4BV4R

Structure and allostery in toll-spatzle recognition
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
440
structure length
440
Chain Sequence
b'SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN SPAETZLE C-106
publication title Cytokine Spatzle Binds to the Drosophila Immunoreceptor Toll with a Neurotrophin-Like Specificity and Couples Receptor Activation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Immune system
total genus 142
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4bv4R00
1O6SA 4BV4R 4QXEA 3RJ0A 4PERA 1XWDC 5GMHA 2JE1A 1O6VA 4XOSA 3E2JA 4Z94G 3WPHA 4CILA 1KOHA 4L3AA 2ID5A 2A0ZA 4XSQA 3ZYNA 2OMZA 1FQVA 2WQWA 3C6NB 4CNCA 4G8AA 3E6JA 5B4PA 3VQ1A 1Z7XW 2Z62A 1JL5A 2Z7XB 4R58A 1PGVA 3OGKB 4RWTC 2RR6A 4U7LA 1DFJI 1SQ0B 4LI1A 4J0MA 1XKUA 1A4YA 5GMGA 4Q62A 3WPGA 4LI2A 3FXIA 2O6RA 4B8CD 4M7EC 4HQ1A 5AWBA 4R6JA 2OMTA 2OMUA 1H6TA 2Z81A 4LSCA 3W3LA 4MN8B 4FD0A 1P9AG 2UZYA 4H09A 4Y61B 3WN4A 3E3ZA 1K5DC 2OMYA 1OTMA 4V2EA 3CIGA 1LTXA 4Q3IA 2BNHA 2O6SA 1U0ND 4U08A 3P72A 4CC4C 2Z7XA 3ULVA 4EZGA 3WPIA 3C6PB 5FTTB 4R07A 5GMFA 4Z61C 4GT6A 3ZYIA 4LSAA 3RW6A 2ASTB 3G04C 1M0ZA 3RW7A 4V2DA 4R0AA 5HZLB 4KT1A 4ARRA 4C2BB 3WPEA 3OGMB 3GOZA 1OOKG 3A79B 1K5GC 4KNGA 2P1PB 3CVRA 4PQ8A 1XEUA 3PMHG 1WWLA 3RFJA 3JB9j 4YEBB 1D0BA 5CMNA 4P91A 4LSXC 5GQRK 1A9NA 4Z8GA 4PKIG 3UL8A 4FHOA 4WYKA 3W3MA 4QBZA 3SB4A 1QYYA 3UL9A 2Z66A 1ZIWA 2Y5QA 4M7EA 4FCGA 2RA8A 2ASSB 5IJBA 4P8SA 3ULUA 2OMXA 4GLPA 3BZ5A 4OQTA 4QC0A 1XECA 1KOOA 4WP6A 3WPBA 4MQWX 3W3NA 4U09A 3OGLB 4Q3GA 5B0NA 3O6NA 3G39A 4NKGA 2CA6A 3G06A 1H6UA 1IO0A 2V9TB 3UN9A 2JE0A 3UL7A 3G3AA 2P1OB 5IJCA 4CC4A 1P8VA 5GS2B 5LFNA 2Z65A 4FDWA 2Z64A 5AWAA 4Z79A 5IJDA 2Z63A 1OTNA 2XWTC 3C6OB 2R9UA 1W8AA 1OGQA 3CIYA 4BSUA 2WFHA 3ULAA 3OJAB 4R5DA 5A5CA 5D3IA 4R6GA 5B0TA 3W3KA 5CMPA 4TZHA 3RGZA 2FT3A 4LXSA 1DCEA 4AY9X 1OZNA 2ELLA 4UFRA 1M10B 4R5CA 4RCAB 4IM6A 4K17A 4CNMA 1P8TA 1G9UA 3WPFA 4C2AB 4L3FA 1M9LA 4ARNA 3DZEA 3W3GA 4KXFB 2O6QA 4V2CA 2WQVA 3E4GA 1FO1A 4LSXA 4PEQB 5AWCA 5AZ5A 4XGOA 1M9SA 2WQXA 3OJAA 4R09A 4ECNA 2P1QB 3W3JA 3KJ4A 1GWBA 4Z64C 3TSRE 3RFEA 2P1MB 4RCWA 1OTOA 4FS7A 4R6AA 1FS2A 4CP6A 2OMVA 2V70A 4BSRA 2XOTA 2UZXA 4AW4A 4NKHA 2Q4GW 3M18A 3WPDA 3G3BA 4J4LA 4U06A 3RFSA 4PSJA 4R08A 3ZYOA 1O6TA 3WPCA 2BEXA 5AWDA 2Z82A 2OMWA 1XCDA 2JQDA 1YRGA 4R6FA 2IFGA 3RIZA 2P1NB 5HDHA 3REZA 4FMZA 5IYXC 3M19A 5GS0A 4ECOA 4BSSA 4LXRA 1DS9A 3ZYJA 1FT8A 3RGXA 3O53A 2WQUA 3VQ2A 4I6JB 2V9SA
chains in the Genus database with same CATH superfamily
1O6SA 4BV4R 4QXEA 3RJ0A 4PERA 1XWDC 5GMHA 2JE1A 1O6VA 4XOSA 3E2JA 4Z94G 3WPHA 4CILA 1KOHA 4L3AA 2ID5A 2A0ZA 4XSQA 3ZYNA 2OMZA 1FQVA 2WQWA 3C6NB 4CNCA 4G8AA 3E6JA 5B4PA 3VQ1A 1Z7XW 2Z62A 1JL5A 2Z7XB 4R58A 1PGVA 3OGKB 4RWTC 2RR6A 4U7LA 1DFJI 1SQ0B 4LI1A 4J0MA 1XKUA 1A4YA 5GMGA 4Q62A 3WPGA 4LI2A 3FXIA 2O6RA 4B8CD 4M7EC 4HQ1A 5AWBA 4R6JA 2OMTA 2OMUA 1H6TA 2Z81A 4LSCA 3W3LA 4MN8B 4FD0A 1P9AG 2UZYA 4H09A 4Y61B 3WN4A 3E3ZA 1K5DC 2OMYA 1OTMA 4V2EA 3CIGA 1LTXA 4Q3IA 2BNHA 2O6SA 1U0ND 4U08A 3P72A 4CC4C 2Z7XA 3ULVA 4EZGA 3WPIA 3C6PB 5FTTB 4R07A 5GMFA 4Z61C 4GT6A 3ZYIA 4LSAA 3RW6A 2ASTB 3G04C 1M0ZA 3RW7A 4V2DA 4R0AA 5HZLB 4KT1A 4ARRA 4C2BB 3WPEA 3OGMB 3GOZA 1OOKG 3A79B 1K5GC 4KNGA 2P1PB 3CVRA 4PQ8A 1XEUA 3PMHG 1WWLA 3RFJA 3JB9j 4YEBB 1D0BA 5CMNA 4P91A 4LSXC 5GQRK 1A9NA 4Z8GA 4PKIG 3UL8A 4FHOA 4WYKA 3W3MA 4QBZA 3SB4A 1QYYA 3UL9A 2Z66A 1ZIWA 2Y5QA 4M7EA 4FCGA 2RA8A 2ASSB 5IJBA 4P8SA 3ULUA 2OMXA 4GLPA 3BZ5A 4OQTA 4QC0A 1XECA 1KOOA 4WP6A 3WPBA 4MQWX 3W3NA 4U09A 3OGLB 4Q3GA 5B0NA 3O6NA 3G39A 4NKGA 2CA6A 3G06A 1H6UA 1IO0A 2V9TB 3UN9A 2JE0A 3UL7A 3G3AA 4NZRM 2P1OB 5IJCA 4CC4A 1P8VA 5GS2B 5LFNA 2Z65A 4FDWA 2Z64A 5AWAA 4Z79A 5IJDA 2Z63A 1OTNA 2XWTC 3C6OB 2R9UA 1W8AA 1OGQA 3CIYA 4BSUA 2WFHA 3ULAA 3OJAB 4R5DA 5A5CA 5D3IA 4R6GA 5B0TA 3W3KA 5CMPA 4TZHA 3RGZA 2FT3A 4LXSA 1DCEA 4AY9X 1OZNA 2ELLA 4UFRA 1M10B 4R5CA 4RCAB 4IM6A 4K17A 4CNMA 1P8TA 1G9UA 3WPFA 4C2AB 4L3FA 1M9LA 4ARNA 3DZEA 3W3GA 4KXFB 2O6QA 4V2CA 2WQVA 3E4GA 1FO1A 4LSXA 4PEQB 5AWCA 5AZ5A 4XGOA 1M9SA 2WQXA 3OJAA 4R09A 4ECNA 2P1QB 3W3JA 3KJ4A 1GWBA 4Z64C 3TSRE 3RFEA 2P1MB 4RCWA 1OTOA 4FS7A 4R6AA 1FS2A 4CP6A 2OMVA 2V70A 4BSRA 2XOTA 2UZXA 4AW4A 4NKHA 2Q4GW 3M18A 3WPDA 3G3BA 4J4LA 4U06A 3RFSA 4PSJA 4R08A 3ZYOA 1O6TA 3WPCA 2BEXA 4NZTM 5AWDA 2Z82A 2OMWA 1XCDA 2JQDA 1YRGA 4R6FA 2IFGA 3RIZA 2P1NB 5HDHA 3REZA 4FMZA 5IYXC 3M19A 5GS0A 4ECOA 4BSSA 4LXRA 1DS9A 3ZYJA 1FT8A 3RGXA 3O53A 2WQUA 3VQ2A 4I6JB 2V9SA
chains in the Genus database with same CATH topology
1O6SA 4BV4R 4QXEA 3RJ0A 4PERA 1XWDC 5GMHA 2JE1A 1O6VA 4XOSA 3E2JA 4Z94G 3WPHA 4CILA 1KOHA 4L3AA 2ID5A 2A0ZA 4XSQA 3ZYNA 2OMZA 1FQVA 2WQWA 3C6NB 4CNCA 4G8AA 3E6JA 5B4PA 3VQ1A 1Z7XW 2Z62A 1JL5A 2Z7XB 4R58A 1PGVA 3OGKB 4RWTC 2RR6A 4U7LA 1DFJI 1SQ0B 4LI1A 4J0MA 1XKUA 1A4YA 5GMGA 4Q62A 3WPGA 4LI2A 3FXIA 2O6RA 4B8CD 4M7EC 4HQ1A 5AWBA 4R6JA 2OMTA 2OMUA 1H6TA 2Z81A 4LSCA 3W3LA 4MN8B 4FD0A 1P9AG 2UZYA 4H09A 4Y61B 3WN4A 3E3ZA 1K5DC 2OMYA 1OTMA 4V2EA 3CIGA 1LTXA 4Q3IA 2BNHA 2O6SA 1U0ND 4U08A 3P72A 4CC4C 2Z7XA 3ULVA 4EZGA 3WPIA 3C6PB 5FTTB 4R07A 5GMFA 4Z61C 4GT6A 3ZYIA 4LSAA 3RW6A 2ASTB 3G04C 1M0ZA 3RW7A 4V2DA 4R0AA 5HZLB 4KT1A 4ARRA 4C2BB 3WPEA 3OGMB 3GOZA 1OOKG 3A79B 1K5GC 4KNGA 2P1PB 3CVRA 4PQ8A 1XEUA 3PMHG 1WWLA 3RFJA 3JB9j 4YEBB 1D0BA 5CMNA 4P91A 4LSXC 5GQRK 1A9NA 4Z8GA 4PKIG 3UL8A 4FHOA 4WYKA 3W3MA 4QBZA 3SB4A 1QYYA 3UL9A 2Z66A 1ZIWA 2Y5QA 4M7EA 4FCGA 2RA8A 2ASSB 5IJBA 4P8SA 3ULUA 2OMXA 4GLPA 3BZ5A 4OQTA 4QC0A 1XECA 1KOOA 4WP6A 3WPBA 4MQWX 3W3NA 4U09A 3OGLB 4Q3GA 5B0NA 3O6NA 3G39A 4NKGA 2CA6A 3G06A 1H6UA 1IO0A 2V9TB 3UN9A 2JE0A 3UL7A 3G3AA 2P1OB 5IJCA 4CC4A 1P8VA 5GS2B 5LFNA 2Z65A 4FDWA 2Z64A 5AWAA 4Z79A 5IJDA 2Z63A 1OTNA 2XWTC 3C6OB 2R9UA 1W8AA 1OGQA 3CIYA 4BSUA 2WFHA 3ULAA 3OJAB 4R5DA 5A5CA 5D3IA 4R6GA 5B0TA 3W3KA 5CMPA 4TZHA 3RGZA 2FT3A 4LXSA 1DCEA 4AY9X 1OZNA 2ELLA 4UFRA 1M10B 4R5CA 4RCAB 4IM6A 4K17A 4CNMA 1P8TA 1G9UA 3WPFA 4C2AB 4L3FA 1M9LA 4ARNA 3DZEA 3W3GA 4KXFB 2O6QA 4V2CA 2WQVA 3E4GA 1FO1A 4LSXA 4PEQB 5AWCA 5AZ5A 4XGOA 1M9SA 2WQXA 3OJAA 4R09A 4ECNA 2P1QB 3W3JA 3KJ4A 1GWBA 4Z64C 3TSRE 3RFEA 2P1MB 4RCWA 1OTOA 4FS7A 4R6AA 1FS2A 4CP6A 2OMVA 2V70A 4BSRA 2XOTA 2UZXA 4AW4A 4NKHA 2Q4GW 3M18A 3WPDA 3G3BA 4J4LA 4U06A 3RFSA 4PSJA 4R08A 3ZYOA 1O6TA 3WPCA 2BEXA 5AWDA 2Z82A 2OMWA 1XCDA 2JQDA 1YRGA 4R6FA 2IFGA 3RIZA 2P1NB 5HDHA 3REZA 4FMZA 5IYXC 3M19A 5GS0A 4ECOA 4BSSA 4LXRA 1DS9A 3ZYJA 1FT8A 3RGXA 3O53A 2WQUA 3VQ2A 4I6JB 2V9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6S A;  4BV4 R;  4QXE A;  3RJ0 A;  4PER A;  1XWD C;  5GMH A;  2JE1 A;  1O6V A;  4XOS A;  3E2J A;  4Z94 G;  3WPH A;  4CIL A;  1KOH A;  4L3A A;  2ID5 A;  2A0Z A;  4XSQ A;  3ZYN A;  2OMZ A;  1FQV A;  2WQW A;  3C6N B;  4CNC A;  4G8A A;  3E6J A;  5B4P A;  3VQ1 A;  1Z7X W;  2Z62 A;  1JL5 A;  2Z7X B;  4R58 A;  1PGV A;  3OGK B;  4RWT C;  2RR6 A;  4U7L A;  1DFJ I;  1SQ0 B;  4LI1 A;  4J0M A;  1XKU A;  1A4Y A;  5GMG A;  4Q62 A;  3WPG A;  4LI2 A;  3FXI A;  2O6R A;  4B8C D;  4M7E C;  4HQ1 A;  5AWB A;  4R6J A;  2OMT A;  2OMU A;  1H6T A;  2Z81 A;  4LSC A;  3W3L A;  4MN8 B;  4FD0 A;  1P9A G;  2UZY A;  4H09 A;  4Y61 B;  3WN4 A;  3E3Z A;  1K5D C;  2OMY A;  1OTM A;  4V2E A;  3CIG A;  1LTX A;  4Q3I A;  2BNH A;  2O6S A;  1U0N D;  4U08 A;  3P72 A;  4CC4 C;  2Z7X A;  3ULV A;  4EZG A;  3WPI A;  3C6P B;  5FTT B;  4R07 A;  5GMF A;  4Z61 C;  4GT6 A;  3ZYI A;  4LSA A;  3RW6 A;  2AST B;  3G04 C;  1M0Z A;  3RW7 A;  4V2D A;  4R0A A;  5HZL B;  4KT1 A;  4ARR A;  4C2B B;  3WPE A;  3OGM B;  3GOZ A;  1OOK G;  3A79 B;  1K5G C;  4KNG A;  2P1P B;  3CVR A;  4PQ8 A;  1XEU A;  3PMH G;  1WWL A;  3RFJ A;  3JB9 j;  4YEB B;  1D0B A;  5CMN A;  4P91 A;  4LSX C;  5GQR K;  1A9N A;  4Z8G A;  4PKI G;  3UL8 A;  4FHO A;  4WYK A;  3W3M A;  4QBZ A;  3SB4 A;  1QYY A;  3UL9 A;  2Z66 A;  1ZIW A;  2Y5Q A;  4M7E A;  4FCG A;  2RA8 A;  2ASS B;  5IJB A;  4P8S A;  3ULU A;  2OMX A;  4GLP A;  3BZ5 A;  4OQT A;  4QC0 A;  1XEC A;  1KOO A;  4WP6 A;  3WPB A;  4MQW X;  3W3N A;  4U09 A;  3OGL B;  4Q3G A;  5B0N A;  3O6N A;  3G39 A;  4NKG A;  2CA6 A;  3G06 A;  1H6U A;  1IO0 A;  2V9T B;  3UN9 A;  2JE0 A;  3UL7 A;  3G3A A;  2P1O B;  5IJC A;  4CC4 A;  1P8V A;  5GS2 B;  5LFN A;  2Z65 A;  4FDW A;  2Z64 A;  5AWA A;  4Z79 A;  5IJD A;  2Z63 A;  1OTN A;  2XWT C;  3C6O B;  2R9U A;  1W8A A;  1OGQ A;  3CIY A;  4BSU A;  2WFH A;  3ULA A;  3OJA B;  4R5D A;  5A5C A;  5D3I A;  4R6G A;  5B0T A;  3W3K A;  5CMP A;  4TZH A;  3RGZ A;  2FT3 A;  4LXS A;  1DCE A;  4AY9 X;  1OZN A;  2ELL A;  4UFR A;  1M10 B;  4R5C A;  4RCA B;  4IM6 A;  4K17 A;  4CNM A;  1P8T A;  1G9U A;  3WPF A;  4C2A B;  4L3F A;  1M9L A;  4ARN A;  3DZE A;  3W3G A;  4KXF B;  2O6Q A;  4V2C A;  2WQV A;  3E4G A;  1FO1 A;  4LSX A;  4PEQ B;  5AWC A;  5AZ5 A;  4XGO A;  1M9S A;  2WQX A;  3OJA A;  4R09 A;  4ECN A;  2P1Q B;  3W3J A;  3KJ4 A;  1GWB A;  4Z64 C;  3TSR E;  3RFE A;  2P1M B;  4RCW A;  1OTO A;  4FS7 A;  4R6A A;  1FS2 A;  4CP6 A;  2OMV A;  2V70 A;  4BSR A;  2XOT A;  2UZX A;  4AW4 A;  4NKH A;  2Q4G W;  3M18 A;  3WPD A;  3G3B A;  4J4L A;  4U06 A;  3RFS A;  4PSJ A;  4R08 A;  3ZYO A;  1O6T A;  3WPC A;  2BEX A;  5AWD A;  2Z82 A;  2OMW A;  1XCD A;  2JQD A;  1YRG A;  4R6F A;  2IFG A;  3RIZ A;  2P1N B;  5HDH A;  3REZ A;  4FMZ A;  5IYX C;  3M19 A;  5GS0 A;  4ECO A;  4BSS A;  4LXR A;  1DS9 A;  3ZYJ A;  1FT8 A;  3RGX A;  3O53 A;  2WQU A;  3VQ2 A;  4I6J B;  2V9S A; 
#chains in the Genus database with same CATH topology
 1O6S A;  4BV4 R;  4QXE A;  3RJ0 A;  4PER A;  1XWD C;  5GMH A;  2JE1 A;  1O6V A;  4XOS A;  3E2J A;  4Z94 G;  3WPH A;  4CIL A;  1KOH A;  4L3A A;  2ID5 A;  2A0Z A;  4XSQ A;  3ZYN A;  2OMZ A;  1FQV A;  2WQW A;  3C6N B;  4CNC A;  4G8A A;  3E6J A;  5B4P A;  3VQ1 A;  1Z7X W;  2Z62 A;  1JL5 A;  2Z7X B;  4R58 A;  1PGV A;  3OGK B;  4RWT C;  2RR6 A;  4U7L A;  1DFJ I;  1SQ0 B;  4LI1 A;  4J0M A;  1XKU A;  1A4Y A;  5GMG A;  4Q62 A;  3WPG A;  4LI2 A;  3FXI A;  2O6R A;  4B8C D;  4M7E C;  4HQ1 A;  5AWB A;  4R6J A;  2OMT A;  2OMU A;  1H6T A;  2Z81 A;  4LSC A;  3W3L A;  4MN8 B;  4FD0 A;  1P9A G;  2UZY A;  4H09 A;  4Y61 B;  3WN4 A;  3E3Z A;  1K5D C;  2OMY A;  1OTM A;  4V2E A;  3CIG A;  1LTX A;  4Q3I A;  2BNH A;  2O6S A;  1U0N D;  4U08 A;  3P72 A;  4CC4 C;  2Z7X A;  3ULV A;  4EZG A;  3WPI A;  3C6P B;  5FTT B;  4R07 A;  5GMF A;  4Z61 C;  4GT6 A;  3ZYI A;  4LSA A;  3RW6 A;  2AST B;  3G04 C;  1M0Z A;  3RW7 A;  4V2D A;  4R0A A;  5HZL B;  4KT1 A;  4ARR A;  4C2B B;  3WPE A;  3OGM B;  3GOZ A;  1OOK G;  3A79 B;  1K5G C;  4KNG A;  2P1P B;  3CVR A;  4PQ8 A;  1XEU A;  3PMH G;  1WWL A;  3RFJ A;  3JB9 j;  4YEB B;  1D0B A;  5CMN A;  4P91 A;  4LSX C;  5GQR K;  1A9N A;  4Z8G A;  4PKI G;  3UL8 A;  4FHO A;  4WYK A;  3W3M A;  4QBZ A;  3SB4 A;  1QYY A;  3UL9 A;  2Z66 A;  1ZIW A;  2Y5Q A;  4M7E A;  4FCG A;  2RA8 A;  2ASS B;  5IJB A;  4P8S A;  3ULU A;  2OMX A;  4GLP A;  3BZ5 A;  4OQT A;  4QC0 A;  1XEC A;  1KOO A;  4WP6 A;  3WPB A;  4MQW X;  3W3N A;  4U09 A;  3OGL B;  4Q3G A;  5B0N A;  3O6N A;  3G39 A;  4NKG A;  2CA6 A;  3G06 A;  1H6U A;  1IO0 A;  2V9T B;  3UN9 A;  2JE0 A;  3UL7 A;  3G3A A;  4NZR M;  2P1O B;  5IJC A;  4CC4 A;  1P8V A;  5GS2 B;  5LFN A;  2Z65 A;  4FDW A;  2Z64 A;  5AWA A;  4Z79 A;  5IJD A;  2Z63 A;  1OTN A;  2XWT C;  3C6O B;  2R9U A;  1W8A A;  1OGQ A;  3CIY A;  4BSU A;  2WFH A;  3ULA A;  3OJA B;  4R5D A;  5A5C A;  5D3I A;  4R6G A;  5B0T A;  3W3K A;  5CMP A;  4TZH A;  3RGZ A;  2FT3 A;  4LXS A;  1DCE A;  4AY9 X;  1OZN A;  2ELL A;  4UFR A;  1M10 B;  4R5C A;  4RCA B;  4IM6 A;  4K17 A;  4CNM A;  1P8T A;  1G9U A;  3WPF A;  4C2A B;  4L3F A;  1M9L A;  4ARN A;  3DZE A;  3W3G A;  4KXF B;  2O6Q A;  4V2C A;  2WQV A;  3E4G A;  1FO1 A;  4LSX A;  4PEQ B;  5AWC A;  5AZ5 A;  4XGO A;  1M9S A;  2WQX A;  3OJA A;  4R09 A;  4ECN A;  2P1Q B;  3W3J A;  3KJ4 A;  1GWB A;  4Z64 C;  3TSR E;  3RFE A;  2P1M B;  4RCW A;  1OTO A;  4FS7 A;  4R6A A;  1FS2 A;  4CP6 A;  2OMV A;  2V70 A;  4BSR A;  2XOT A;  2UZX A;  4AW4 A;  4NKH A;  2Q4G W;  3M18 A;  3WPD A;  3G3B A;  4J4L A;  4U06 A;  3RFS A;  4PSJ A;  4R08 A;  3ZYO A;  1O6T A;  3WPC A;  2BEX A;  4NZT M;  5AWD A;  2Z82 A;  2OMW A;  1XCD A;  2JQD A;  1YRG A;  4R6F A;  2IFG A;  3RIZ A;  2P1N B;  5HDH A;  3REZ A;  4FMZ A;  5IYX C;  3M19 A;  5GS0 A;  4ECO A;  4BSS A;  4LXR A;  1DS9 A;  3ZYJ A;  1FT8 A;  3RGX A;  3O53 A;  2WQU A;  3VQ2 A;  4I6J B;  2V9S A; 
#chains in the Genus database with same CATH homology
 1O6S A;  4BV4 R;  4QXE A;  3RJ0 A;  4PER A;  1XWD C;  5GMH A;  2JE1 A;  1O6V A;  4XOS A;  3E2J A;  4Z94 G;  3WPH A;  4CIL A;  1KOH A;  4L3A A;  2ID5 A;  2A0Z A;  4XSQ A;  3ZYN A;  2OMZ A;  1FQV A;  2WQW A;  3C6N B;  4CNC A;  4G8A A;  3E6J A;  5B4P A;  3VQ1 A;  1Z7X W;  2Z62 A;  1JL5 A;  2Z7X B;  4R58 A;  1PGV A;  3OGK B;  4RWT C;  2RR6 A;  4U7L A;  1DFJ I;  1SQ0 B;  4LI1 A;  4J0M A;  1XKU A;  1A4Y A;  5GMG A;  4Q62 A;  3WPG A;  4LI2 A;  3FXI A;  2O6R A;  4B8C D;  4M7E C;  4HQ1 A;  5AWB A;  4R6J A;  2OMT A;  2OMU A;  1H6T A;  2Z81 A;  4LSC A;  3W3L A;  4MN8 B;  4FD0 A;  1P9A G;  2UZY A;  4H09 A;  4Y61 B;  3WN4 A;  3E3Z A;  1K5D C;  2OMY A;  1OTM A;  4V2E A;  3CIG A;  1LTX A;  4Q3I A;  2BNH A;  2O6S A;  1U0N D;  4U08 A;  3P72 A;  4CC4 C;  2Z7X A;  3ULV A;  4EZG A;  3WPI A;  3C6P B;  5FTT B;  4R07 A;  5GMF A;  4Z61 C;  4GT6 A;  3ZYI A;  4LSA A;  3RW6 A;  2AST B;  3G04 C;  1M0Z A;  3RW7 A;  4V2D A;  4R0A A;  5HZL B;  4KT1 A;  4ARR A;  4C2B B;  3WPE A;  3OGM B;  3GOZ A;  1OOK G;  3A79 B;  1K5G C;  4KNG A;  2P1P B;  3CVR A;  4PQ8 A;  1XEU A;  3PMH G;  1WWL A;  3RFJ A;  3JB9 j;  4YEB B;  1D0B A;  5CMN A;  4P91 A;  4LSX C;  5GQR K;  1A9N A;  4Z8G A;  4PKI G;  3UL8 A;  4FHO A;  4WYK A;  3W3M A;  4QBZ A;  3SB4 A;  1QYY A;  3UL9 A;  2Z66 A;  1ZIW A;  2Y5Q A;  4M7E A;  4FCG A;  2RA8 A;  2ASS B;  5IJB A;  4P8S A;  3ULU A;  2OMX A;  4GLP A;  3BZ5 A;  4OQT A;  4QC0 A;  1XEC A;  1KOO A;  4WP6 A;  3WPB A;  4MQW X;  3W3N A;  4U09 A;  3OGL B;  4Q3G A;  5B0N A;  3O6N A;  3G39 A;  4NKG A;  2CA6 A;  3G06 A;  1H6U A;  1IO0 A;  2V9T B;  3UN9 A;  2JE0 A;  3UL7 A;  3G3A A;  2P1O B;  5IJC A;  4CC4 A;  1P8V A;  5GS2 B;  5LFN A;  2Z65 A;  4FDW A;  2Z64 A;  5AWA A;  4Z79 A;  5IJD A;  2Z63 A;  1OTN A;  2XWT C;  3C6O B;  2R9U A;  1W8A A;  1OGQ A;  3CIY A;  4BSU A;  2WFH A;  3ULA A;  3OJA B;  4R5D A;  5A5C A;  5D3I A;  4R6G A;  5B0T A;  3W3K A;  5CMP A;  4TZH A;  3RGZ A;  2FT3 A;  4LXS A;  1DCE A;  4AY9 X;  1OZN A;  2ELL A;  4UFR A;  1M10 B;  4R5C A;  4RCA B;  4IM6 A;  4K17 A;  4CNM A;  1P8T A;  1G9U A;  3WPF A;  4C2A B;  4L3F A;  1M9L A;  4ARN A;  3DZE A;  3W3G A;  4KXF B;  2O6Q A;  4V2C A;  2WQV A;  3E4G A;  1FO1 A;  4LSX A;  4PEQ B;  5AWC A;  5AZ5 A;  4XGO A;  1M9S A;  2WQX A;  3OJA A;  4R09 A;  4ECN A;  2P1Q B;  3W3J A;  3KJ4 A;  1GWB A;  4Z64 C;  3TSR E;  3RFE A;  2P1M B;  4RCW A;  1OTO A;  4FS7 A;  4R6A A;  1FS2 A;  4CP6 A;  2OMV A;  2V70 A;  4BSR A;  2XOT A;  2UZX A;  4AW4 A;  4NKH A;  2Q4G W;  3M18 A;  3WPD A;  3G3B A;  4J4L A;  4U06 A;  3RFS A;  4PSJ A;  4R08 A;  3ZYO A;  1O6T A;  3WPC A;  2BEX A;  5AWD A;  2Z82 A;  2OMW A;  1XCD A;  2JQD A;  1YRG A;  4R6F A;  2IFG A;  3RIZ A;  2P1N B;  5HDH A;  3REZ A;  4FMZ A;  5IYX C;  3M19 A;  5GS0 A;  4ECO A;  4BSS A;  4LXR A;  1DS9 A;  3ZYJ A;  1FT8 A;  3RGX A;  3O53 A;  2WQU A;  3VQ2 A;  4I6J B;  2V9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...