4BV4R

Structure and allostery in toll-spatzle recognition
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
440
structure length
440
Chain Sequence
SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords PROTEIN SPAETZLE C-106
publication title Cytokine Spatzle Binds to the Drosophila Immunoreceptor Toll with a Neurotrophin-Like Specificity and Couples Receptor Activation.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 142
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4bv4R00
4WYKA 3O6NA 4V2DA 1XWDC 2O6SA 1OZNA 3UL9A 2V9SA 3CIYA 4KNGA 4CNMA 2V9TB 4ECNA 3O53A 3VQ2A 2OMYA 1FO1A 1M9SA 3JB9j 2IFGA 4KXFB 4I6JB 4R09A 1YRGA 1OTOA 4PKIG 3WPGA 4R5DA 4RWTC 5AZ5A 3KJ4A 5IYXC 1D0BA 4V2CA 4J0MA 1M9LA 3VQ1A 1FS2A 4U09A 2Z65A 4LXRA 3W3JA 3G04C 5GQRK 1P8VA 3FXIA 2WQVA 2OMWA 4XSQA 2ASSB 1P9AG 3WPEA 1O6TA 1GWBA 2Z64A 3CIGA 1DFJI 1SQ0B 4L3AA 3WN4A 3DZEA 2UZXA 4R0AA 5FTTB 4FCGA 1XKUA 5GMFA 3E3ZA 4AY9X 4TZHA 2R9UA 4M7EA 3RFJA 5IJBA 3G3AA 4FHOA 2P1NB 3RFSA 4Q62A 4LSAA 2OMZA 4WP6A 4FD0A 4R6AA 3UL8A 5IJCA 4Z64C 5CMPA 3G3BA 3C6OB 2JE0A 2Z81A 1O6SA 5B4PA 2ID5A 4CILA 3M18A 4U06A 4QC0A 3SB4A 3E4GA 2XWTC 4PERA 4CNCA 4PEQB 2RR6A 3RJ0A 2O6RA 3CVRA 4MQWX 3OGKB 4LI2A 5GS0A 4XOSA 3OGMB 1FQVA 1PGVA 4BSRA 2CA6A 3ULUA 2WQUA 4Z94G 2WQWA 1OTMA 2P1PB 3P72A 3GOZA 3WPHA 3RIZA 4R58A 4C2AB 5B0TA 3WPIA 4ARNA 4GT6A 1M0ZA 4LSXA 3WPCA 5AWCA 1KOHA 1G9UA 4NKHA 4C2BB 1O6VA 5GS2B 1U0ND 1K5GC 4R5CA 3ZYOA 1QYYA 4FMZA 4P91A 2JQDA 3TSRE 3REZA 1XECA 1JL5A 1DS9A 4CP6A 4YEBB 3ZYNA 3PMHG 1XCDA 4ARRA 4GLPA 3ULVA 1LTXA 2XOTA 4G8AA 2ASTB 1A4YA 4BSUA 2Q4GW 3E2JA 5GMHA 4QBZA 4KT1A 4Q3GA 4J4LA 4R6FA 2OMUA 5GMGA 4Z79A 3WPFA 4UFRA 3G06A 3RW7A 3W3NA 4OQTA 3W3KA 2BNHA 1KOOA 2O6QA 2ELLA 1H6UA 4B8CD 1OOKG 2UZYA 4M7EC 4P8SA 5AWBA 4PSJA 5AWAA 4QXEA 3OJAA 4FS7A 5HDHA 1WWLA 4R07A 3RW6A 3ZYJA 3OGLB 2FT3A 3UN9A 5D3IA 2WQXA 5LFNA 4BV4R 3W3MA 4L3FA 4Q3IA 3WPDA 4AW4A 4BSSA 3A79B 2P1MB 2Z7XA 3G39A 2JE1A 3C6NB 3RGZA 3UL7A 4MN8B 4LSCA 2RA8A 4LXSA 4NKGA 3M19A 3BZ5A 3RFEA 2P1OB 2OMTA 4Z8GA 2A0ZA 2Z63A 5HZLB 3ZYIA 2Y5QA 3OJAB 2BEXA 2Z62A 3E6JA 2WFHA 4V2EA 4U08A 2V70A 1K5DC 4LSXC 3ULAA 4FDWA 2P1QB 4Z61C 5A5CA 1H6TA 5IJDA 1OTNA 1OGQA 4U7LA 3C6PB 2Z66A 4IM6A 1P8TA 2Z82A 1Z7XW 4CC4A 2Z7XB 4XGOA 4RCWA 4Y61B 3RGXA 4LI1A 1DCEA 3W3LA 4R08A 1XEUA 1IO0A 1A9NA 5B0NA 5CMNA 4ECOA 1ZIWA 4H09A 5AWDA 4HQ1A 1W8AA 2OMXA 3W3GA 2OMVA 4R6GA 4CC4C 4EZGA 1FT8A 4R6JA 3WPBA 4K17A 1M10B 4RCAB 4PQ8A
chains in the Genus database with same CATH superfamily
4WYKA 3O6NA 4V2DA 1XWDC 2O6SA 1OZNA 3UL9A 2V9SA 3CIYA 4KNGA 4CNMA 2V9TB 4ECNA 3O53A 3VQ2A 2OMYA 1FO1A 1M9SA 3JB9j 2IFGA 4KXFB 4I6JB 4R09A 1YRGA 1OTOA 4PKIG 3WPGA 4R5DA 4RWTC 5AZ5A 3KJ4A 5IYXC 1D0BA 4V2CA 4J0MA 1M9LA 3VQ1A 1FS2A 4U09A 2Z65A 4LXRA 3W3JA 3G04C 5GQRK 1P8VA 3FXIA 2WQVA 2OMWA 4XSQA 2ASSB 1P9AG 3WPEA 1O6TA 1GWBA 2Z64A 3CIGA 1DFJI 1SQ0B 4L3AA 3WN4A 3DZEA 2UZXA 4R0AA 5FTTB 4FCGA 1XKUA 5GMFA 3E3ZA 4AY9X 4TZHA 2R9UA 4M7EA 3RFJA 5IJBA 3G3AA 4FHOA 2P1NB 3RFSA 4Q62A 4LSAA 2OMZA 4WP6A 4FD0A 4R6AA 3UL8A 5IJCA 4Z64C 5CMPA 3G3BA 3C6OB 2JE0A 2Z81A 1O6SA 5B4PA 2ID5A 4CILA 3M18A 4U06A 4QC0A 3SB4A 3E4GA 2XWTC 4PERA 4CNCA 4PEQB 2RR6A 3RJ0A 2O6RA 3CVRA 5GS0A 4MQWX 3OGKB 4LI2A 4NZRM 4XOSA 3OGMB 1FQVA 1PGVA 4BSRA 2CA6A 3ULUA 2WQUA 4Z94G 2WQWA 1OTMA 2P1PB 3P72A 3GOZA 3WPHA 3RIZA 4R58A 4C2AB 5B0TA 3WPIA 4ARNA 4GT6A 1M0ZA 4LSXA 3WPCA 5AWCA 1KOHA 1G9UA 4NKHA 4C2BB 1O6VA 5GS2B 1U0ND 1K5GC 4R5CA 3ZYOA 1QYYA 4FMZA 4P91A 2JQDA 3TSRE 3REZA 1XECA 1JL5A 1DS9A 4CP6A 4YEBB 3ZYNA 3PMHG 1XCDA 4ARRA 4GLPA 3ULVA 1LTXA 2XOTA 4G8AA 2ASTB 1A4YA 4BSUA 2Q4GW 3E2JA 5GMHA 4QBZA 4KT1A 4Q3GA 4J4LA 4R6FA 2OMUA 5GMGA 4Z79A 3WPFA 4UFRA 3G06A 3RW7A 3W3NA 4OQTA 3W3KA 2BNHA 1KOOA 4NZTM 2O6QA 2ELLA 1H6UA 4B8CD 1OOKG 2UZYA 4M7EC 4P8SA 5AWBA 4PSJA 5AWAA 4QXEA 3OJAA 4FS7A 5HDHA 1WWLA 4R07A 3RW6A 3ZYJA 3OGLB 2FT3A 3UN9A 5D3IA 2WQXA 5LFNA 4BV4R 3W3MA 4L3FA 4Q3IA 3WPDA 4AW4A 4BSSA 3A79B 2P1MB 2Z7XA 3G39A 2JE1A 3C6NB 3RGZA 3UL7A 4MN8B 4LSCA 2RA8A 4LXSA 4NKGA 3M19A 3BZ5A 3RFEA 2P1OB 2OMTA 4Z8GA 2A0ZA 2Z63A 5HZLB 3ZYIA 2Y5QA 3OJAB 2BEXA 2Z62A 3E6JA 2WFHA 4V2EA 4U08A 2V70A 1K5DC 4LSXC 3ULAA 4FDWA 2P1QB 4Z61C 5A5CA 1H6TA 5IJDA 1OTNA 1OGQA 4U7LA 3C6PB 2Z66A 4IM6A 1P8TA 2Z82A 1Z7XW 4CC4A 2Z7XB 4XGOA 4RCWA 4Y61B 3RGXA 4LI1A 1DCEA 3W3LA 4R08A 1XEUA 1IO0A 1A9NA 5B0NA 5CMNA 4ECOA 1ZIWA 4H09A 5AWDA 4HQ1A 1W8AA 2OMXA 3W3GA 2OMVA 4R6GA 4CC4C 4EZGA 1FT8A 4R6JA 3WPBA 4K17A 1M10B 4RCAB 4PQ8A
chains in the Genus database with same CATH topology
4WYKA 3O6NA 4V2DA 1XWDC 2O6SA 1OZNA 3UL9A 2V9SA 3CIYA 4KNGA 4CNMA 2V9TB 4ECNA 3O53A 3VQ2A 2OMYA 1FO1A 1M9SA 3JB9j 2IFGA 4KXFB 4I6JB 4R09A 1YRGA 1OTOA 4PKIG 3WPGA 4R5DA 4RWTC 5AZ5A 3KJ4A 5IYXC 1D0BA 4V2CA 4J0MA 1M9LA 3VQ1A 1FS2A 4U09A 2Z65A 4LXRA 3W3JA 3G04C 5GQRK 1P8VA 3FXIA 2WQVA 2OMWA 4XSQA 2ASSB 1P9AG 3WPEA 1O6TA 1GWBA 2Z64A 3CIGA 1DFJI 1SQ0B 4L3AA 3WN4A 3DZEA 2UZXA 4R0AA 5FTTB 4FCGA 1XKUA 5GMFA 3E3ZA 4AY9X 4TZHA 2R9UA 4M7EA 3RFJA 5IJBA 3G3AA 4FHOA 2P1NB 3RFSA 4Q62A 4LSAA 2OMZA 4WP6A 4FD0A 4R6AA 3UL8A 5IJCA 4Z64C 5CMPA 3G3BA 3C6OB 2JE0A 2Z81A 1O6SA 5B4PA 2ID5A 4CILA 3M18A 4U06A 4QC0A 3SB4A 3E4GA 2XWTC 4PERA 4CNCA 4PEQB 2RR6A 3RJ0A 2O6RA 3CVRA 4MQWX 3OGKB 4LI2A 5GS0A 4XOSA 3OGMB 1FQVA 1PGVA 4BSRA 2CA6A 3ULUA 2WQUA 4Z94G 2WQWA 1OTMA 2P1PB 3P72A 3GOZA 3WPHA 3RIZA 4R58A 4C2AB 5B0TA 3WPIA 4ARNA 4GT6A 1M0ZA 4LSXA 3WPCA 5AWCA 1KOHA 1G9UA 4NKHA 4C2BB 1O6VA 5GS2B 1U0ND 1K5GC 4R5CA 3ZYOA 1QYYA 4FMZA 4P91A 2JQDA 3TSRE 3REZA 1XECA 1JL5A 1DS9A 4CP6A 4YEBB 3ZYNA 3PMHG 1XCDA 4ARRA 4GLPA 3ULVA 1LTXA 2XOTA 4G8AA 2ASTB 1A4YA 4BSUA 2Q4GW 3E2JA 5GMHA 4QBZA 4KT1A 4Q3GA 4J4LA 4R6FA 2OMUA 5GMGA 4Z79A 3WPFA 4UFRA 3G06A 3RW7A 3W3NA 4OQTA 3W3KA 2BNHA 1KOOA 2O6QA 2ELLA 1H6UA 4B8CD 1OOKG 2UZYA 4M7EC 4P8SA 5AWBA 4PSJA 5AWAA 4QXEA 3OJAA 4FS7A 5HDHA 1WWLA 4R07A 3RW6A 3ZYJA 3OGLB 2FT3A 3UN9A 5D3IA 2WQXA 5LFNA 4BV4R 3W3MA 4L3FA 4Q3IA 3WPDA 4AW4A 4BSSA 3A79B 2P1MB 2Z7XA 3G39A 2JE1A 3C6NB 3RGZA 3UL7A 4MN8B 4LSCA 2RA8A 4LXSA 4NKGA 3M19A 3BZ5A 3RFEA 2P1OB 2OMTA 4Z8GA 2A0ZA 2Z63A 5HZLB 3ZYIA 2Y5QA 3OJAB 2BEXA 2Z62A 3E6JA 2WFHA 4V2EA 4U08A 2V70A 1K5DC 4LSXC 3ULAA 4FDWA 2P1QB 4Z61C 5A5CA 1H6TA 5IJDA 1OTNA 1OGQA 4U7LA 3C6PB 2Z66A 4IM6A 1P8TA 2Z82A 1Z7XW 4CC4A 2Z7XB 4XGOA 4RCWA 4Y61B 3RGXA 4LI1A 1DCEA 3W3LA 4R08A 1XEUA 1IO0A 1A9NA 5B0NA 5CMNA 4ECOA 1ZIWA 4H09A 5AWDA 4HQ1A 1W8AA 2OMXA 3W3GA 2OMVA 4R6GA 4CC4C 4EZGA 1FT8A 4R6JA 3WPBA 4K17A 1M10B 4RCAB 4PQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYK A;  3O6N A;  4V2D A;  1XWD C;  2O6S A;  1OZN A;  3UL9 A;  2V9S A;  3CIY A;  4KNG A;  4CNM A;  2V9T B;  4ECN A;  3O53 A;  3VQ2 A;  2OMY A;  1FO1 A;  1M9S A;  3JB9 j;  2IFG A;  4KXF B;  4I6J B;  4R09 A;  1YRG A;  1OTO A;  4PKI G;  3WPG A;  4R5D A;  4RWT C;  5AZ5 A;  3KJ4 A;  5IYX C;  1D0B A;  4V2C A;  4J0M A;  1M9L A;  3VQ1 A;  1FS2 A;  4U09 A;  2Z65 A;  4LXR A;  3W3J A;  3G04 C;  5GQR K;  1P8V A;  3FXI A;  2WQV A;  2OMW A;  4XSQ A;  2ASS B;  1P9A G;  3WPE A;  1O6T A;  1GWB A;  2Z64 A;  3CIG A;  1DFJ I;  1SQ0 B;  4L3A A;  3WN4 A;  3DZE A;  2UZX A;  4R0A A;  5FTT B;  4FCG A;  1XKU A;  5GMF A;  3E3Z A;  4AY9 X;  4TZH A;  2R9U A;  4M7E A;  3RFJ A;  5IJB A;  3G3A A;  4FHO A;  2P1N B;  3RFS A;  4Q62 A;  4LSA A;  2OMZ A;  4WP6 A;  4FD0 A;  4R6A A;  3UL8 A;  5IJC A;  4Z64 C;  5CMP A;  3G3B A;  3C6O B;  2JE0 A;  2Z81 A;  1O6S A;  5B4P A;  2ID5 A;  4CIL A;  3M18 A;  4U06 A;  4QC0 A;  3SB4 A;  3E4G A;  2XWT C;  4PER A;  4CNC A;  4PEQ B;  2RR6 A;  3RJ0 A;  2O6R A;  3CVR A;  4MQW X;  3OGK B;  4LI2 A;  5GS0 A;  4XOS A;  3OGM B;  1FQV A;  1PGV A;  4BSR A;  2CA6 A;  3ULU A;  2WQU A;  4Z94 G;  2WQW A;  1OTM A;  2P1P B;  3P72 A;  3GOZ A;  3WPH A;  3RIZ A;  4R58 A;  4C2A B;  5B0T A;  3WPI A;  4ARN A;  4GT6 A;  1M0Z A;  4LSX A;  3WPC A;  5AWC A;  1KOH A;  1G9U A;  4NKH A;  4C2B B;  1O6V A;  5GS2 B;  1U0N D;  1K5G C;  4R5C A;  3ZYO A;  1QYY A;  4FMZ A;  4P91 A;  2JQD A;  3TSR E;  3REZ A;  1XEC A;  1JL5 A;  1DS9 A;  4CP6 A;  4YEB B;  3ZYN A;  3PMH G;  1XCD A;  4ARR A;  4GLP A;  3ULV A;  1LTX A;  2XOT A;  4G8A A;  2AST B;  1A4Y A;  4BSU A;  2Q4G W;  3E2J A;  5GMH A;  4QBZ A;  4KT1 A;  4Q3G A;  4J4L A;  4R6F A;  2OMU A;  5GMG A;  4Z79 A;  3WPF A;  4UFR A;  3G06 A;  3RW7 A;  3W3N A;  4OQT A;  3W3K A;  2BNH A;  1KOO A;  2O6Q A;  2ELL A;  1H6U A;  4B8C D;  1OOK G;  2UZY A;  4M7E C;  4P8S A;  5AWB A;  4PSJ A;  5AWA A;  4QXE A;  3OJA A;  4FS7 A;  5HDH A;  1WWL A;  4R07 A;  3RW6 A;  3ZYJ A;  3OGL B;  2FT3 A;  3UN9 A;  5D3I A;  2WQX A;  5LFN A;  4BV4 R;  3W3M A;  4L3F A;  4Q3I A;  3WPD A;  4AW4 A;  4BSS A;  3A79 B;  2P1M B;  2Z7X A;  3G39 A;  2JE1 A;  3C6N B;  3RGZ A;  3UL7 A;  4MN8 B;  4LSC A;  2RA8 A;  4LXS A;  4NKG A;  3M19 A;  3BZ5 A;  3RFE A;  2P1O B;  2OMT A;  4Z8G A;  2A0Z A;  2Z63 A;  5HZL B;  3ZYI A;  2Y5Q A;  3OJA B;  2BEX A;  2Z62 A;  3E6J A;  2WFH A;  4V2E A;  4U08 A;  2V70 A;  1K5D C;  4LSX C;  3ULA A;  4FDW A;  2P1Q B;  4Z61 C;  5A5C A;  1H6T A;  5IJD A;  1OTN A;  1OGQ A;  4U7L A;  3C6P B;  2Z66 A;  4IM6 A;  1P8T A;  2Z82 A;  1Z7X W;  4CC4 A;  2Z7X B;  4XGO A;  4RCW A;  4Y61 B;  3RGX A;  4LI1 A;  1DCE A;  3W3L A;  4R08 A;  1XEU A;  1IO0 A;  1A9N A;  5B0N A;  5CMN A;  4ECO A;  1ZIW A;  4H09 A;  5AWD A;  4HQ1 A;  1W8A A;  2OMX A;  3W3G A;  2OMV A;  4R6G A;  4CC4 C;  4EZG A;  1FT8 A;  4R6J A;  3WPB A;  4K17 A;  1M10 B;  4RCA B;  4PQ8 A; 
#chains in the Genus database with same CATH topology
 4WYK A;  3O6N A;  4V2D A;  1XWD C;  2O6S A;  1OZN A;  3UL9 A;  2V9S A;  3CIY A;  4KNG A;  4CNM A;  2V9T B;  4ECN A;  3O53 A;  3VQ2 A;  2OMY A;  1FO1 A;  1M9S A;  3JB9 j;  2IFG A;  4KXF B;  4I6J B;  4R09 A;  1YRG A;  1OTO A;  4PKI G;  3WPG A;  4R5D A;  4RWT C;  5AZ5 A;  3KJ4 A;  5IYX C;  1D0B A;  4V2C A;  4J0M A;  1M9L A;  3VQ1 A;  1FS2 A;  4U09 A;  2Z65 A;  4LXR A;  3W3J A;  3G04 C;  5GQR K;  1P8V A;  3FXI A;  2WQV A;  2OMW A;  4XSQ A;  2ASS B;  1P9A G;  3WPE A;  1O6T A;  1GWB A;  2Z64 A;  3CIG A;  1DFJ I;  1SQ0 B;  4L3A A;  3WN4 A;  3DZE A;  2UZX A;  4R0A A;  5FTT B;  4FCG A;  1XKU A;  5GMF A;  3E3Z A;  4AY9 X;  4TZH A;  2R9U A;  4M7E A;  3RFJ A;  5IJB A;  3G3A A;  4FHO A;  2P1N B;  3RFS A;  4Q62 A;  4LSA A;  2OMZ A;  4WP6 A;  4FD0 A;  4R6A A;  3UL8 A;  5IJC A;  4Z64 C;  5CMP A;  3G3B A;  3C6O B;  2JE0 A;  2Z81 A;  1O6S A;  5B4P A;  2ID5 A;  4CIL A;  3M18 A;  4U06 A;  4QC0 A;  3SB4 A;  3E4G A;  2XWT C;  4PER A;  4CNC A;  4PEQ B;  2RR6 A;  3RJ0 A;  2O6R A;  3CVR A;  5GS0 A;  4MQW X;  3OGK B;  4LI2 A;  4NZR M;  4XOS A;  3OGM B;  1FQV A;  1PGV A;  4BSR A;  2CA6 A;  3ULU A;  2WQU A;  4Z94 G;  2WQW A;  1OTM A;  2P1P B;  3P72 A;  3GOZ A;  3WPH A;  3RIZ A;  4R58 A;  4C2A B;  5B0T A;  3WPI A;  4ARN A;  4GT6 A;  1M0Z A;  4LSX A;  3WPC A;  5AWC A;  1KOH A;  1G9U A;  4NKH A;  4C2B B;  1O6V A;  5GS2 B;  1U0N D;  1K5G C;  4R5C A;  3ZYO A;  1QYY A;  4FMZ A;  4P91 A;  2JQD A;  3TSR E;  3REZ A;  1XEC A;  1JL5 A;  1DS9 A;  4CP6 A;  4YEB B;  3ZYN A;  3PMH G;  1XCD A;  4ARR A;  4GLP A;  3ULV A;  1LTX A;  2XOT A;  4G8A A;  2AST B;  1A4Y A;  4BSU A;  2Q4G W;  3E2J A;  5GMH A;  4QBZ A;  4KT1 A;  4Q3G A;  4J4L A;  4R6F A;  2OMU A;  5GMG A;  4Z79 A;  3WPF A;  4UFR A;  3G06 A;  3RW7 A;  3W3N A;  4OQT A;  3W3K A;  2BNH A;  1KOO A;  4NZT M;  2O6Q A;  2ELL A;  1H6U A;  4B8C D;  1OOK G;  2UZY A;  4M7E C;  4P8S A;  5AWB A;  4PSJ A;  5AWA A;  4QXE A;  3OJA A;  4FS7 A;  5HDH A;  1WWL A;  4R07 A;  3RW6 A;  3ZYJ A;  3OGL B;  2FT3 A;  3UN9 A;  5D3I A;  2WQX A;  5LFN A;  4BV4 R;  3W3M A;  4L3F A;  4Q3I A;  3WPD A;  4AW4 A;  4BSS A;  3A79 B;  2P1M B;  2Z7X A;  3G39 A;  2JE1 A;  3C6N B;  3RGZ A;  3UL7 A;  4MN8 B;  4LSC A;  2RA8 A;  4LXS A;  4NKG A;  3M19 A;  3BZ5 A;  3RFE A;  2P1O B;  2OMT A;  4Z8G A;  2A0Z A;  2Z63 A;  5HZL B;  3ZYI A;  2Y5Q A;  3OJA B;  2BEX A;  2Z62 A;  3E6J A;  2WFH A;  4V2E A;  4U08 A;  2V70 A;  1K5D C;  4LSX C;  3ULA A;  4FDW A;  2P1Q B;  4Z61 C;  5A5C A;  1H6T A;  5IJD A;  1OTN A;  1OGQ A;  4U7L A;  3C6P B;  2Z66 A;  4IM6 A;  1P8T A;  2Z82 A;  1Z7X W;  4CC4 A;  2Z7X B;  4XGO A;  4RCW A;  4Y61 B;  3RGX A;  4LI1 A;  1DCE A;  3W3L A;  4R08 A;  1XEU A;  1IO0 A;  1A9N A;  5B0N A;  5CMN A;  4ECO A;  1ZIW A;  4H09 A;  5AWD A;  4HQ1 A;  1W8A A;  2OMX A;  3W3G A;  2OMV A;  4R6G A;  4CC4 C;  4EZG A;  1FT8 A;  4R6J A;  3WPB A;  4K17 A;  1M10 B;  4RCA B;  4PQ8 A; 
#chains in the Genus database with same CATH homology
 4WYK A;  3O6N A;  4V2D A;  1XWD C;  2O6S A;  1OZN A;  3UL9 A;  2V9S A;  3CIY A;  4KNG A;  4CNM A;  2V9T B;  4ECN A;  3O53 A;  3VQ2 A;  2OMY A;  1FO1 A;  1M9S A;  3JB9 j;  2IFG A;  4KXF B;  4I6J B;  4R09 A;  1YRG A;  1OTO A;  4PKI G;  3WPG A;  4R5D A;  4RWT C;  5AZ5 A;  3KJ4 A;  5IYX C;  1D0B A;  4V2C A;  4J0M A;  1M9L A;  3VQ1 A;  1FS2 A;  4U09 A;  2Z65 A;  4LXR A;  3W3J A;  3G04 C;  5GQR K;  1P8V A;  3FXI A;  2WQV A;  2OMW A;  4XSQ A;  2ASS B;  1P9A G;  3WPE A;  1O6T A;  1GWB A;  2Z64 A;  3CIG A;  1DFJ I;  1SQ0 B;  4L3A A;  3WN4 A;  3DZE A;  2UZX A;  4R0A A;  5FTT B;  4FCG A;  1XKU A;  5GMF A;  3E3Z A;  4AY9 X;  4TZH A;  2R9U A;  4M7E A;  3RFJ A;  5IJB A;  3G3A A;  4FHO A;  2P1N B;  3RFS A;  4Q62 A;  4LSA A;  2OMZ A;  4WP6 A;  4FD0 A;  4R6A A;  3UL8 A;  5IJC A;  4Z64 C;  5CMP A;  3G3B A;  3C6O B;  2JE0 A;  2Z81 A;  1O6S A;  5B4P A;  2ID5 A;  4CIL A;  3M18 A;  4U06 A;  4QC0 A;  3SB4 A;  3E4G A;  2XWT C;  4PER A;  4CNC A;  4PEQ B;  2RR6 A;  3RJ0 A;  2O6R A;  3CVR A;  4MQW X;  3OGK B;  4LI2 A;  5GS0 A;  4XOS A;  3OGM B;  1FQV A;  1PGV A;  4BSR A;  2CA6 A;  3ULU A;  2WQU A;  4Z94 G;  2WQW A;  1OTM A;  2P1P B;  3P72 A;  3GOZ A;  3WPH A;  3RIZ A;  4R58 A;  4C2A B;  5B0T A;  3WPI A;  4ARN A;  4GT6 A;  1M0Z A;  4LSX A;  3WPC A;  5AWC A;  1KOH A;  1G9U A;  4NKH A;  4C2B B;  1O6V A;  5GS2 B;  1U0N D;  1K5G C;  4R5C A;  3ZYO A;  1QYY A;  4FMZ A;  4P91 A;  2JQD A;  3TSR E;  3REZ A;  1XEC A;  1JL5 A;  1DS9 A;  4CP6 A;  4YEB B;  3ZYN A;  3PMH G;  1XCD A;  4ARR A;  4GLP A;  3ULV A;  1LTX A;  2XOT A;  4G8A A;  2AST B;  1A4Y A;  4BSU A;  2Q4G W;  3E2J A;  5GMH A;  4QBZ A;  4KT1 A;  4Q3G A;  4J4L A;  4R6F A;  2OMU A;  5GMG A;  4Z79 A;  3WPF A;  4UFR A;  3G06 A;  3RW7 A;  3W3N A;  4OQT A;  3W3K A;  2BNH A;  1KOO A;  2O6Q A;  2ELL A;  1H6U A;  4B8C D;  1OOK G;  2UZY A;  4M7E C;  4P8S A;  5AWB A;  4PSJ A;  5AWA A;  4QXE A;  3OJA A;  4FS7 A;  5HDH A;  1WWL A;  4R07 A;  3RW6 A;  3ZYJ A;  3OGL B;  2FT3 A;  3UN9 A;  5D3I A;  2WQX A;  5LFN A;  4BV4 R;  3W3M A;  4L3F A;  4Q3I A;  3WPD A;  4AW4 A;  4BSS A;  3A79 B;  2P1M B;  2Z7X A;  3G39 A;  2JE1 A;  3C6N B;  3RGZ A;  3UL7 A;  4MN8 B;  4LSC A;  2RA8 A;  4LXS A;  4NKG A;  3M19 A;  3BZ5 A;  3RFE A;  2P1O B;  2OMT A;  4Z8G A;  2A0Z A;  2Z63 A;  5HZL B;  3ZYI A;  2Y5Q A;  3OJA B;  2BEX A;  2Z62 A;  3E6J A;  2WFH A;  4V2E A;  4U08 A;  2V70 A;  1K5D C;  4LSX C;  3ULA A;  4FDW A;  2P1Q B;  4Z61 C;  5A5C A;  1H6T A;  5IJD A;  1OTN A;  1OGQ A;  4U7L A;  3C6P B;  2Z66 A;  4IM6 A;  1P8T A;  2Z82 A;  1Z7X W;  4CC4 A;  2Z7X B;  4XGO A;  4RCW A;  4Y61 B;  3RGX A;  4LI1 A;  1DCE A;  3W3L A;  4R08 A;  1XEU A;  1IO0 A;  1A9N A;  5B0N A;  5CMN A;  4ECO A;  1ZIW A;  4H09 A;  5AWD A;  4HQ1 A;  1W8A A;  2OMX A;  3W3G A;  2OMV A;  4R6G A;  4CC4 C;  4EZG A;  1FT8 A;  4R6J A;  3WPB A;  4K17 A;  1M10 B;  4RCA B;  4PQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...