEA 3CIGA 3W3GA 3O53A 2JE0A 3C6PB 5IJCA 1FO1A 4Z61C 2Z65A 3G06A 2FT3A 4MN8B 5GS0A 2Z63A 4V2CA 4LI2A 2OMZA 4M7EC 1ZIWA 4CP6A 3P72A 5GMGA 1WWLA 2P1QB 4R6JA 2UZXA 2WQWA 4KNGA 3UL9A 4J0MA 3WPDA 4FD0A 1OOKG 4I6JB 3WPIA 1XKUA 5HZLB 1JL5A 1FQVA 5D3IA 4CNCA 1IO0A 1XCDA 1XWDC 4V2EA 4KT1A 3TSRE 1Z7XW 3RJ0A 4R09A 3GOZA 4RCWA 2OMUA 5GQRK 4Q3IA 1OTMA 3CVRA 5B4PA 4R6FA 3G3AA 5A5CA 1OZNA 5AWCA 3ZYIA 1G9UA 4Z8GA 3JB9j 3M19A 2BEXA 1DCEA 1PGVA 5IYXC 3UL7A 5AZ5A 4LI1A 3W3KA 3W3JA 1K5DC 4R07A 1A4YA 3WPGA 5FTTB 2O6SA 2Z7XA 1XEUA 4U09A 4FMZA 1KOOA 3OGMB 3WPHA 4Q62A 4G8AA 2JE1A 3BZ5A 4XSQA 3WPCA 1P9AG 4B8CD 3VQ1A 1OTOA 2WQXA 4LSAA 2JQDA 5IJBA 3RW7A 2O6RA 4QC0A 3G3BA 4PERA 4H09A 4U08A 2OMXA 2UZYA 5B0NA 5HDHA 4WYKA 4AW4A 4U7LA 4R6GA 4PEQB 2V9SA 2A0ZA 3ZYNA 3RW6A 4EZGA 2CA6A 4BSRA 1GWBA 2Z81A 4Z94G 4C2AB 2Z82A 1FT8A 4GLPA 2P1OB 4Q3GA 3W3NA 4LSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP6 A;  4U06 A;  4BSU A;  3RGX A;  1K5G C;  4LXR A;  2BNH A;  4XGO A;  5B0T A;  2Z66 A;  4AY9 X;  3G04 C;  3PMH G;  3ZYO A;  4ARN A;  2XWT C;  4ECN A;  4CIL A;  3WN4 A;  4PQ8 A;  4ARR A;  3VQ2 A;  1OGQ A;  2AST B;  3DZE A;  1M9L A;  3ULU A;  1M9S A;  4BSS A;  1XEC A;  4FS7 A;  4CNM A;  2OMY A;  5GMH A;  2Y5Q A;  3RIZ A;  4P91 A;  1O6V A;  4PSJ A;  3E2J A;  1H6U A;  4RWT C;  2OMV A;  4XOS A;  1YRG A;  4IM6 A;  3W3L A;  4M7E A;  3A79 B;  3RFJ A;  3UL8 A;  4K17 A;  4MQW X;  4R6A A;  4FDW A;  1M0Z A;  3REZ A;  1QYY A;  4L3A A;  3OJA B;  4LSC A;  4ECO A;  4NKG A;  2P1M B;  2Z7X B;  3C6O B;  3UN9 A;  2Q4G W;  5LFN A;  4R58 A;  4NKH A;  4Z64 C;  3WPE A;  3E6J A;  4YEB B;  5GMF A;  2P1N B;  4UFR A;  2WFH A;  1LTX A;  3RGZ A;  2OMT A;  3OGL B;  4R0A A;  5AWD A;  2ELL A;  4J4L A;  4L3F A;  4KXF B;  2RR6 A;  2WQV A;  4OQT A;  4RCA B;  2ASS B;  4FHO A;  5AWA A;  1O6T A;  5AWB A;  4TZH A;  3E3Z A;  3ULV A;  2Z64 A;  5CMP A;  1KOH A;  1W8A A;  4C2B B;  2OMW A;  3KJ4 A;  4CC4 C;  4Y61 B;  4P8S A;  3ZYJ A;  3C6N B;  1P8T A;  1DS9 A;  4PKI G;  4GT6 A;  4R5C A;  3FXI A;  3SB4 A;  5GS2 B;  2WQU A;  5IJD A;  2RA8 A;  2IFG A;  4LXS A;  1H6T A;  4R08 A;  1U0N D;  3OGK B;  1A9N A;  4QBZ A;  3E4G A;  3RFE A;  4R5D A;  2XOT A;  3M18 A;  2V9T B;  4BV4 R;  1OTN A;  1FS2 A;  5CMN A;  1M10 B;  3WPF A;  3G39 A;  2Z62 A;  4LSX C;  1O6S A;  3CIY A;  3RFS A;  4V2D A;  3OJA A;  2ID5 A;  2P1P B;  3O6N A;  4HQ1 A;  1DFJ I;  2R9U A;  1P8V A;  3W3M A;  1SQ0 B;  4FCG A;  2V70 A;  4Z79 A;  2O6Q A;  4CC4 A;  3WPB A;  3ULA A;  1D0B A;  4QXE A;  3CIG A;  3W3G A;  3O53 A;  2JE0 A;  3C6P B;  5IJC A;  1FO1 A;  4Z61 C;  2Z65 A;  3G06 A;  2FT3 A;  4MN8 B;  5GS0 A;  2Z63 A;  4V2C A;  4LI2 A;  2OMZ A;  4M7E C;  1ZIW A;  4CP6 A;  3P72 A;  5GMG A;  1WWL A;  2P1Q B;  4R6J A;  2UZX A;  2WQW A;  4KNG A;  3UL9 A;  4J0M A;  3WPD A;  4FD0 A;  1OOK G;  4I6J B;  3WPI A;  1XKU A;  5HZL B;  1JL5 A;  1FQV A;  5D3I A;  4CNC A;  1IO0 A;  1XCD A;  1XWD C;  4V2E A;  4KT1 A;  3TSR E;  1Z7X W;  3RJ0 A;  4R09 A;  3GOZ A;  4RCW A;  2OMU A;  5GQR K;  4Q3I A;  1OTM A;  3CVR A;  5B4P A;  4R6F A;  3G3A A;  5A5C A;  1OZN A;  5AWC A;  3ZYI A;  1G9U A;  4Z8G A;  3JB9 j;  3M19 A;  2BEX A;  1DCE A;  1PGV A;  5IYX C;  3UL7 A;  5AZ5 A;  4LI1 A;  3W3K A;  3W3J A;  1K5D C;  4R07 A;  1A4Y A;  3WPG A;  5FTT B;  2O6S A;  2Z7X A;  1XEU A;  4U09 A;  4FMZ A;  1KOO A;  3OGM B;  3WPH A;  4Q62 A;  4G8A A;  2JE1 A;  3BZ5 A;  4XSQ A;  3WPC A;  1P9A G;  4B8C D;  3VQ1 A;  1OTO A;  2WQX A;  4LSA A;  2JQD A;  5IJB A;  3RW7 A;  2O6R A;  4QC0 A;  3G3B A;  4PER A;  4H09 A;  4U08 A;  2OMX A;  2UZY A;  5B0N A;  5HDH A;  4WYK A;  4AW4 A;  4U7L A;  4R6G A;  4PEQ B;  2V9S A;  2A0Z A;  3ZYN A;  3RW6 A;  4EZG A;  2CA6 A;  4BSR A;  1GWB A;  2Z81 A;  4Z94 G;  4C2A B;  2Z82 A;  1FT8 A;  4GLP A;  2P1O B;  4Q3G A;  3W3N A;  4LSX A; 
#chains in the Genus database with same CATH topology
 4WP6 A;  4U06 A;  4BSU A;  3RGX A;  1K5G C;  4LXR A;  2BNH A;  4XGO A;  5B0T A;  2Z66 A;  4AY9 X;  3G04 C;  3PMH G;  3ZYO A;  4ARN A;  2XWT C;  4ECN A;  4CIL A;  3WN4 A;  4PQ8 A;  4ARR A;  3VQ2 A;  1OGQ A;  2AST B;  3DZE A;  1M9L A;  3ULU A;  1M9S A;  4BSS A;  1XEC A;  4FS7 A;  4CNM A;  2OMY A;  5GMH A;  2Y5Q A;  3RIZ A;  4P91 A;  1O6V A;  4PSJ A;  3E2J A;  1H6U A;  4RWT C;  2OMV A;  4XOS A;  1YRG A;  4IM6 A;  3W3L A;  4M7E A;  3A79 B;  3RFJ A;  3UL8 A;  4K17 A;  4MQW X;  4R6A A;  4FDW A;  1M0Z A;  3REZ A;  1QYY A;  4L3A A;  3OJA B;  4LSC A;  4ECO A;  4NKG A;  2P1M B;  2Z7X B;  3C6O B;  3UN9 A;  2Q4G W;  5LFN A;  4R58 A;  4NKH A;  4Z64 C;  3WPE A;  3E6J A;  4YEB B;  5GMF A;  2P1N B;  4UFR A;  2WFH A;  1LTX A;  3RGZ A;  2OMT A;  3OGL B;  4R0A A;  5AWD A;  2ELL A;  4J4L A;  4L3F A;  4KXF B;  2RR6 A;  2WQV A;  4OQT A;  4RCA B;  2ASS B;  4FHO A;  5AWA A;  1O6T A;  5AWB A;  4TZH A;  3E3Z A;  3ULV A;  2Z64 A;  5CMP A;  1KOH A;  1W8A A;  4C2B B;  2OMW A;  3KJ4 A;  4CC4 C;  4Y61 B;  4P8S A;  3ZYJ A;  3C6N B;  4NZT M;  1P8T A;  1DS9 A;  4PKI G;  4GT6 A;  4R5C A;  3FXI A;  3SB4 A;  5GS2 B;  2WQU A;  5IJD A;  2RA8 A;  2IFG A;  4LXS A;  1H6T A;  4R08 A;  1U0N D;  3OGK B;  1A9N A;  4QBZ A;  3E4G A;  3RFE A;  4R5D A;  2XOT A;  3M18 A;  2V9T B;  4BV4 R;  1OTN A;  1FS2 A;  5CMN A;  1M10 B;  3WPF A;  3G39 A;  2Z62 A;  4LSX C;  1O6S A;  3CIY A;  3RFS A;  4V2D A;  3OJA A;  2ID5 A;  2P1P B;  3O6N A;  4HQ1 A;  1DFJ I;  2R9U A;  1P8V A;  3W3M A;  1SQ0 B;  4FCG A;  2V70 A;  4Z79 A;  2O6Q A;  4CC4 A;  3WPB A;  3ULA A;  1D0B A;  4QXE A;  3CIG A;  3W3G A;  3O53 A;  2JE0 A;  3C6P B;  5IJC A;  1FO1 A;  4Z61 C;  2Z65 A;  3G06 A;  2FT3 A;  4MN8 B;  5GS0 A;  2Z63 A;  4V2C A;  4LI2 A;  2OMZ A;  4M7E C;  1ZIW A;  4CP6 A;  3P72 A;  5GMG A;  1WWL A;  2P1Q B;  4R6J A;  2UZX A;  2WQW A;  4KNG A;  3UL9 A;  4J0M A;  3WPD A;  4FD0 A;  1OOK G;  4I6J B;  3WPI A;  1XKU A;  5HZL B;  1JL5 A;  1FQV A;  5D3I A;  4CNC A;  1IO0 A;  1XCD A;  1XWD C;  4V2E A;  4KT1 A;  3TSR E;  1Z7X W;  3RJ0 A;  4R09 A;  3GOZ A;  4RCW A;  2OMU A;  5GQR K;  4Q3I A;  1OTM A;  3CVR A;  5B4P A;  4R6F A;  3G3A A;  5A5C A;  1OZN A;  5AWC A;  3ZYI A;  1G9U A;  4Z8G A;  3JB9 j;  3M19 A;  2BEX A;  1DCE A;  1PGV A;  5IYX C;  3UL7 A;  5AZ5 A;  4LI1 A;  3W3K A;  3W3J A;  1K5D C;  4R07 A;  1A4Y A;  3WPG A;  5FTT B;  2O6S A;  2Z7X A;  1XEU A;  4U09 A;  4FMZ A;  1KOO A;  3OGM B;  3WPH A;  4Q62 A;  4G8A A;  2JE1 A;  3BZ5 A;  4XSQ A;  3WPC A;  1P9A G;  4B8C D;  3VQ1 A;  1OTO A;  2WQX A;  4LSA A;  2JQD A;  5IJB A;  3RW7 A;  2O6R A;  4QC0 A;  3G3B A;  4PER A;  4H09 A;  4U08 A;  2OMX A;  2UZY A;  5B0N A;  5HDH A;  4WYK A;  4AW4 A;  4U7L A;  4R6G A;  4PEQ B;  2V9S A;  2A0Z A;  3ZYN A;  3RW6 A;  4EZG A;  4NZR M;  2CA6 A;  4BSR A;  1GWB A;  2Z81 A;  4Z94 G;  4C2A B;  2Z82 A;  1FT8 A;  4GLP A;  2P1O B;  4Q3G A;  3W3N A;  4LSX A; 
#chains in the Genus database with same CATH homology
 4WP6 A;  4U06 A;  4BSU A;  3RGX A;  1K5G C;  4LXR A;  2BNH A;  4XGO A;  5B0T A;  2Z66 A;  4AY9 X;  3G04 C;  3PMH G;  3ZYO A;  4ARN A;  2XWT C;  4ECN A;  4CIL A;  3WN4 A;  4PQ8 A;  4ARR A;  3VQ2 A;  1OGQ A;  2AST B;  3DZE A;  1M9L A;  3ULU A;  1M9S A;  4BSS A;  1XEC A;  4FS7 A;  4CNM A;  2OMY A;  5GMH A;  2Y5Q A;  3RIZ A;  4P91 A;  1O6V A;  4PSJ A;  3E2J A;  1H6U A;  4RWT C;  2OMV A;  4XOS A;  1YRG A;  4IM6 A;  3W3L A;  4M7E A;  3A79 B;  3RFJ A;  3UL8 A;  4K17 A;  4MQW X;  4R6A A;  4FDW A;  1M0Z A;  3REZ A;  1QYY A;  4L3A A;  3OJA B;  4LSC A;  4ECO A;  4NKG A;  2P1M B;  2Z7X B;  3C6O B;  3UN9 A;  2Q4G W;  5LFN A;  4R58 A;  4NKH A;  4Z64 C;  3WPE A;  3E6J A;  4YEB B;  5GMF A;  2P1N B;  4UFR A;  2WFH A;  1LTX A;  3RGZ A;  2OMT A;  3OGL B;  4R0A A;  5AWD A;  2ELL A;  4J4L A;  4L3F A;  4KXF B;  2RR6 A;  2WQV A;  4OQT A;  4RCA B;  2ASS B;  4FHO A;  5AWA A;  1O6T A;  5AWB A;  4TZH A;  3E3Z A;  3ULV A;  2Z64 A;  5CMP A;  1KOH A;  1W8A A;  4C2B B;  2OMW A;  3KJ4 A;  4CC4 C;  4Y61 B;  4P8S A;  3ZYJ A;  3C6N B;  1P8T A;  1DS9 A;  4PKI G;  4GT6 A;  4R5C A;  3FXI A;  3SB4 A;  5GS2 B;  2WQU A;  5IJD A;  2RA8 A;  2IFG A;  4LXS A;  1H6T A;  4R08 A;  1U0N D;  3OGK B;  1A9N A;  4QBZ A;  3E4G A;  3RFE A;  4R5D A;  2XOT A;  3M18 A;  2V9T B;  4BV4 R;  1OTN A;  1FS2 A;  5CMN A;  1M10 B;  3WPF A;  3G39 A;  2Z62 A;  4LSX C;  1O6S A;  3CIY A;  3RFS A;  4V2D A;  3OJA A;  2ID5 A;  2P1P B;  3O6N A;  4HQ1 A;  1DFJ I;  2R9U A;  1P8V A;  3W3M A;  1SQ0 B;  4FCG A;  2V70 A;  4Z79 A;  2O6Q A;  4CC4 A;  3WPB A;  3ULA A;  1D0B A;  4QXE A;  3CIG A;  3W3G A;  3O53 A;  2JE0 A;  3C6P B;  5IJC A;  1FO1 A;  4Z61 C;  2Z65 A;  3G06 A;  2FT3 A;  4MN8 B;  5GS0 A;  2Z63 A;  4V2C A;  4LI2 A;  2OMZ A;  4M7E C;  1ZIW A;  4CP6 A;  3P72 A;  5GMG A;  1WWL A;  2P1Q B;  4R6J A;  2UZX A;  2WQW A;  4KNG A;  3UL9 A;  4J0M A;  3WPD A;  4FD0 A;  1OOK G;  4I6J B;  3WPI A;  1XKU A;  5HZL B;  1JL5 A;  1FQV A;  5D3I A;  4CNC A;  1IO0 A;  1XCD A;  1XWD C;  4V2E A;  4KT1 A;  3TSR E;  1Z7X W;  3RJ0 A;  4R09 A;  3GOZ A;  4RCW A;  2OMU A;  5GQR K;  4Q3I A;  1OTM A;  3CVR A;  5B4P A;  4R6F A;  3G3A A;  5A5C A;  1OZN A;  5AWC A;  3ZYI A;  1G9U A;  4Z8G A;  3JB9 j;  3M19 A;  2BEX A;  1DCE A;  1PGV A;  5IYX C;  3UL7 A;  5AZ5 A;  4LI1 A;  3W3K A;  3W3J A;  1K5D C;  4R07 A;  1A4Y A;  3WPG A;  5FTT B;  2O6S A;  2Z7X A;  1XEU A;  4U09 A;  4FMZ A;  1KOO A;  3OGM B;  3WPH A;  4Q62 A;  4G8A A;  2JE1 A;  3BZ5 A;  4XSQ A;  3WPC A;  1P9A G;  4B8C D;  3VQ1 A;  1OTO A;  2WQX A;  4LSA A;  2JQD A;  5IJB A;  3RW7 A;  2O6R A;  4QC0 A;  3G3B A;  4PER A;  4H09 A;  4U08 A;  2OMX A;  2UZY A;  5B0N A;  5HDH A;  4WYK A;  4AW4 A;  4U7L A;  4R6G A;  4PEQ B;  2V9S A;  2A0Z A;  3ZYN A;  3RW6 A;  4EZG A;  2CA6 A;  4BSR A;  1GWB A;  2Z81 A;  4Z94 G;  4C2A B;  2Z82 A;  1FT8 A;  4GLP A;  2P1O B;  4Q3G A;  3W3N A;  4LSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...