5CMPA

Human flrt3 lrr domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
324
structure length
324
Chain Sequence
KSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Leucine-rich repeat transmembrane protein FLRT3
publication title Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 324
sequence length 324
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5cmpA00
3ZYNA 2O6QA 1OZNA 2V9TB 3G06A 2WFHA 4AY9X 2JE0A 4QBZA 1G9UA 1H6TA 4R6JA 4R6GA 4C2AB 4ECNA 4GT6A 2Z64A 3RFEA 1M0ZA 3A79B 4KNGA 2Z66A 1XKUA 5IYXC 4LSXC 4BSUA 1OTOA 2OMZA 3C6NB 4OQTA 3VQ1A 5GMGA 4Z79A 2O6SA 5B0TA 2RA8A 4V2CA 3ZYOA 5AWCA 3E3ZA 2WQVA 1QYYA 5LFNA 3UL9A 1PGVA 3PMHG 1YRGA 1XCDA 3RIZA 3TSRE 3WPGA 4FS7A 3G3BA 4LSAA 3UN9A 4XGOA 2OMXA 1GWBA 2P1QB 3W3GA 1DS9A 3DZEA 4BSSA 3RFSA 3VQ2A 4FCGA 4XOSA 5HDHA 4LI2A 3WPDA 3ZYJA 5GS0A 4R09A 5GS2B 1A4YA 5A5CA 2O6RA 1O6SA 4FDWA 1FQVA 4U06A 4PERA 4H09A 4FMZA 2V9SA 1OTNA 1K5GC 3W3KA 2XWTC 3E6JA 2Z63A 1M10B 3O6NA 3W3MA 2BEXA 3OJAB 3ULAA 4MQWX 4R5CA 4K17A 4R08A 3WPEA 4U7LA 4AW4A 4R6AA 3W3JA 4Q62A 2ELLA 2OMUA 2Z62A 3OJAA 4U08A 4CILA 4CNMA 2V70A 3JB9j 3WPIA 4WP6A 1P8VA 5GQRK 4L3FA 1M9LA 3WPBA 4J0MA 4V2EA 4BV4R 2XOTA 2Z7XB 1JL5A 4M7EA 4MN8B 1M9SA 3ULUA 4TZHA 3CVRA 4CC4C 4R6FA 3FXIA 5IJDA 2R9UA 2WQWA 4FHOA 2Z7XA 4EZGA 5D3IA 3ZYIA 2UZYA 5FTTB 4LXSA 4P91A 2P1PB 1WWLA 4RWTC 4RCAB 5IJBA 3W3NA 2Z81A 4ARRA 4IM6A 3KJ4A 2OMWA 4CNCA 1SQ0B 1H6UA 4BSRA 1LTXA 3O53A 3CIYA 3WPFA 1U0ND 3RGXA 3ULVA 1Z7XW 2Z82A 2JQDA 3RGZA 4P8SA 4R5DA 2Z65A 3UL8A 4LSXA 3P72A 3G3AA 3G39A 4PSJA 4QXEA 3OGMB 3OGLB 2Q4GW 2OMYA 5AZ5A 3E2JA 4KT1A 4LXRA 2ID5A 2WQUA 4V2DA 4ECOA 5CMNA 5HZLB 4Y61B 1OGQA 4PKIG 3C6PB 3GOZA 4Z61C 5AWBA 4PEQB 4CC4A 1DFJI 3E4GA 4CP6A 1KOOA 4G8AA 4I6JB 4Q3IA 1KOHA 5GMFA 1P9AG 3SB4A 4NKHA 4NKGA 2ASTB 5GMHA 4R58A 3RFJA 3G04C 2A0ZA 5CMPA 2BNHA 1OTMA 2UZXA 5IJCA 1XEUA 4Z64C 3RJ0A 2ASSB 3CIGA 5AWDA 1ZIWA 2OMTA 2RR6A 3RW6A 4QC0A 1FS2A 4XSQA 1O6VA 3W3LA 1A9NA 1FO1A 4WYKA 2FT3A 4UFRA 3UL7A 3C6OB 4FD0A 4J4LA 2WQXA 4YEBB 1XECA 2OMVA 4C2BB 4LSCA 3WPCA 3WN4A 4R07A 4GLPA 4ARNA 1W8AA 1D0BA 2CA6A 5AWAA 3OGKB 3REZA 2Y5QA 2P1OB 4Z94G 1XWDC 4Z8GA 1P8TA 4B8CD 3BZ5A 4Q3GA 2IFGA 4PQ8A 4LI1A 1O6TA 1DCEA 4KXFB 4R0AA 4M7EC 2JE1A 4L3AA 3M18A 1OOKG 3M19A 4U09A 2P1MB 5B4PA 1K5DC 1FT8A 3WPHA 5B0NA 4RCWA 3RW7A 1IO0A 4HQ1A 2P1NB
chains in the Genus database with same CATH superfamily
3ZYNA 2O6QA 1OZNA 2V9TB 3G06A 2WFHA 4AY9X 2JE0A 4QBZA 1G9UA 1H6TA 4R6JA 4R6GA 4C2AB 4ECNA 4GT6A 2Z64A 3RFEA 1M0ZA 3A79B 4KNGA 2Z66A 1XKUA 5IYXC 4LSXC 4BSUA 1OTOA 2OMZA 3C6NB 4OQTA 3VQ1A 5GMGA 4Z79A 2O6SA 5B0TA 2RA8A 4V2CA 3ZYOA 5AWCA 3E3ZA 2WQVA 1QYYA 5LFNA 3UL9A 1PGVA 3PMHG 1YRGA 1XCDA 3RIZA 3TSRE 3WPGA 4FS7A 3G3BA 4LSAA 3UN9A 4XGOA 2OMXA 1GWBA 4NZRM 2P1QB 3W3GA 1DS9A 3DZEA 4BSSA 3RFSA 3VQ2A 4FCGA 4XOSA 5HDHA 4LI2A 3WPDA 3ZYJA 5GS0A 4R09A 5GS2B 1A4YA 5A5CA 2O6RA 1O6SA 4FDWA 1FQVA 4U06A 4PERA 4H09A 4FMZA 2V9SA 1OTNA 1K5GC 3W3KA 2XWTC 3E6JA 2Z63A 1M10B 3O6NA 3W3MA 2BEXA 3OJAB 3ULAA 4MQWX 4R5CA 4K17A 4R08A 3WPEA 4U7LA 4AW4A 4R6AA 3W3JA 4Q62A 2ELLA 2OMUA 2Z62A 3OJAA 4U08A 4CILA 4CNMA 2V70A 3JB9j 3WPIA 4WP6A 1P8VA 5GQRK 4L3FA 1M9LA 3WPBA 4J0MA 4V2EA 4BV4R 2XOTA 2Z7XB 1JL5A 4M7EA 4MN8B 1M9SA 3ULUA 4TZHA 3CVRA 4CC4C 4R6FA 3FXIA 5IJDA 2R9UA 2WQWA 4FHOA 2Z7XA 4EZGA 5D3IA 3ZYIA 2UZYA 5FTTB 4LXSA 4P91A 2P1PB 1WWLA 4RWTC 4RCAB 5IJBA 3W3NA 2Z81A 4ARRA 4IM6A 3KJ4A 2OMWA 4CNCA 1SQ0B 1H6UA 4BSRA 1LTXA 3O53A 3CIYA 3WPFA 1U0ND 3RGXA 3ULVA 1Z7XW 2Z82A 2JQDA 3RGZA 4P8SA 4R5DA 2Z65A 3UL8A 4LSXA 3P72A 3G3AA 3G39A 4PSJA 4QXEA 3OGMB 3OGLB 2Q4GW 2OMYA 5AZ5A 3E2JA 4KT1A 4LXRA 2ID5A 2WQUA 4V2DA 4ECOA 5CMNA 5HZLB 4Y61B 1OGQA 4PKIG 3C6PB 3GOZA 4Z61C 5AWBA 4PEQB 4CC4A 1DFJI 3E4GA 4CP6A 1KOOA 4G8AA 4I6JB 4Q3IA 1KOHA 5GMFA 1P9AG 3SB4A 4NKHA 4NKGA 2ASTB 5GMHA 4R58A 3RFJA 3G04C 2A0ZA 5CMPA 2BNHA 1OTMA 2UZXA 5IJCA 1XEUA 4Z64C 3RJ0A 2ASSB 3CIGA 5AWDA 1ZIWA 2OMTA 2RR6A 3RW6A 4QC0A 1FS2A 4XSQA 1O6VA 3W3LA 1A9NA 1FO1A 4WYKA 2FT3A 4UFRA 4NZTM 3UL7A 3C6OB 4FD0A 4J4LA 2WQXA 4YEBB 1XECA 2OMVA 4C2BB 4LSCA 3WPCA 3WN4A 4R07A 4GLPA 4ARNA 1W8AA 1D0BA 2CA6A 5AWAA 3OGKB 3REZA 2Y5QA 2P1OB 4Z94G 1XWDC 4Z8GA 1P8TA 4B8CD 3BZ5A 4Q3GA 2IFGA 4PQ8A 4LI1A 1O6TA 1DCEA 4KXFB 4R0AA 4M7EC 2JE1A 4L3AA 3M18A 1OOKG 3M19A 4U09A 2P1MB 5B4PA 1K5DC 1FT8A 3WPHA 5B0NA 4RCWA 3RW7A 1IO0A 4HQ1A 2P1NB
chains in the Genus database with same CATH topology
3ZYNA 2O6QA 1OZNA 2V9TB 3G06A 2WFHA 4AY9X 2JE0A 4QBZA 1G9UA 1H6TA 4R6JA 4R6GA 4C2AB 4ECNA 4GT6A 2Z64A 3RFEA 1M0ZA 3A79B 4KNGA 2Z66A 1XKUA 5IYXC 4LSXC 4BSUA 1OTOA 2OMZA 3C6NB 4OQTA 3VQ1A 5GMGA 4Z79A 2O6SA 5B0TA 2RA8A 4V2CA 3ZYOA 5AWCA 3E3ZA 2WQVA 1QYYA 5LFNA 3UL9A 1PGVA 3PMHG 1YRGA 1XCDA 3RIZA 3TSRE 3WPGA 4FS7A 3G3BA 4LSAA 3UN9A 4XGOA 2OMXA 1GWBA 2P1QB 3W3GA 1DS9A 3DZEA 4BSSA 3RFSA 3VQ2A 4FCGA 4XOSA 5HDHA 4LI2A 3WPDA 3ZYJA 5GS0A 4R09A 5GS2B 1A4YA 5A5CA 2O6RA 1O6SA 4FDWA 1FQVA 4U06A 4PERA 4H09A 4FMZA 2V9SA 1OTNA 1K5GC 3W3KA 2XWTC 3E6JA 2Z63A 1M10B 3O6NA 3W3MA 2BEXA 3OJAB 3ULAA 4MQWX 4R5CA 4K17A 4R08A 3WPEA 4U7LA 4AW4A 4R6AA 3W3JA 4Q62A 2ELLA 2OMUA 2Z62A 3OJAA 4U08A 4CILA 4CNMA 2V70A 3JB9j 3WPIA 4WP6A 1P8VA 5GQRK 4L3FA 1M9LA 3WPBA 4J0MA 4V2EA 4BV4R 2XOTA 2Z7XB 1JL5A 4M7EA 4MN8B 1M9SA 3ULUA 4TZHA 3CVRA 4CC4C 4R6FA 3FXIA 5IJDA 2R9UA 2WQWA 4FHOA 2Z7XA 4EZGA 5D3IA 3ZYIA 2UZYA 5FTTB 4LXSA 4P91A 2P1PB 1WWLA 4RWTC 4RCAB 5IJBA 3W3NA 2Z81A 4ARRA 4IM6A 3KJ4A 2OMWA 4CNCA 1SQ0B 1H6UA 4BSRA 1LTXA 3O53A 3CIYA 3WPFA 1U0ND 3RGXA 3ULVA 1Z7XW 2Z82A 2JQDA 3RGZA 4P8SA 4R5DA 2Z65A 3UL8A 4LSXA 3P72A 3G3AA 3G39A 4PSJA 4QXEA 3OGMB 3OGLB 2Q4GW 2OMYA 5AZ5A 3E2JA 4KT1A 4LXRA 2ID5A 2WQUA 4V2DA 4ECOA 5CMNA 5HZLB 4Y61B 1OGQA 4PKIG 3C6PB 3GOZA 4Z61C 5AWBA 4PEQB 4CC4A 1DFJI 3E4GA 4CP6A 1KOOA 4G8AA 4I6JB 4Q3IA 1KOHA 5GMFA 1P9AG 3SB4A 4NKHA 4NKGA 2ASTB 5GMHA 4R58A 3RFJA 3G04C 2A0ZA 5CMPA 2BNHA 1OTMA 2UZXA 5IJCA 1XEUA 4Z64C 3RJ0A 2ASSB 3CIGA 5AWDA 1ZIWA 2OMTA 2RR6A 3RW6A 4QC0A 1FS2A 4XSQA 1O6VA 3W3LA 1A9NA 1FO1A 4WYKA 2FT3A 4UFRA 3UL7A 3C6OB 4FD0A 4J4LA 2WQXA 4YEBB 1XECA 2OMVA 4C2BB 4LSCA 3WPCA 3WN4A 4R07A 4GLPA 4ARNA 1W8AA 1D0BA 2CA6A 5AWAA 3OGKB 3REZA 2Y5QA 2P1OB 4Z94G 1XWDC 4Z8GA 1P8TA 4B8CD 3BZ5A 4Q3GA 2IFGA 4PQ8A 4LI1A 1O6TA 1DCEA 4KXFB 4R0AA 4M7EC 2JE1A 4L3AA 3M18A 1OOKG 3M19A 4U09A 2P1MB 5B4PA 1K5DC 1FT8A 3WPHA 5B0NA 4RCWA 3RW7A 1IO0A 4HQ1A 2P1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYN A;  2O6Q A;  1OZN A;  2V9T B;  3G06 A;  2WFH A;  4AY9 X;  2JE0 A;  4QBZ A;  1G9U A;  1H6T A;  4R6J A;  4R6G A;  4C2A B;  4ECN A;  4GT6 A;  2Z64 A;  3RFE A;  1M0Z A;  3A79 B;  4KNG A;  2Z66 A;  1XKU A;  5IYX C;  4LSX C;  4BSU A;  1OTO A;  2OMZ A;  3C6N B;  4OQT A;  3VQ1 A;  5GMG A;  4Z79 A;  2O6S A;  5B0T A;  2RA8 A;  4V2C A;  3ZYO A;  5AWC A;  3E3Z A;  2WQV A;  1QYY A;  5LFN A;  3UL9 A;  1PGV A;  3PMH G;  1YRG A;  1XCD A;  3RIZ A;  3TSR E;  3WPG A;  4FS7 A;  3G3B A;  4LSA A;  3UN9 A;  4XGO A;  2OMX A;  1GWB A;  2P1Q B;  3W3G A;  1DS9 A;  3DZE A;  4BSS A;  3RFS A;  3VQ2 A;  4FCG A;  4XOS A;  5HDH A;  4LI2 A;  3WPD A;  3ZYJ A;  5GS0 A;  4R09 A;  5GS2 B;  1A4Y A;  5A5C A;  2O6R A;  1O6S A;  4FDW A;  1FQV A;  4U06 A;  4PER A;  4H09 A;  4FMZ A;  2V9S A;  1OTN A;  1K5G C;  3W3K A;  2XWT C;  3E6J A;  2Z63 A;  1M10 B;  3O6N A;  3W3M A;  2BEX A;  3OJA B;  3ULA A;  4MQW X;  4R5C A;  4K17 A;  4R08 A;  3WPE A;  4U7L A;  4AW4 A;  4R6A A;  3W3J A;  4Q62 A;  2ELL A;  2OMU A;  2Z62 A;  3OJA A;  4U08 A;  4CIL A;  4CNM A;  2V70 A;  3JB9 j;  3WPI A;  4WP6 A;  1P8V A;  5GQR K;  4L3F A;  1M9L A;  3WPB A;  4J0M A;  4V2E A;  4BV4 R;  2XOT A;  2Z7X B;  1JL5 A;  4M7E A;  4MN8 B;  1M9S A;  3ULU A;  4TZH A;  3CVR A;  4CC4 C;  4R6F A;  3FXI A;  5IJD A;  2R9U A;  2WQW A;  4FHO A;  2Z7X A;  4EZG A;  5D3I A;  3ZYI A;  2UZY A;  5FTT B;  4LXS A;  4P91 A;  2P1P B;  1WWL A;  4RWT C;  4RCA B;  5IJB A;  3W3N A;  2Z81 A;  4ARR A;  4IM6 A;  3KJ4 A;  2OMW A;  4CNC A;  1SQ0 B;  1H6U A;  4BSR A;  1LTX A;  3O53 A;  3CIY A;  3WPF A;  1U0N D;  3RGX A;  3ULV A;  1Z7X W;  2Z82 A;  2JQD A;  3RGZ A;  4P8S A;  4R5D A;  2Z65 A;  3UL8 A;  4LSX A;  3P72 A;  3G3A A;  3G39 A;  4PSJ A;  4QXE A;  3OGM B;  3OGL B;  2Q4G W;  2OMY A;  5AZ5 A;  3E2J A;  4KT1 A;  4LXR A;  2ID5 A;  2WQU A;  4V2D A;  4ECO A;  5CMN A;  5HZL B;  4Y61 B;  1OGQ A;  4PKI G;  3C6P B;  3GOZ A;  4Z61 C;  5AWB A;  4PEQ B;  4CC4 A;  1DFJ I;  3E4G A;  4CP6 A;  1KOO A;  4G8A A;  4I6J B;  4Q3I A;  1KOH A;  5GMF A;  1P9A G;  3SB4 A;  4NKH A;  4NKG A;  2AST B;  5GMH A;  4R58 A;  3RFJ A;  3G04 C;  2A0Z A;  5CMP A;  2BNH A;  1OTM A;  2UZX A;  5IJC A;  1XEU A;  4Z64 C;  3RJ0 A;  2ASS B;  3CIG A;  5AWD A;  1ZIW A;  2OMT A;  2RR6 A;  3RW6 A;  4QC0 A;  1FS2 A;  4XSQ A;  1O6V A;  3W3L A;  1A9N A;  1FO1 A;  4WYK A;  2FT3 A;  4UFR A;  3UL7 A;  3C6O B;  4FD0 A;  4J4L A;  2WQX A;  4YEB B;  1XEC A;  2OMV A;  4C2B B;  4LSC A;  3WPC A;  3WN4 A;  4R07 A;  4GLP A;  4ARN A;  1W8A A;  1D0B A;  2CA6 A;  5AWA A;  3OGK B;  3REZ A;  2Y5Q A;  2P1O B;  4Z94 G;  1XWD C;  4Z8G A;  1P8T A;  4B8C D;  3BZ5 A;  4Q3G A;  2IFG A;  4PQ8 A;  4LI1 A;  1O6T A;  1DCE A;  4KXF B;  4R0A A;  4M7E C;  2JE1 A;  4L3A A;  3M18 A;  1OOK G;  3M19 A;  4U09 A;  2P1M B;  5B4P A;  1K5D C;  1FT8 A;  3WPH A;  5B0N A;  4RCW A;  3RW7 A;  1IO0 A;  4HQ1 A;  2P1N B; 
#chains in the Genus database with same CATH topology
 3ZYN A;  2O6Q A;  1OZN A;  2V9T B;  3G06 A;  2WFH A;  4AY9 X;  2JE0 A;  4QBZ A;  1G9U A;  1H6T A;  4R6J A;  4R6G A;  4C2A B;  4ECN A;  4GT6 A;  2Z64 A;  3RFE A;  1M0Z A;  3A79 B;  4KNG A;  2Z66 A;  1XKU A;  5IYX C;  4LSX C;  4BSU A;  1OTO A;  2OMZ A;  3C6N B;  4OQT A;  3VQ1 A;  5GMG A;  4Z79 A;  2O6S A;  5B0T A;  2RA8 A;  4V2C A;  3ZYO A;  5AWC A;  3E3Z A;  2WQV A;  1QYY A;  5LFN A;  3UL9 A;  1PGV A;  3PMH G;  1YRG A;  1XCD A;  3RIZ A;  3TSR E;  3WPG A;  4FS7 A;  3G3B A;  4LSA A;  3UN9 A;  4XGO A;  2OMX A;  1GWB A;  4NZR M;  2P1Q B;  3W3G A;  1DS9 A;  3DZE A;  4BSS A;  3RFS A;  3VQ2 A;  4FCG A;  4XOS A;  5HDH A;  4LI2 A;  3WPD A;  3ZYJ A;  5GS0 A;  4R09 A;  5GS2 B;  1A4Y A;  5A5C A;  2O6R A;  1O6S A;  4FDW A;  1FQV A;  4U06 A;  4PER A;  4H09 A;  4FMZ A;  2V9S A;  1OTN A;  1K5G C;  3W3K A;  2XWT C;  3E6J A;  2Z63 A;  1M10 B;  3O6N A;  3W3M A;  2BEX A;  3OJA B;  3ULA A;  4MQW X;  4R5C A;  4K17 A;  4R08 A;  3WPE A;  4U7L A;  4AW4 A;  4R6A A;  3W3J A;  4Q62 A;  2ELL A;  2OMU A;  2Z62 A;  3OJA A;  4U08 A;  4CIL A;  4CNM A;  2V70 A;  3JB9 j;  3WPI A;  4WP6 A;  1P8V A;  5GQR K;  4L3F A;  1M9L A;  3WPB A;  4J0M A;  4V2E A;  4BV4 R;  2XOT A;  2Z7X B;  1JL5 A;  4M7E A;  4MN8 B;  1M9S A;  3ULU A;  4TZH A;  3CVR A;  4CC4 C;  4R6F A;  3FXI A;  5IJD A;  2R9U A;  2WQW A;  4FHO A;  2Z7X A;  4EZG A;  5D3I A;  3ZYI A;  2UZY A;  5FTT B;  4LXS A;  4P91 A;  2P1P B;  1WWL A;  4RWT C;  4RCA B;  5IJB A;  3W3N A;  2Z81 A;  4ARR A;  4IM6 A;  3KJ4 A;  2OMW A;  4CNC A;  1SQ0 B;  1H6U A;  4BSR A;  1LTX A;  3O53 A;  3CIY A;  3WPF A;  1U0N D;  3RGX A;  3ULV A;  1Z7X W;  2Z82 A;  2JQD A;  3RGZ A;  4P8S A;  4R5D A;  2Z65 A;  3UL8 A;  4LSX A;  3P72 A;  3G3A A;  3G39 A;  4PSJ A;  4QXE A;  3OGM B;  3OGL B;  2Q4G W;  2OMY A;  5AZ5 A;  3E2J A;  4KT1 A;  4LXR A;  2ID5 A;  2WQU A;  4V2D A;  4ECO A;  5CMN A;  5HZL B;  4Y61 B;  1OGQ A;  4PKI G;  3C6P B;  3GOZ A;  4Z61 C;  5AWB A;  4PEQ B;  4CC4 A;  1DFJ I;  3E4G A;  4CP6 A;  1KOO A;  4G8A A;  4I6J B;  4Q3I A;  1KOH A;  5GMF A;  1P9A G;  3SB4 A;  4NKH A;  4NKG A;  2AST B;  5GMH A;  4R58 A;  3RFJ A;  3G04 C;  2A0Z A;  5CMP A;  2BNH A;  1OTM A;  2UZX A;  5IJC A;  1XEU A;  4Z64 C;  3RJ0 A;  2ASS B;  3CIG A;  5AWD A;  1ZIW A;  2OMT A;  2RR6 A;  3RW6 A;  4QC0 A;  1FS2 A;  4XSQ A;  1O6V A;  3W3L A;  1A9N A;  1FO1 A;  4WYK A;  2FT3 A;  4UFR A;  4NZT M;  3UL7 A;  3C6O B;  4FD0 A;  4J4L A;  2WQX A;  4YEB B;  1XEC A;  2OMV A;  4C2B B;  4LSC A;  3WPC A;  3WN4 A;  4R07 A;  4GLP A;  4ARN A;  1W8A A;  1D0B A;  2CA6 A;  5AWA A;  3OGK B;  3REZ A;  2Y5Q A;  2P1O B;  4Z94 G;  1XWD C;  4Z8G A;  1P8T A;  4B8C D;  3BZ5 A;  4Q3G A;  2IFG A;  4PQ8 A;  4LI1 A;  1O6T A;  1DCE A;  4KXF B;  4R0A A;  4M7E C;  2JE1 A;  4L3A A;  3M18 A;  1OOK G;  3M19 A;  4U09 A;  2P1M B;  5B4P A;  1K5D C;  1FT8 A;  3WPH A;  5B0N A;  4RCW A;  3RW7 A;  1IO0 A;  4HQ1 A;  2P1N B; 
#chains in the Genus database with same CATH homology
 3ZYN A;  2O6Q A;  1OZN A;  2V9T B;  3G06 A;  2WFH A;  4AY9 X;  2JE0 A;  4QBZ A;  1G9U A;  1H6T A;  4R6J A;  4R6G A;  4C2A B;  4ECN A;  4GT6 A;  2Z64 A;  3RFE A;  1M0Z A;  3A79 B;  4KNG A;  2Z66 A;  1XKU A;  5IYX C;  4LSX C;  4BSU A;  1OTO A;  2OMZ A;  3C6N B;  4OQT A;  3VQ1 A;  5GMG A;  4Z79 A;  2O6S A;  5B0T A;  2RA8 A;  4V2C A;  3ZYO A;  5AWC A;  3E3Z A;  2WQV A;  1QYY A;  5LFN A;  3UL9 A;  1PGV A;  3PMH G;  1YRG A;  1XCD A;  3RIZ A;  3TSR E;  3WPG A;  4FS7 A;  3G3B A;  4LSA A;  3UN9 A;  4XGO A;  2OMX A;  1GWB A;  2P1Q B;  3W3G A;  1DS9 A;  3DZE A;  4BSS A;  3RFS A;  3VQ2 A;  4FCG A;  4XOS A;  5HDH A;  4LI2 A;  3WPD A;  3ZYJ A;  5GS0 A;  4R09 A;  5GS2 B;  1A4Y A;  5A5C A;  2O6R A;  1O6S A;  4FDW A;  1FQV A;  4U06 A;  4PER A;  4H09 A;  4FMZ A;  2V9S A;  1OTN A;  1K5G C;  3W3K A;  2XWT C;  3E6J A;  2Z63 A;  1M10 B;  3O6N A;  3W3M A;  2BEX A;  3OJA B;  3ULA A;  4MQW X;  4R5C A;  4K17 A;  4R08 A;  3WPE A;  4U7L A;  4AW4 A;  4R6A A;  3W3J A;  4Q62 A;  2ELL A;  2OMU A;  2Z62 A;  3OJA A;  4U08 A;  4CIL A;  4CNM A;  2V70 A;  3JB9 j;  3WPI A;  4WP6 A;  1P8V A;  5GQR K;  4L3F A;  1M9L A;  3WPB A;  4J0M A;  4V2E A;  4BV4 R;  2XOT A;  2Z7X B;  1JL5 A;  4M7E A;  4MN8 B;  1M9S A;  3ULU A;  4TZH A;  3CVR A;  4CC4 C;  4R6F A;  3FXI A;  5IJD A;  2R9U A;  2WQW A;  4FHO A;  2Z7X A;  4EZG A;  5D3I A;  3ZYI A;  2UZY A;  5FTT B;  4LXS A;  4P91 A;  2P1P B;  1WWL A;  4RWT C;  4RCA B;  5IJB A;  3W3N A;  2Z81 A;  4ARR A;  4IM6 A;  3KJ4 A;  2OMW A;  4CNC A;  1SQ0 B;  1H6U A;  4BSR A;  1LTX A;  3O53 A;  3CIY A;  3WPF A;  1U0N D;  3RGX A;  3ULV A;  1Z7X W;  2Z82 A;  2JQD A;  3RGZ A;  4P8S A;  4R5D A;  2Z65 A;  3UL8 A;  4LSX A;  3P72 A;  3G3A A;  3G39 A;  4PSJ A;  4QXE A;  3OGM B;  3OGL B;  2Q4G W;  2OMY A;  5AZ5 A;  3E2J A;  4KT1 A;  4LXR A;  2ID5 A;  2WQU A;  4V2D A;  4ECO A;  5CMN A;  5HZL B;  4Y61 B;  1OGQ A;  4PKI G;  3C6P B;  3GOZ A;  4Z61 C;  5AWB A;  4PEQ B;  4CC4 A;  1DFJ I;  3E4G A;  4CP6 A;  1KOO A;  4G8A A;  4I6J B;  4Q3I A;  1KOH A;  5GMF A;  1P9A G;  3SB4 A;  4NKH A;  4NKG A;  2AST B;  5GMH A;  4R58 A;  3RFJ A;  3G04 C;  2A0Z A;  5CMP A;  2BNH A;  1OTM A;  2UZX A;  5IJC A;  1XEU A;  4Z64 C;  3RJ0 A;  2ASS B;  3CIG A;  5AWD A;  1ZIW A;  2OMT A;  2RR6 A;  3RW6 A;  4QC0 A;  1FS2 A;  4XSQ A;  1O6V A;  3W3L A;  1A9N A;  1FO1 A;  4WYK A;  2FT3 A;  4UFR A;  3UL7 A;  3C6O B;  4FD0 A;  4J4L A;  2WQX A;  4YEB B;  1XEC A;  2OMV A;  4C2B B;  4LSC A;  3WPC A;  3WN4 A;  4R07 A;  4GLP A;  4ARN A;  1W8A A;  1D0B A;  2CA6 A;  5AWA A;  3OGK B;  3REZ A;  2Y5Q A;  2P1O B;  4Z94 G;  1XWD C;  4Z8G A;  1P8T A;  4B8C D;  3BZ5 A;  4Q3G A;  2IFG A;  4PQ8 A;  4LI1 A;  1O6T A;  1DCE A;  4KXF B;  4R0A A;  4M7E C;  2JE1 A;  4L3A A;  3M18 A;  1OOK G;  3M19 A;  4U09 A;  2P1M B;  5B4P A;  1K5D C;  1FT8 A;  3WPH A;  5B0N A;  4RCW A;  3RW7 A;  1IO0 A;  4HQ1 A;  2P1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...