4BV4R

Structure and allostery in toll-spatzle recognition
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
440
structure length
440
Chain Sequence
b'SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cytokine Spatzle Binds to the Drosophila Immunoreceptor Toll with a Neurotrophin-Like Specificity and Couples Receptor Activation.
pubmed doi rcsb
molecule keywords PROTEIN SPAETZLE C-106
source organism Drosophila melanogaster
molecule tags Immune system
total genus 142
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4bv4R00
2CA6A 1XCDA 4LXRA 4Z64C 5GMHA 4U09A 4BV4R 1FS2A 1O6VA 1OGQA 2Z63A 1P8VA 3W3KA 3WPEA 1ZIWA 1IO0A 2JQDA 5IJBA 4QBZA 4OQTA 3UL7A 3ZYOA 4NKHA 3WPCA 3OGLB 1OZNA 2XWTC 2IFGA 4EZGA 2OMYA 4L3FA 4U06A 2ASTB 2Z65A 3JB9j 4XGOA 1OTNA 1DFJI 1H6UA 2ID5A 4P8SA 4K17A 4GT6A 3RW7A 5B0TA 3BZ5A 4PQ8A 4FD0A 3UL9A 3E6JA 3VQ1A 4BSUA 2ASSB 3OGMB 2UZXA 3PMHG 1A4YA 3G3BA 4LI2A 4CC4C 1QYYA 4U7LA 1OTOA 4TZHA 4J0MA 4LSXC 4R0AA 3C6OB 4FCGA 3W3JA 4I6JB 3WPFA 3O6NA 2Y5QA 5CMPA 4CILA 4WYKA 4R58A 1LTXA 4LI1A 4M7EC 4Z61C 1FQVA 1FT8A 2V9TB 3WPHA 3TSRE 2O6SA 2OMUA 3CIYA 4AW4A 5B4PA 1GWBA 4J4LA 4Z79A 5GS0A 3WN4A 1OTMA 2OMZA 1FO1A 5HZLB 1XECA 3CIGA 2FT3A 3ZYNA 2P1QB 2BEXA 5IYXC 4R6GA 2P1NB 2A0ZA 4R08A 1XKUA 3SB4A 4PEQB 2Z62A 4ECOA 4YEBB 3FXIA 4P91A 3RW6A 3G39A 4Z94G 3RFEA 1U0ND 2P1MB 3CVRA 1P9AG 2WQXA 4UFRA 4G8AA 2Q4GW 3C6NB 4V2CA 5GMFA 4FMZA 4KXFB 5D3IA 3E4GA 1PGVA 5AWDA 4FS7A 4XSQA 2O6RA 3A79B 1OOKG 5B0NA 1O6TA 5AWAA 3M18A 4QC0A 4CP6A 1DCEA 2P1PB 1O6SA 3ULAA 4RWTC 3W3NA 4Q62A 4BSSA 3OJAA 2Z7XB 4LSAA 4CC4A 1M9SA 3P72A 1M9LA 4LSXA 3OGKB 2JE0A 4KNGA 5IJCA 3WPGA 1SQ0B 5LFNA 4CNMA 4U08A 4C2AB 2OMWA 4ARNA 4M7EA 5IJDA 4V2EA 3REZA 4LXSA 1KOHA 4BSRA 4NKGA 3E2JA 3ZYJA 2RA8A 4FDWA 2Z81A 4R09A 3W3LA 2WFHA 3G04C 3O53A 2V70A 2Z82A 2OMTA 4V2DA 4GLPA 4Y61B 4C2BB 4ECNA 4ARRA 1DS9A 1P8TA 4WP6A 2WQVA 3WPBA 4Q3IA 5HDHA 2RR6A 3W3MA 4R5CA 2O6QA 1H6TA 1KOOA 2BNHA 5GMGA 2OMXA 3W3GA 4R6JA 2UZYA 2WQWA 2XOTA 3DZEA 3RGXA 3UN9A 4KT1A 5AWBA 1Z7XW 3RFSA 5A5CA 4B8CD 3ULVA 4QXEA 4R6AA 4CNCA 1M0ZA 4LSCA 3KJ4A 5GQRK 4Q3GA 3M19A 4AY9X 2OMVA 2Z7XA 3VQ2A 1YRGA 3GOZA 2Z64A 1JL5A 3G06A 2Z66A 2ELLA 1WWLA 3WPIA 3RJ0A 1W8AA 4IM6A 3E3ZA 4MQWX 3UL8A 1M10B 4MN8B 5CMNA 5GS2B 4R07A 4PSJA 2V9SA 3RFJA 1A9NA 4R6FA 3C6PB 1K5DC 3RGZA 4Z8GA 3ULUA 3G3AA 1D0BA 2R9UA 2WQUA 4RCAB 4L3AA 4FHOA 4PKIG 4R5DA 1G9UA 4XOSA 3OJAB 2P1OB 4PERA 3ZYIA 4RCWA 3WPDA 1K5GC 5FTTB 5AZ5A 1XWDC 5AWCA 4H09A 4HQ1A 2JE1A 1XEUA 3RIZA
chains in the Genus database with same CATH superfamily
2CA6A 1XCDA 4LXRA 4Z64C 5GMHA 4U09A 4BV4R 1FS2A 1O6VA 1OGQA 2Z63A 1P8VA 3W3KA 3WPEA 1ZIWA 1IO0A 2JQDA 5IJBA 4QBZA 4OQTA 3UL7A 3ZYOA 4NKHA 3WPCA 3OGLB 1OZNA 2XWTC 2IFGA 4EZGA 2OMYA 4L3FA 4NZRM 4U06A 2ASTB 2Z65A 3JB9j 4XGOA 1OTNA 1DFJI 1H6UA 2ID5A 4P8SA 4K17A 4GT6A 3RW7A 5B0TA 3BZ5A 4PQ8A 4FD0A 3UL9A 3E6JA 3VQ1A 4BSUA 2ASSB 3OGMB 2UZXA 3PMHG 1A4YA 3G3BA 4LI2A 4CC4C 1QYYA 4U7LA 1OTOA 4TZHA 4J0MA 4LSXC 4R0AA 3C6OB 4FCGA 3W3JA 4I6JB 3WPFA 3O6NA 2Y5QA 5CMPA 4CILA 4WYKA 4R58A 1LTXA 4LI1A 4M7EC 4Z61C 1FQVA 1FT8A 2V9TB 3WPHA 3TSRE 2O6SA 2OMUA 3CIYA 4AW4A 5B4PA 1GWBA 4J4LA 4Z79A 5GS0A 3WN4A 1OTMA 2OMZA 1FO1A 5HZLB 1XECA 3CIGA 2FT3A 3ZYNA 2P1QB 2BEXA 5IYXC 4R6GA 2P1NB 2A0ZA 4R08A 1XKUA 3SB4A 4PEQB 2Z62A 4ECOA 4YEBB 3FXIA 4P91A 3RW6A 3G39A 4Z94G 3RFEA 1U0ND 2P1MB 3CVRA 1P9AG 2WQXA 4UFRA 4G8AA 2Q4GW 3C6NB 4V2CA 5GMFA 4FMZA 4KXFB 5D3IA 3E4GA 1PGVA 5AWDA 4FS7A 4XSQA 2O6RA 3A79B 1OOKG 5B0NA 1O6TA 5AWAA 3M18A 4QC0A 4CP6A 1DCEA 2P1PB 1O6SA 3ULAA 4RWTC 3W3NA 4Q62A 4BSSA 3OJAA 2Z7XB 4LSAA 4CC4A 1M9SA 3P72A 1M9LA 4LSXA 3OGKB 2JE0A 4KNGA 5IJCA 3WPGA 1SQ0B 5LFNA 4CNMA 4U08A 4C2AB 2OMWA 4ARNA 4M7EA 5IJDA 4V2EA 3REZA 4LXSA 1KOHA 4BSRA 4NKGA 3E2JA 3ZYJA 2RA8A 4FDWA 2Z81A 4R09A 3W3LA 2WFHA 3G04C 3O53A 2V70A 2Z82A 2OMTA 4V2DA 4GLPA 4Y61B 4C2BB 4ECNA 4ARRA 1DS9A 1P8TA 4WP6A 2WQVA 3WPBA 4Q3IA 5HDHA 2RR6A 3W3MA 4R5CA 2O6QA 1H6TA 1KOOA 2BNHA 5GMGA 2OMXA 3W3GA 4R6JA 2UZYA 2WQWA 2XOTA 3DZEA 3RGXA 3UN9A 4KT1A 5AWBA 1Z7XW 3RFSA 5A5CA 4B8CD 3ULVA 4QXEA 4R6AA 4CNCA 4NZTM 1M0ZA 4LSCA 3KJ4A 5GQRK 4Q3GA 3M19A 4AY9X 2OMVA 2Z7XA 3VQ2A 1YRGA 3GOZA 2Z64A 1JL5A 3G06A 2Z66A 2ELLA 1WWLA 3WPIA 3RJ0A 1W8AA 4IM6A 3E3ZA 4MQWX 3UL8A 1M10B 4MN8B 5CMNA 5GS2B 4R07A 4PSJA 2V9SA 3RFJA 1A9NA 4R6FA 3C6PB 1K5DC 3RGZA 4Z8GA 3ULUA 3G3AA 1D0BA 2R9UA 2WQUA 4RCAB 4L3AA 4FHOA 4PKIG 4R5DA 1G9UA 4XOSA 3OJAB 2P1OB 4PERA 3ZYIA 4RCWA 3WPDA 1K5GC 5FTTB 5AZ5A 1XWDC 5AWCA 4H09A 4HQ1A 2JE1A 1XEUA 3RIZA
chains in the Genus database with same CATH topology
2CA6A 1XCDA 4LXRA 4Z64C 5GMHA 4U09A 4BV4R 1FS2A 1O6VA 1OGQA 2Z63A 1P8VA 3W3KA 3WPEA 1ZIWA 1IO0A 2JQDA 5IJBA 4QBZA 4OQTA 3UL7A 3ZYOA 4NKHA 3WPCA 3OGLB 1OZNA 2XWTC 2IFGA 4EZGA 2OMYA 4L3FA 4U06A 2ASTB 2Z65A 3JB9j 4XGOA 1OTNA 1DFJI 1H6UA 2ID5A 4P8SA 4K17A 4GT6A 3RW7A 5B0TA 3BZ5A 4PQ8A 4FD0A 3UL9A 3E6JA 3VQ1A 4BSUA 2ASSB 3OGMB 2UZXA 3PMHG 1A4YA 3G3BA 4LI2A 4CC4C 1QYYA 4U7LA 1OTOA 4TZHA 4J0MA 4LSXC 4R0AA 3C6OB 4FCGA 3W3JA 4I6JB 3WPFA 3O6NA 2Y5QA 5CMPA 4CILA 4WYKA 4R58A 1LTXA 4LI1A 4M7EC 4Z61C 1FQVA 1FT8A 2V9TB 3WPHA 3TSRE 2O6SA 2OMUA 3CIYA 4AW4A 5B4PA 1GWBA 4J4LA 4Z79A 5GS0A 3WN4A 1OTMA 2OMZA 1FO1A 5HZLB 1XECA 3CIGA 2FT3A 3ZYNA 2P1QB 2BEXA 5IYXC 4R6GA 2P1NB 2A0ZA 4R08A 1XKUA 3SB4A 4PEQB 2Z62A 4ECOA 4YEBB 3FXIA 4P91A 3RW6A 3G39A 4Z94G 3RFEA 1U0ND 2P1MB 3CVRA 1P9AG 2WQXA 4UFRA 4G8AA 2Q4GW 3C6NB 4V2CA 5GMFA 4FMZA 4KXFB 5D3IA 3E4GA 1PGVA 5AWDA 4FS7A 4XSQA 2O6RA 3A79B 1OOKG 5B0NA 1O6TA 5AWAA 3M18A 4QC0A 4CP6A 1DCEA 2P1PB 1O6SA 3ULAA 4RWTC 3W3NA 4Q62A 4BSSA 3OJAA 2Z7XB 4LSAA 4CC4A 1M9SA 3P72A 1M9LA 4LSXA 3OGKB 2JE0A 4KNGA 5IJCA 3WPGA 1SQ0B 5LFNA 4CNMA 4U08A 4C2AB 2OMWA 4ARNA 4M7EA 5IJDA 4V2EA 3REZA 4LXSA 1KOHA 4BSRA 4NKGA 3E2JA 3ZYJA 2RA8A 4FDWA 2Z81A 4R09A 3W3LA 2WFHA 3G04C 3O53A 2V70A 2Z82A 2OMTA 4V2DA 4GLPA 4Y61B 4C2BB 4ECNA 4ARRA 1DS9A 1P8TA 4WP6A 2WQVA 3WPBA 4Q3IA 5HDHA 2RR6A 3W3MA 4R5CA 2O6QA 1H6TA 1KOOA 2BNHA 5GMGA 2OMXA 3W3GA 4R6JA 2UZYA 2WQWA 2XOTA 3DZEA 3RGXA 3UN9A 4KT1A 5AWBA 1Z7XW 3RFSA 5A5CA 4B8CD 3ULVA 4QXEA 4R6AA 4CNCA 1M0ZA 4LSCA 3KJ4A 5GQRK 4Q3GA 3M19A 4AY9X 2OMVA 2Z7XA 3VQ2A 1YRGA 3GOZA 2Z64A 1JL5A 3G06A 2Z66A 2ELLA 1WWLA 3WPIA 3RJ0A 1W8AA 4IM6A 3E3ZA 4MQWX 3UL8A 1M10B 4MN8B 5CMNA 5GS2B 4R07A 4PSJA 2V9SA 3RFJA 1A9NA 4R6FA 3C6PB 1K5DC 3RGZA 4Z8GA 3ULUA 3G3AA 1D0BA 2R9UA 2WQUA 4RCAB 4L3AA 4FHOA 4PKIG 4R5DA 1G9UA 4XOSA 3OJAB 2P1OB 4PERA 3ZYIA 4RCWA 3WPDA 1K5GC 5FTTB 5AZ5A 1XWDC 5AWCA 4H09A 4HQ1A 2JE1A 1XEUA 3RIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA6 A;  1XCD A;  4LXR A;  4Z64 C;  5GMH A;  4U09 A;  4BV4 R;  1FS2 A;  1O6V A;  1OGQ A;  2Z63 A;  1P8V A;  3W3K A;  3WPE A;  1ZIW A;  1IO0 A;  2JQD A;  5IJB A;  4QBZ A;  4OQT A;  3UL7 A;  3ZYO A;  4NKH A;  3WPC A;  3OGL B;  1OZN A;  2XWT C;  2IFG A;  4EZG A;  2OMY A;  4L3F A;  4U06 A;  2AST B;  2Z65 A;  3JB9 j;  4XGO A;  1OTN A;  1DFJ I;  1H6U A;  2ID5 A;  4P8S A;  4K17 A;  4GT6 A;  3RW7 A;  5B0T A;  3BZ5 A;  4PQ8 A;  4FD0 A;  3UL9 A;  3E6J A;  3VQ1 A;  4BSU A;  2ASS B;  3OGM B;  2UZX A;  3PMH G;  1A4Y A;  3G3B A;  4LI2 A;  4CC4 C;  1QYY A;  4U7L A;  1OTO A;  4TZH A;  4J0M A;  4LSX C;  4R0A A;  3C6O B;  4FCG A;  3W3J A;  4I6J B;  3WPF A;  3O6N A;  2Y5Q A;  5CMP A;  4CIL A;  4WYK A;  4R58 A;  1LTX A;  4LI1 A;  4M7E C;  4Z61 C;  1FQV A;  1FT8 A;  2V9T B;  3WPH A;  3TSR E;  2O6S A;  2OMU A;  3CIY A;  4AW4 A;  5B4P A;  1GWB A;  4J4L A;  4Z79 A;  5GS0 A;  3WN4 A;  1OTM A;  2OMZ A;  1FO1 A;  5HZL B;  1XEC A;  3CIG A;  2FT3 A;  3ZYN A;  2P1Q B;  2BEX A;  5IYX C;  4R6G A;  2P1N B;  2A0Z A;  4R08 A;  1XKU A;  3SB4 A;  4PEQ B;  2Z62 A;  4ECO A;  4YEB B;  3FXI A;  4P91 A;  3RW6 A;  3G39 A;  4Z94 G;  3RFE A;  1U0N D;  2P1M B;  3CVR A;  1P9A G;  2WQX A;  4UFR A;  4G8A A;  2Q4G W;  3C6N B;  4V2C A;  5GMF A;  4FMZ A;  4KXF B;  5D3I A;  3E4G A;  1PGV A;  5AWD A;  4FS7 A;  4XSQ A;  2O6R A;  3A79 B;  1OOK G;  5B0N A;  1O6T A;  5AWA A;  3M18 A;  4QC0 A;  4CP6 A;  1DCE A;  2P1P B;  1O6S A;  3ULA A;  4RWT C;  3W3N A;  4Q62 A;  4BSS A;  3OJA A;  2Z7X B;  4LSA A;  4CC4 A;  1M9S A;  3P72 A;  1M9L A;  4LSX A;  3OGK B;  2JE0 A;  4KNG A;  5IJC A;  3WPG A;  1SQ0 B;  5LFN A;  4CNM A;  4U08 A;  4C2A B;  2OMW A;  4ARN A;  4M7E A;  5IJD A;  4V2E A;  3REZ A;  4LXS A;  1KOH A;  4BSR A;  4NKG A;  3E2J A;  3ZYJ A;  2RA8 A;  4FDW A;  2Z81 A;  4R09 A;  3W3L A;  2WFH A;  3G04 C;  3O53 A;  2V70 A;  2Z82 A;  2OMT A;  4V2D A;  4GLP A;  4Y61 B;  4C2B B;  4ECN A;  4ARR A;  1DS9 A;  1P8T A;  4WP6 A;  2WQV A;  3WPB A;  4Q3I A;  5HDH A;  2RR6 A;  3W3M A;  4R5C A;  2O6Q A;  1H6T A;  1KOO A;  2BNH A;  5GMG A;  2OMX A;  3W3G A;  4R6J A;  2UZY A;  2WQW A;  2XOT A;  3DZE A;  3RGX A;  3UN9 A;  4KT1 A;  5AWB A;  1Z7X W;  3RFS A;  5A5C A;  4B8C D;  3ULV A;  4QXE A;  4R6A A;  4CNC A;  1M0Z A;  4LSC A;  3KJ4 A;  5GQR K;  4Q3G A;  3M19 A;  4AY9 X;  2OMV A;  2Z7X A;  3VQ2 A;  1YRG A;  3GOZ A;  2Z64 A;  1JL5 A;  3G06 A;  2Z66 A;  2ELL A;  1WWL A;  3WPI A;  3RJ0 A;  1W8A A;  4IM6 A;  3E3Z A;  4MQW X;  3UL8 A;  1M10 B;  4MN8 B;  5CMN A;  5GS2 B;  4R07 A;  4PSJ A;  2V9S A;  3RFJ A;  1A9N A;  4R6F A;  3C6P B;  1K5D C;  3RGZ A;  4Z8G A;  3ULU A;  3G3A A;  1D0B A;  2R9U A;  2WQU A;  4RCA B;  4L3A A;  4FHO A;  4PKI G;  4R5D A;  1G9U A;  4XOS A;  3OJA B;  2P1O B;  4PER A;  3ZYI A;  4RCW A;  3WPD A;  1K5G C;  5FTT B;  5AZ5 A;  1XWD C;  5AWC A;  4H09 A;  4HQ1 A;  2JE1 A;  1XEU A;  3RIZ A; 
#chains in the Genus database with same CATH topology
 2CA6 A;  1XCD A;  4LXR A;  4Z64 C;  5GMH A;  4U09 A;  4BV4 R;  1FS2 A;  1O6V A;  1OGQ A;  2Z63 A;  1P8V A;  3W3K A;  3WPE A;  1ZIW A;  1IO0 A;  2JQD A;  5IJB A;  4QBZ A;  4OQT A;  3UL7 A;  3ZYO A;  4NKH A;  3WPC A;  3OGL B;  1OZN A;  2XWT C;  2IFG A;  4EZG A;  2OMY A;  4L3F A;  4NZR M;  4U06 A;  2AST B;  2Z65 A;  3JB9 j;  4XGO A;  1OTN A;  1DFJ I;  1H6U A;  2ID5 A;  4P8S A;  4K17 A;  4GT6 A;  3RW7 A;  5B0T A;  3BZ5 A;  4PQ8 A;  4FD0 A;  3UL9 A;  3E6J A;  3VQ1 A;  4BSU A;  2ASS B;  3OGM B;  2UZX A;  3PMH G;  1A4Y A;  3G3B A;  4LI2 A;  4CC4 C;  1QYY A;  4U7L A;  1OTO A;  4TZH A;  4J0M A;  4LSX C;  4R0A A;  3C6O B;  4FCG A;  3W3J A;  4I6J B;  3WPF A;  3O6N A;  2Y5Q A;  5CMP A;  4CIL A;  4WYK A;  4R58 A;  1LTX A;  4LI1 A;  4M7E C;  4Z61 C;  1FQV A;  1FT8 A;  2V9T B;  3WPH A;  3TSR E;  2O6S A;  2OMU A;  3CIY A;  4AW4 A;  5B4P A;  1GWB A;  4J4L A;  4Z79 A;  5GS0 A;  3WN4 A;  1OTM A;  2OMZ A;  1FO1 A;  5HZL B;  1XEC A;  3CIG A;  2FT3 A;  3ZYN A;  2P1Q B;  2BEX A;  5IYX C;  4R6G A;  2P1N B;  2A0Z A;  4R08 A;  1XKU A;  3SB4 A;  4PEQ B;  2Z62 A;  4ECO A;  4YEB B;  3FXI A;  4P91 A;  3RW6 A;  3G39 A;  4Z94 G;  3RFE A;  1U0N D;  2P1M B;  3CVR A;  1P9A G;  2WQX A;  4UFR A;  4G8A A;  2Q4G W;  3C6N B;  4V2C A;  5GMF A;  4FMZ A;  4KXF B;  5D3I A;  3E4G A;  1PGV A;  5AWD A;  4FS7 A;  4XSQ A;  2O6R A;  3A79 B;  1OOK G;  5B0N A;  1O6T A;  5AWA A;  3M18 A;  4QC0 A;  4CP6 A;  1DCE A;  2P1P B;  1O6S A;  3ULA A;  4RWT C;  3W3N A;  4Q62 A;  4BSS A;  3OJA A;  2Z7X B;  4LSA A;  4CC4 A;  1M9S A;  3P72 A;  1M9L A;  4LSX A;  3OGK B;  2JE0 A;  4KNG A;  5IJC A;  3WPG A;  1SQ0 B;  5LFN A;  4CNM A;  4U08 A;  4C2A B;  2OMW A;  4ARN A;  4M7E A;  5IJD A;  4V2E A;  3REZ A;  4LXS A;  1KOH A;  4BSR A;  4NKG A;  3E2J A;  3ZYJ A;  2RA8 A;  4FDW A;  2Z81 A;  4R09 A;  3W3L A;  2WFH A;  3G04 C;  3O53 A;  2V70 A;  2Z82 A;  2OMT A;  4V2D A;  4GLP A;  4Y61 B;  4C2B B;  4ECN A;  4ARR A;  1DS9 A;  1P8T A;  4WP6 A;  2WQV A;  3WPB A;  4Q3I A;  5HDH A;  2RR6 A;  3W3M A;  4R5C A;  2O6Q A;  1H6T A;  1KOO A;  2BNH A;  5GMG A;  2OMX A;  3W3G A;  4R6J A;  2UZY A;  2WQW A;  2XOT A;  3DZE A;  3RGX A;  3UN9 A;  4KT1 A;  5AWB A;  1Z7X W;  3RFS A;  5A5C A;  4B8C D;  3ULV A;  4QXE A;  4R6A A;  4CNC A;  4NZT M;  1M0Z A;  4LSC A;  3KJ4 A;  5GQR K;  4Q3G A;  3M19 A;  4AY9 X;  2OMV A;  2Z7X A;  3VQ2 A;  1YRG A;  3GOZ A;  2Z64 A;  1JL5 A;  3G06 A;  2Z66 A;  2ELL A;  1WWL A;  3WPI A;  3RJ0 A;  1W8A A;  4IM6 A;  3E3Z A;  4MQW X;  3UL8 A;  1M10 B;  4MN8 B;  5CMN A;  5GS2 B;  4R07 A;  4PSJ A;  2V9S A;  3RFJ A;  1A9N A;  4R6F A;  3C6P B;  1K5D C;  3RGZ A;  4Z8G A;  3ULU A;  3G3A A;  1D0B A;  2R9U A;  2WQU A;  4RCA B;  4L3A A;  4FHO A;  4PKI G;  4R5D A;  1G9U A;  4XOS A;  3OJA B;  2P1O B;  4PER A;  3ZYI A;  4RCW A;  3WPD A;  1K5G C;  5FTT B;  5AZ5 A;  1XWD C;  5AWC A;  4H09 A;  4HQ1 A;  2JE1 A;  1XEU A;  3RIZ A; 
#chains in the Genus database with same CATH homology
 2CA6 A;  1XCD A;  4LXR A;  4Z64 C;  5GMH A;  4U09 A;  4BV4 R;  1FS2 A;  1O6V A;  1OGQ A;  2Z63 A;  1P8V A;  3W3K A;  3WPE A;  1ZIW A;  1IO0 A;  2JQD A;  5IJB A;  4QBZ A;  4OQT A;  3UL7 A;  3ZYO A;  4NKH A;  3WPC A;  3OGL B;  1OZN A;  2XWT C;  2IFG A;  4EZG A;  2OMY A;  4L3F A;  4U06 A;  2AST B;  2Z65 A;  3JB9 j;  4XGO A;  1OTN A;  1DFJ I;  1H6U A;  2ID5 A;  4P8S A;  4K17 A;  4GT6 A;  3RW7 A;  5B0T A;  3BZ5 A;  4PQ8 A;  4FD0 A;  3UL9 A;  3E6J A;  3VQ1 A;  4BSU A;  2ASS B;  3OGM B;  2UZX A;  3PMH G;  1A4Y A;  3G3B A;  4LI2 A;  4CC4 C;  1QYY A;  4U7L A;  1OTO A;  4TZH A;  4J0M A;  4LSX C;  4R0A A;  3C6O B;  4FCG A;  3W3J A;  4I6J B;  3WPF A;  3O6N A;  2Y5Q A;  5CMP A;  4CIL A;  4WYK A;  4R58 A;  1LTX A;  4LI1 A;  4M7E C;  4Z61 C;  1FQV A;  1FT8 A;  2V9T B;  3WPH A;  3TSR E;  2O6S A;  2OMU A;  3CIY A;  4AW4 A;  5B4P A;  1GWB A;  4J4L A;  4Z79 A;  5GS0 A;  3WN4 A;  1OTM A;  2OMZ A;  1FO1 A;  5HZL B;  1XEC A;  3CIG A;  2FT3 A;  3ZYN A;  2P1Q B;  2BEX A;  5IYX C;  4R6G A;  2P1N B;  2A0Z A;  4R08 A;  1XKU A;  3SB4 A;  4PEQ B;  2Z62 A;  4ECO A;  4YEB B;  3FXI A;  4P91 A;  3RW6 A;  3G39 A;  4Z94 G;  3RFE A;  1U0N D;  2P1M B;  3CVR A;  1P9A G;  2WQX A;  4UFR A;  4G8A A;  2Q4G W;  3C6N B;  4V2C A;  5GMF A;  4FMZ A;  4KXF B;  5D3I A;  3E4G A;  1PGV A;  5AWD A;  4FS7 A;  4XSQ A;  2O6R A;  3A79 B;  1OOK G;  5B0N A;  1O6T A;  5AWA A;  3M18 A;  4QC0 A;  4CP6 A;  1DCE A;  2P1P B;  1O6S A;  3ULA A;  4RWT C;  3W3N A;  4Q62 A;  4BSS A;  3OJA A;  2Z7X B;  4LSA A;  4CC4 A;  1M9S A;  3P72 A;  1M9L A;  4LSX A;  3OGK B;  2JE0 A;  4KNG A;  5IJC A;  3WPG A;  1SQ0 B;  5LFN A;  4CNM A;  4U08 A;  4C2A B;  2OMW A;  4ARN A;  4M7E A;  5IJD A;  4V2E A;  3REZ A;  4LXS A;  1KOH A;  4BSR A;  4NKG A;  3E2J A;  3ZYJ A;  2RA8 A;  4FDW A;  2Z81 A;  4R09 A;  3W3L A;  2WFH A;  3G04 C;  3O53 A;  2V70 A;  2Z82 A;  2OMT A;  4V2D A;  4GLP A;  4Y61 B;  4C2B B;  4ECN A;  4ARR A;  1DS9 A;  1P8T A;  4WP6 A;  2WQV A;  3WPB A;  4Q3I A;  5HDH A;  2RR6 A;  3W3M A;  4R5C A;  2O6Q A;  1H6T A;  1KOO A;  2BNH A;  5GMG A;  2OMX A;  3W3G A;  4R6J A;  2UZY A;  2WQW A;  2XOT A;  3DZE A;  3RGX A;  3UN9 A;  4KT1 A;  5AWB A;  1Z7X W;  3RFS A;  5A5C A;  4B8C D;  3ULV A;  4QXE A;  4R6A A;  4CNC A;  1M0Z A;  4LSC A;  3KJ4 A;  5GQR K;  4Q3G A;  3M19 A;  4AY9 X;  2OMV A;  2Z7X A;  3VQ2 A;  1YRG A;  3GOZ A;  2Z64 A;  1JL5 A;  3G06 A;  2Z66 A;  2ELL A;  1WWL A;  3WPI A;  3RJ0 A;  1W8A A;  4IM6 A;  3E3Z A;  4MQW X;  3UL8 A;  1M10 B;  4MN8 B;  5CMN A;  5GS2 B;  4R07 A;  4PSJ A;  2V9S A;  3RFJ A;  1A9N A;  4R6F A;  3C6P B;  1K5D C;  3RGZ A;  4Z8G A;  3ULU A;  3G3A A;  1D0B A;  2R9U A;  2WQU A;  4RCA B;  4L3A A;  4FHO A;  4PKI G;  4R5D A;  1G9U A;  4XOS A;  3OJA B;  2P1O B;  4PER A;  3ZYI A;  4RCW A;  3WPD A;  1K5G C;  5FTT B;  5AZ5 A;  1XWD C;  5AWC A;  4H09 A;  4HQ1 A;  2JE1 A;  1XEU A;  3RIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...