4MQWX

Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
339
structure length
288
Chain Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNSAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRICNKDDLCVDVTCSPKPDAFNPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein hormones, alpha polypeptide
publication title Evidence for Follicle-stimulating Hormone Receptor as a Functional Trimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 86
structure length 288
sequence length 339
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01462 LRRNT Leucine rich repeat N-terminal domain
X PF12369 GnHR_trans Gonadotropin hormone receptor transmembrane region
X PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4mqwX00
4R6GA 4BSUA 4Y61B 4RCAB 2JE0A 4R0AA 4WYKA 4KT1A 4Z94G 2XOTA 3E4GA 5FTTB 2Y5QA 5CMPA 1O6TA 1K5DC 4NKGA 4PSJA 4BSSA 4G8AA 3OGMB 3W3GA 3M19A 3M18A 3SB4A 2XWTC 3RJ0A 4CNCA 5AWAA 4Z79A 3VQ1A 1XECA 1OTNA 2OMZA 4MN8B 4H09A 3DZEA 3C6NB 4KXFB 2UZXA 4XOSA 1OGQA 2ASTB 4FS7A 4BV4R 3OGLB 4LXRA 1O6SA 3G3AA 1ZIWA 5IJCA 1W8AA 4R6AA 4M7EA 4R6FA 2FT3A 2IFGA 3VQ2A 2R9UA 4GT6A 4ARNA 4L3FA 1XEUA 3W3MA 2CA6A 2O6SA 2OMUA 4NKHA 3E3ZA 3RW7A 3PMHG 4KNGA 4Q3IA 2Z66A 3ZYIA 3ZYNA 3O53A 2OMTA 1M10B 4PKIG 4LXSA 4Z8GA 4R08A 3E6JA 3WPCA 5IJBA 5GS0A 1P8TA 2O6RA 4V2CA 1LTXA 2Z63A 3G06A 4U06A 3OJAA 3BZ5A 4V2DA 4EZGA 3RGZA 2ELLA 5IJDA 4Q62A 4U09A 3RFSA 3CIGA 4C2AB 1K5GC 2JQDA 4GLPA 5HDHA 5AWBA 3WPEA 5B0NA 3UN9A 2OMXA 3G04C 1FQVA 2WQXA 5AWCA 2JE1A 1DFJI 3RFJA 4M7EC 2OMWA 1P9AG 4ARRA 4R6JA 3JB9j 4K17A 3W3NA 4AY9X 4LI2A 5IYXC 2P1OB 5AWDA 1PGVA 1XWDC 3ZYOA 4P91A 1QYYA 5GS2B 4R5DA 3OGKB 2Z65A 4BSRA 1U0ND 3WN4A 5AZ5A 4CNMA 3KJ4A 1OTOA 2A0ZA 4FD0A 5B0TA 4P8SA 3C6OB 3TSRE 2WQUA 4WP6A 5GMGA 2P1NB 3WPDA 3REZA 1OTMA 3W3LA 1A4YA 2Z7XA 4LSCA 3ULUA 3O6NA 3RW6A 4PERA 4YEBB 4FDWA 3CVRA 2BEXA 5D3IA 3W3JA 3RGXA 1OZNA 5GQRK 5GMFA 2WFHA 4Q3GA 1XKUA 4RCWA 1SQ0B 1H6TA 4CP6A 3CIYA 4L3AA 1XCDA 4V2EA 4CC4A 4XSQA 4C2BB 2ASSB 5B4PA 2Z81A 2WQWA 4PQ8A 1FO1A 3RIZA 4IM6A 2Z82A 5CMNA 2RR6A 4QXEA 1DCEA 4Z61C 1M0ZA 4AW4A 1Z7XW 1KOHA 3A79B 4QBZA 4ECOA 1FS2A 2P1QB 3UL7A 4HQ1A 4PEQB 1O6VA 2OMYA 4RWTC 4LSXA 2P1MB 2O6QA 2P1PB 4R58A 2BNHA 2Z62A 3OJAB 5HZLB 3G39A 3FXIA 1WWLA 5A5CA 1D0BA 4TZHA 3W3KA 1OOKG 5LFNA 4LI1A 2OMVA 1M9SA 4I6JB 1YRGA 4CILA 3E2JA 1M9LA 1KOOA 2V9SA 2RA8A 1A9NA 3UL9A 3C6PB 2UZYA 4LSAA 4U08A 3P72A 1DS9A 1IO0A 3WPIA 2ID5A 4R09A 3ZYJA 2WQVA 4CC4C 4FCGA 4J0MA 1GWBA 3GOZA 1FT8A 2Z64A 3WPFA 4FMZA 2V70A 3G3BA 2Q4GW 3ULVA 4B8CD 1H6UA 3WPHA 1P8VA 3UL8A 3WPGA 4LSXC 2V9TB 3ULAA 4Z64C 4R5CA 1JL5A 4J4LA 4MQWX 2Z7XB 3RFEA 4ECNA 5GMHA 4XGOA 4R07A 4QC0A 4U7LA 4UFRA 4FHOA 1G9UA 3WPBA 4OQTA
chains in the Genus database with same CATH superfamily
4R6GA 4BSUA 4Y61B 4RCAB 2JE0A 4R0AA 4WYKA 4KT1A 4Z94G 2XOTA 3E4GA 4NZRM 2Y5QA 5FTTB 5CMPA 1O6TA 1K5DC 4NKGA 4PSJA 4BSSA 4G8AA 3OGMB 3W3GA 4NZTM 3M19A 3M18A 3SB4A 2XWTC 3RJ0A 4CNCA 5AWAA 4Z79A 3VQ1A 1XECA 1OTNA 2OMZA 4MN8B 4H09A 3DZEA 3C6NB 4KXFB 2UZXA 4XOSA 1OGQA 2ASTB 4FS7A 4BV4R 3OGLB 4LXRA 1O6SA 3G3AA 1ZIWA 5IJCA 1W8AA 4R6AA 4M7EA 4R6FA 2FT3A 2IFGA 3VQ2A 2R9UA 4GT6A 4ARNA 4L3FA 1XEUA 3W3MA 2CA6A 2O6SA 2OMUA 4NKHA 3E3ZA 3RW7A 3PMHG 4KNGA 4Q3IA 2Z66A 3ZYIA 3ZYNA 3O53A 2OMTA 1M10B 4PKIG 4LXSA 4Z8GA 4R08A 3E6JA 3WPCA 5IJBA 5GS0A 1P8TA 2O6RA 4V2CA 1LTXA 2Z63A 3G06A 4U06A 3OJAA 3BZ5A 4V2DA 4EZGA 3RGZA 2ELLA 5IJDA 4Q62A 4U09A 3RFSA 3CIGA 4C2AB 1K5GC 2JQDA 4GLPA 5HDHA 5AWBA 3WPEA 5B0NA 3UN9A 2OMXA 3G04C 1FQVA 2WQXA 5AWCA 2JE1A 1DFJI 3RFJA 4M7EC 2OMWA 1P9AG 4ARRA 4R6JA 3JB9j 4K17A 3W3NA 4AY9X 4LI2A 5IYXC 2P1OB 5AWDA 1PGVA 1XWDC 3ZYOA 4P91A 1QYYA 5GS2B 4R5DA 3OGKB 2Z65A 4BSRA 1U0ND 3WN4A 5AZ5A 4CNMA 3KJ4A 1OTOA 2A0ZA 4FD0A 5B0TA 4P8SA 3C6OB 3TSRE 2WQUA 4WP6A 5GMGA 2P1NB 3WPDA 3REZA 1OTMA 3W3LA 1A4YA 2Z7XA 4LSCA 3ULUA 3O6NA 3RW6A 4PERA 4YEBB 4FDWA 3CVRA 2BEXA 5D3IA 3W3JA 3RGXA 1OZNA 5GQRK 5GMFA 2WFHA 4Q3GA 1XKUA 4RCWA 1SQ0B 1H6TA 4CP6A 3CIYA 4L3AA 1XCDA 4V2EA 4CC4A 4XSQA 4C2BB 2ASSB 5B4PA 2Z81A 2WQWA 4PQ8A 1FO1A 3RIZA 4IM6A 2Z82A 5CMNA 2RR6A 4QXEA 1DCEA 4Z61C 1M0ZA 4AW4A 1Z7XW 1KOHA 3A79B 4QBZA 4ECOA 1FS2A 2P1QB 3UL7A 4HQ1A 4PEQB 1O6VA 2OMYA 4RWTC 4LSXA 2P1MB 2O6QA 2P1PB 4R58A 2BNHA 2Z62A 3OJAB 5HZLB 3G39A 3FXIA 1WWLA 5A5CA 1D0BA 4TZHA 3W3KA 1OOKG 5LFNA 4LI1A 2OMVA 1M9SA 4I6JB 1YRGA 4CILA 3E2JA 1M9LA 1KOOA 2V9SA 2RA8A 1A9NA 3UL9A 3C6PB 2UZYA 4LSAA 4U08A 3P72A 1DS9A 1IO0A 3WPIA 2ID5A 4R09A 3ZYJA 2WQVA 4CC4C 4FCGA 4J0MA 1GWBA 3GOZA 1FT8A 2Z64A 3WPFA 4FMZA 2V70A 3G3BA 2Q4GW 3ULVA 4B8CD 1H6UA 3WPHA 1P8VA 3UL8A 3WPGA 4LSXC 2V9TB 3ULAA 4Z64C 4R5CA 1JL5A 4J4LA 4MQWX 2Z7XB 3RFEA 4ECNA 5GMHA 4XGOA 4R07A 4QC0A 4U7LA 4UFRA 4FHOA 1G9UA 3WPBA 4OQTA
chains in the Genus database with same CATH topology
4R6GA 4BSUA 4Y61B 4RCAB 2JE0A 4R0AA 4WYKA 4KT1A 4Z94G 2XOTA 3E4GA 5FTTB 2Y5QA 5CMPA 1O6TA 1K5DC 4NKGA 4PSJA 4BSSA 4G8AA 3OGMB 3W3GA 3M19A 3M18A 3SB4A 2XWTC 3RJ0A 4CNCA 5AWAA 4Z79A 3VQ1A 1XECA 1OTNA 2OMZA 4MN8B 4H09A 3DZEA 3C6NB 4KXFB 2UZXA 4XOSA 1OGQA 2ASTB 4FS7A 4BV4R 3OGLB 4LXRA 1O6SA 3G3AA 1ZIWA 5IJCA 1W8AA 4R6AA 4M7EA 4R6FA 2FT3A 2IFGA 3VQ2A 2R9UA 4GT6A 4ARNA 4L3FA 1XEUA 3W3MA 2CA6A 2O6SA 2OMUA 4NKHA 3E3ZA 3RW7A 3PMHG 4KNGA 4Q3IA 2Z66A 3ZYIA 3ZYNA 3O53A 2OMTA 1M10B 4PKIG 4LXSA 4Z8GA 4R08A 3E6JA 3WPCA 5IJBA 5GS0A 1P8TA 2O6RA 4V2CA 1LTXA 2Z63A 3G06A 4U06A 3OJAA 3BZ5A 4V2DA 4EZGA 3RGZA 2ELLA 5IJDA 4Q62A 4U09A 3RFSA 3CIGA 4C2AB 1K5GC 2JQDA 4GLPA 5HDHA 5AWBA 3WPEA 5B0NA 3UN9A 2OMXA 3G04C 1FQVA 2WQXA 5AWCA 2JE1A 1DFJI 3RFJA 4M7EC 2OMWA 1P9AG 4ARRA 4R6JA 3JB9j 4K17A 3W3NA 4AY9X 4LI2A 5IYXC 2P1OB 5AWDA 1PGVA 1XWDC 3ZYOA 4P91A 1QYYA 5GS2B 4R5DA 3OGKB 2Z65A 4BSRA 1U0ND 3WN4A 5AZ5A 4CNMA 3KJ4A 1OTOA 2A0ZA 4FD0A 5B0TA 4P8SA 3C6OB 3TSRE 2WQUA 4WP6A 5GMGA 2P1NB 3WPDA 3REZA 1OTMA 3W3LA 1A4YA 2Z7XA 4LSCA 3ULUA 3O6NA 3RW6A 4PERA 4YEBB 4FDWA 3CVRA 2BEXA 5D3IA 3W3JA 3RGXA 1OZNA 5GQRK 5GMFA 2WFHA 4Q3GA 1XKUA 4RCWA 1SQ0B 1H6TA 4CP6A 3CIYA 4L3AA 1XCDA 4V2EA 4CC4A 4XSQA 4C2BB 2ASSB 5B4PA 2Z81A 2WQWA 4PQ8A 1FO1A 3RIZA 4IM6A 2Z82A 5CMNA 2RR6A 4QXEA 1DCEA 4Z61C 1M0ZA 4AW4A 1Z7XW 1KOHA 3A79B 4QBZA 4ECOA 1FS2A 2P1QB 3UL7A 4HQ1A 4PEQB 1O6VA 2OMYA 4RWTC 4LSXA 2P1MB 2O6QA 2P1PB 4R58A 2BNHA 2Z62A 3OJAB 5HZLB 3G39A 3FXIA 1WWLA 5A5CA 1D0BA 4TZHA 3W3KA 1OOKG 5LFNA 4LI1A 2OMVA 1M9SA 4I6JB 1YRGA 4CILA 3E2JA 1M9LA 1KOOA 2V9SA 2RA8A 1A9NA 3UL9A 3C6PB 2UZYA 4LSAA 4U08A 3P72A 1DS9A 1IO0A 3WPIA 2ID5A 4R09A 3ZYJA 2WQVA 4CC4C 4FCGA 4J0MA 1GWBA 3GOZA 1FT8A 2Z64A 3WPFA 4FMZA 2V70A 3G3BA 2Q4GW 3ULVA 4B8CD 1H6UA 3WPHA 1P8VA 3UL8A 3WPGA 4LSXC 2V9TB 3ULAA 4Z64C 4R5CA 1JL5A 4J4LA 4MQWX 2Z7XB 3RFEA 4ECNA 5GMHA 4XGOA 4R07A 4QC0A 4U7LA 4UFRA 4FHOA 1G9UA 3WPBA 4OQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6G A;  4BSU A;  4Y61 B;  4RCA B;  2JE0 A;  4R0A A;  4WYK A;  4KT1 A;  4Z94 G;  2XOT A;  3E4G A;  5FTT B;  2Y5Q A;  5CMP A;  1O6T A;  1K5D C;  4NKG A;  4PSJ A;  4BSS A;  4G8A A;  3OGM B;  3W3G A;  3M19 A;  3M18 A;  3SB4 A;  2XWT C;  3RJ0 A;  4CNC A;  5AWA A;  4Z79 A;  3VQ1 A;  1XEC A;  1OTN A;  2OMZ A;  4MN8 B;  4H09 A;  3DZE A;  3C6N B;  4KXF B;  2UZX A;  4XOS A;  1OGQ A;  2AST B;  4FS7 A;  4BV4 R;  3OGL B;  4LXR A;  1O6S A;  3G3A A;  1ZIW A;  5IJC A;  1W8A A;  4R6A A;  4M7E A;  4R6F A;  2FT3 A;  2IFG A;  3VQ2 A;  2R9U A;  4GT6 A;  4ARN A;  4L3F A;  1XEU A;  3W3M A;  2CA6 A;  2O6S A;  2OMU A;  4NKH A;  3E3Z A;  3RW7 A;  3PMH G;  4KNG A;  4Q3I A;  2Z66 A;  3ZYI A;  3ZYN A;  3O53 A;  2OMT A;  1M10 B;  4PKI G;  4LXS A;  4Z8G A;  4R08 A;  3E6J A;  3WPC A;  5IJB A;  5GS0 A;  1P8T A;  2O6R A;  4V2C A;  1LTX A;  2Z63 A;  3G06 A;  4U06 A;  3OJA A;  3BZ5 A;  4V2D A;  4EZG A;  3RGZ A;  2ELL A;  5IJD A;  4Q62 A;  4U09 A;  3RFS A;  3CIG A;  4C2A B;  1K5G C;  2JQD A;  4GLP A;  5HDH A;  5AWB A;  3WPE A;  5B0N A;  3UN9 A;  2OMX A;  3G04 C;  1FQV A;  2WQX A;  5AWC A;  2JE1 A;  1DFJ I;  3RFJ A;  4M7E C;  2OMW A;  1P9A G;  4ARR A;  4R6J A;  3JB9 j;  4K17 A;  3W3N A;  4AY9 X;  4LI2 A;  5IYX C;  2P1O B;  5AWD A;  1PGV A;  1XWD C;  3ZYO A;  4P91 A;  1QYY A;  5GS2 B;  4R5D A;  3OGK B;  2Z65 A;  4BSR A;  1U0N D;  3WN4 A;  5AZ5 A;  4CNM A;  3KJ4 A;  1OTO A;  2A0Z A;  4FD0 A;  5B0T A;  4P8S A;  3C6O B;  3TSR E;  2WQU A;  4WP6 A;  5GMG A;  2P1N B;  3WPD A;  3REZ A;  1OTM A;  3W3L A;  1A4Y A;  2Z7X A;  4LSC A;  3ULU A;  3O6N A;  3RW6 A;  4PER A;  4YEB B;  4FDW A;  3CVR A;  2BEX A;  5D3I A;  3W3J A;  3RGX A;  1OZN A;  5GQR K;  5GMF A;  2WFH A;  4Q3G A;  1XKU A;  4RCW A;  1SQ0 B;  1H6T A;  4CP6 A;  3CIY A;  4L3A A;  1XCD A;  4V2E A;  4CC4 A;  4XSQ A;  4C2B B;  2ASS B;  5B4P A;  2Z81 A;  2WQW A;  4PQ8 A;  1FO1 A;  3RIZ A;  4IM6 A;  2Z82 A;  5CMN A;  2RR6 A;  4QXE A;  1DCE A;  4Z61 C;  1M0Z A;  4AW4 A;  1Z7X W;  1KOH A;  3A79 B;  4QBZ A;  4ECO A;  1FS2 A;  2P1Q B;  3UL7 A;  4HQ1 A;  4PEQ B;  1O6V A;  2OMY A;  4RWT C;  4LSX A;  2P1M B;  2O6Q A;  2P1P B;  4R58 A;  2BNH A;  2Z62 A;  3OJA B;  5HZL B;  3G39 A;  3FXI A;  1WWL A;  5A5C A;  1D0B A;  4TZH A;  3W3K A;  1OOK G;  5LFN A;  4LI1 A;  2OMV A;  1M9S A;  4I6J B;  1YRG A;  4CIL A;  3E2J A;  1M9L A;  1KOO A;  2V9S A;  2RA8 A;  1A9N A;  3UL9 A;  3C6P B;  2UZY A;  4LSA A;  4U08 A;  3P72 A;  1DS9 A;  1IO0 A;  3WPI A;  2ID5 A;  4R09 A;  3ZYJ A;  2WQV A;  4CC4 C;  4FCG A;  4J0M A;  1GWB A;  3GOZ A;  1FT8 A;  2Z64 A;  3WPF A;  4FMZ A;  2V70 A;  3G3B A;  2Q4G W;  3ULV A;  4B8C D;  1H6U A;  3WPH A;  1P8V A;  3UL8 A;  3WPG A;  4LSX C;  2V9T B;  3ULA A;  4Z64 C;  4R5C A;  1JL5 A;  4J4L A;  4MQW X;  2Z7X B;  3RFE A;  4ECN A;  5GMH A;  4XGO A;  4R07 A;  4QC0 A;  4U7L A;  4UFR A;  4FHO A;  1G9U A;  3WPB A;  4OQT A; 
#chains in the Genus database with same CATH topology
 4R6G A;  4BSU A;  4Y61 B;  4RCA B;  2JE0 A;  4R0A A;  4WYK A;  4KT1 A;  4Z94 G;  2XOT A;  3E4G A;  4NZR M;  2Y5Q A;  5FTT B;  5CMP A;  1O6T A;  1K5D C;  4NKG A;  4PSJ A;  4BSS A;  4G8A A;  3OGM B;  3W3G A;  4NZT M;  3M19 A;  3M18 A;  3SB4 A;  2XWT C;  3RJ0 A;  4CNC A;  5AWA A;  4Z79 A;  3VQ1 A;  1XEC A;  1OTN A;  2OMZ A;  4MN8 B;  4H09 A;  3DZE A;  3C6N B;  4KXF B;  2UZX A;  4XOS A;  1OGQ A;  2AST B;  4FS7 A;  4BV4 R;  3OGL B;  4LXR A;  1O6S A;  3G3A A;  1ZIW A;  5IJC A;  1W8A A;  4R6A A;  4M7E A;  4R6F A;  2FT3 A;  2IFG A;  3VQ2 A;  2R9U A;  4GT6 A;  4ARN A;  4L3F A;  1XEU A;  3W3M A;  2CA6 A;  2O6S A;  2OMU A;  4NKH A;  3E3Z A;  3RW7 A;  3PMH G;  4KNG A;  4Q3I A;  2Z66 A;  3ZYI A;  3ZYN A;  3O53 A;  2OMT A;  1M10 B;  4PKI G;  4LXS A;  4Z8G A;  4R08 A;  3E6J A;  3WPC A;  5IJB A;  5GS0 A;  1P8T A;  2O6R A;  4V2C A;  1LTX A;  2Z63 A;  3G06 A;  4U06 A;  3OJA A;  3BZ5 A;  4V2D A;  4EZG A;  3RGZ A;  2ELL A;  5IJD A;  4Q62 A;  4U09 A;  3RFS A;  3CIG A;  4C2A B;  1K5G C;  2JQD A;  4GLP A;  5HDH A;  5AWB A;  3WPE A;  5B0N A;  3UN9 A;  2OMX A;  3G04 C;  1FQV A;  2WQX A;  5AWC A;  2JE1 A;  1DFJ I;  3RFJ A;  4M7E C;  2OMW A;  1P9A G;  4ARR A;  4R6J A;  3JB9 j;  4K17 A;  3W3N A;  4AY9 X;  4LI2 A;  5IYX C;  2P1O B;  5AWD A;  1PGV A;  1XWD C;  3ZYO A;  4P91 A;  1QYY A;  5GS2 B;  4R5D A;  3OGK B;  2Z65 A;  4BSR A;  1U0N D;  3WN4 A;  5AZ5 A;  4CNM A;  3KJ4 A;  1OTO A;  2A0Z A;  4FD0 A;  5B0T A;  4P8S A;  3C6O B;  3TSR E;  2WQU A;  4WP6 A;  5GMG A;  2P1N B;  3WPD A;  3REZ A;  1OTM A;  3W3L A;  1A4Y A;  2Z7X A;  4LSC A;  3ULU A;  3O6N A;  3RW6 A;  4PER A;  4YEB B;  4FDW A;  3CVR A;  2BEX A;  5D3I A;  3W3J A;  3RGX A;  1OZN A;  5GQR K;  5GMF A;  2WFH A;  4Q3G A;  1XKU A;  4RCW A;  1SQ0 B;  1H6T A;  4CP6 A;  3CIY A;  4L3A A;  1XCD A;  4V2E A;  4CC4 A;  4XSQ A;  4C2B B;  2ASS B;  5B4P A;  2Z81 A;  2WQW A;  4PQ8 A;  1FO1 A;  3RIZ A;  4IM6 A;  2Z82 A;  5CMN A;  2RR6 A;  4QXE A;  1DCE A;  4Z61 C;  1M0Z A;  4AW4 A;  1Z7X W;  1KOH A;  3A79 B;  4QBZ A;  4ECO A;  1FS2 A;  2P1Q B;  3UL7 A;  4HQ1 A;  4PEQ B;  1O6V A;  2OMY A;  4RWT C;  4LSX A;  2P1M B;  2O6Q A;  2P1P B;  4R58 A;  2BNH A;  2Z62 A;  3OJA B;  5HZL B;  3G39 A;  3FXI A;  1WWL A;  5A5C A;  1D0B A;  4TZH A;  3W3K A;  1OOK G;  5LFN A;  4LI1 A;  2OMV A;  1M9S A;  4I6J B;  1YRG A;  4CIL A;  3E2J A;  1M9L A;  1KOO A;  2V9S A;  2RA8 A;  1A9N A;  3UL9 A;  3C6P B;  2UZY A;  4LSA A;  4U08 A;  3P72 A;  1DS9 A;  1IO0 A;  3WPI A;  2ID5 A;  4R09 A;  3ZYJ A;  2WQV A;  4CC4 C;  4FCG A;  4J0M A;  1GWB A;  3GOZ A;  1FT8 A;  2Z64 A;  3WPF A;  4FMZ A;  2V70 A;  3G3B A;  2Q4G W;  3ULV A;  4B8C D;  1H6U A;  3WPH A;  1P8V A;  3UL8 A;  3WPG A;  4LSX C;  2V9T B;  3ULA A;  4Z64 C;  4R5C A;  1JL5 A;  4J4L A;  4MQW X;  2Z7X B;  3RFE A;  4ECN A;  5GMH A;  4XGO A;  4R07 A;  4QC0 A;  4U7L A;  4UFR A;  4FHO A;  1G9U A;  3WPB A;  4OQT A; 
#chains in the Genus database with same CATH homology
 4R6G A;  4BSU A;  4Y61 B;  4RCA B;  2JE0 A;  4R0A A;  4WYK A;  4KT1 A;  4Z94 G;  2XOT A;  3E4G A;  5FTT B;  2Y5Q A;  5CMP A;  1O6T A;  1K5D C;  4NKG A;  4PSJ A;  4BSS A;  4G8A A;  3OGM B;  3W3G A;  3M19 A;  3M18 A;  3SB4 A;  2XWT C;  3RJ0 A;  4CNC A;  5AWA A;  4Z79 A;  3VQ1 A;  1XEC A;  1OTN A;  2OMZ A;  4MN8 B;  4H09 A;  3DZE A;  3C6N B;  4KXF B;  2UZX A;  4XOS A;  1OGQ A;  2AST B;  4FS7 A;  4BV4 R;  3OGL B;  4LXR A;  1O6S A;  3G3A A;  1ZIW A;  5IJC A;  1W8A A;  4R6A A;  4M7E A;  4R6F A;  2FT3 A;  2IFG A;  3VQ2 A;  2R9U A;  4GT6 A;  4ARN A;  4L3F A;  1XEU A;  3W3M A;  2CA6 A;  2O6S A;  2OMU A;  4NKH A;  3E3Z A;  3RW7 A;  3PMH G;  4KNG A;  4Q3I A;  2Z66 A;  3ZYI A;  3ZYN A;  3O53 A;  2OMT A;  1M10 B;  4PKI G;  4LXS A;  4Z8G A;  4R08 A;  3E6J A;  3WPC A;  5IJB A;  5GS0 A;  1P8T A;  2O6R A;  4V2C A;  1LTX A;  2Z63 A;  3G06 A;  4U06 A;  3OJA A;  3BZ5 A;  4V2D A;  4EZG A;  3RGZ A;  2ELL A;  5IJD A;  4Q62 A;  4U09 A;  3RFS A;  3CIG A;  4C2A B;  1K5G C;  2JQD A;  4GLP A;  5HDH A;  5AWB A;  3WPE A;  5B0N A;  3UN9 A;  2OMX A;  3G04 C;  1FQV A;  2WQX A;  5AWC A;  2JE1 A;  1DFJ I;  3RFJ A;  4M7E C;  2OMW A;  1P9A G;  4ARR A;  4R6J A;  3JB9 j;  4K17 A;  3W3N A;  4AY9 X;  4LI2 A;  5IYX C;  2P1O B;  5AWD A;  1PGV A;  1XWD C;  3ZYO A;  4P91 A;  1QYY A;  5GS2 B;  4R5D A;  3OGK B;  2Z65 A;  4BSR A;  1U0N D;  3WN4 A;  5AZ5 A;  4CNM A;  3KJ4 A;  1OTO A;  2A0Z A;  4FD0 A;  5B0T A;  4P8S A;  3C6O B;  3TSR E;  2WQU A;  4WP6 A;  5GMG A;  2P1N B;  3WPD A;  3REZ A;  1OTM A;  3W3L A;  1A4Y A;  2Z7X A;  4LSC A;  3ULU A;  3O6N A;  3RW6 A;  4PER A;  4YEB B;  4FDW A;  3CVR A;  2BEX A;  5D3I A;  3W3J A;  3RGX A;  1OZN A;  5GQR K;  5GMF A;  2WFH A;  4Q3G A;  1XKU A;  4RCW A;  1SQ0 B;  1H6T A;  4CP6 A;  3CIY A;  4L3A A;  1XCD A;  4V2E A;  4CC4 A;  4XSQ A;  4C2B B;  2ASS B;  5B4P A;  2Z81 A;  2WQW A;  4PQ8 A;  1FO1 A;  3RIZ A;  4IM6 A;  2Z82 A;  5CMN A;  2RR6 A;  4QXE A;  1DCE A;  4Z61 C;  1M0Z A;  4AW4 A;  1Z7X W;  1KOH A;  3A79 B;  4QBZ A;  4ECO A;  1FS2 A;  2P1Q B;  3UL7 A;  4HQ1 A;  4PEQ B;  1O6V A;  2OMY A;  4RWT C;  4LSX A;  2P1M B;  2O6Q A;  2P1P B;  4R58 A;  2BNH A;  2Z62 A;  3OJA B;  5HZL B;  3G39 A;  3FXI A;  1WWL A;  5A5C A;  1D0B A;  4TZH A;  3W3K A;  1OOK G;  5LFN A;  4LI1 A;  2OMV A;  1M9S A;  4I6J B;  1YRG A;  4CIL A;  3E2J A;  1M9L A;  1KOO A;  2V9S A;  2RA8 A;  1A9N A;  3UL9 A;  3C6P B;  2UZY A;  4LSA A;  4U08 A;  3P72 A;  1DS9 A;  1IO0 A;  3WPI A;  2ID5 A;  4R09 A;  3ZYJ A;  2WQV A;  4CC4 C;  4FCG A;  4J0M A;  1GWB A;  3GOZ A;  1FT8 A;  2Z64 A;  3WPF A;  4FMZ A;  2V70 A;  3G3B A;  2Q4G W;  3ULV A;  4B8C D;  1H6U A;  3WPH A;  1P8V A;  3UL8 A;  3WPG A;  4LSX C;  2V9T B;  3ULA A;  4Z64 C;  4R5C A;  1JL5 A;  4J4L A;  4MQW X;  2Z7X B;  3RFE A;  4ECN A;  5GMH A;  4XGO A;  4R07 A;  4QC0 A;  4U7L A;  4UFR A;  4FHO A;  1G9U A;  3WPB A;  4OQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...