5GS2B

Crystal structure of diabody complex with repebody and mbp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
268
structure length
268
Chain Sequence
TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLYLYHNQLQSLPKGVFDKLTNLTRLDLDNNQLQSLPEGVFDKLTQLKQLSLNDNQLKSVPDGVFDRLTSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 70
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gs2B00
2WQWA 4ECOA 4LXRA 2ID5A 1DCEA 4Q3GA 1WWLA 4P8SA 3A79B 4LSXA 4FMZA 3CVRA 3O6NA 1ZIWA 2P1OB 5CMNA 2Y5QA 4P91A 4FCGA 3RIZA 1FO1A 4UFRA 1P8TA 3E3ZA 4R6JA 1FS2A 5GMFA 3OGLB 3UN9A 4HQ1A 4QXEA 4PEQB 3G3BA 4R6GA 3VQ2A 3E6JA 1QYYA 4V2DA 1PGVA 2BNHA 5GMHA 4OQTA 4TZHA 1M0ZA 5AWAA 1O6SA 2OMTA 2A0ZA 3W3JA 3WPDA 3WPEA 5AWBA 1XECA 1H6UA 1K5DC 3KJ4A 3FXIA 4L3FA 4Y61B 3OGMB 3RFJA 3E4GA 3P72A 4GLPA 3CIYA 5B0TA 4PKIG 1A9NA 3UL7A 3C6PB 1KOOA 5AWDA 3O53A 3ULAA 5IJBA 3RGXA 4PSJA 4AW4A 3WPBA 4MQWX 1Z7XW 4FHOA 4EZGA 4R6AA 3CIGA 3OJAA 2Z7XA 4C2AB 3ULVA 3W3GA 4CP6A 2Z82A 1W8AA 3C6NB 3OGKB 4NKHA 1IO0A 4M7EA 1P8VA 4R6FA 3DZEA 1LTXA 1OTNA 3UL9A 4Z79A 5D3IA 1GWBA 1M9LA 2Z62A 1DFJI 1XCDA 2P1QB 4BSRA 1P9AG 3E2JA 5LFNA 4LSXC 4ECNA 4CC4C 4R0AA 4RCWA 4V2CA 1O6TA 3M19A 1O6VA 4GT6A 4PERA 1M9SA 4MN8B 2Z63A 4K17A 4Z8GA 4I6JB 2CA6A 4KXFB 2OMVA 4U7LA 3ZYIA 1K5GC 4U06A 3G39A 4XSQA 3W3NA 2P1PB 4LXSA 3VQ1A 4LSCA 3W3LA 2V9SA 4R5DA 2UZYA 3RW7A 1XWDC 2XOTA 5HDHA 3RJ0A 3WPIA 4XGOA 4Z64C 4BSSA 2OMWA 4Z61C 1DS9A 2WQUA 1SQ0B 2JE0A 2V70A 1OGQA 2P1NB 1G9UA 5HZLB 4BSUA 5B0NA 4U09A 1OTOA 4NKGA 4QC0A 2WFHA 4Q3IA 5IYXC 4R58A 3M18A 1A4YA 3ULUA 4R5CA 4LI1A 3G3AA 4R08A 3RFEA 2O6QA 2Z81A 3RW6A 3G06A 5CMPA 4B8CD 4KT1A 3W3KA 4V2EA 2OMZA 2Q4GW 3BZ5A 3WPGA 4Z94G 1OTMA 3G04C 3RFSA 1U0ND 4G8AA 4CILA 4L3AA 5AZ5A 3WPFA 2WQXA 4J4LA 5B4PA 3ZYNA 3OJAB 2O6SA 2Z7XB 2WQVA 4KNGA 4FDWA 4WYKA 4XOSA 4IM6A 4CC4A 2Z64A 3ZYOA 1JL5A 5IJDA 2JQDA 2RR6A 3GOZA 4J0MA 3W3MA 1XKUA 4C2BB 1OOKG 2R9UA 1KOHA 4FD0A 2V9TB 5GS0A 2XWTC 4RWTC 2BEXA 2OMUA 4ARNA 4R09A 4M7EC 5A5CA 4U08A 2O6RA 2ASTB 4PQ8A 5FTTB 4ARRA 2ELLA 2OMYA 4H09A 4BV4R 2IFGA 1XEUA 2UZXA 4LSAA 5AWCA 1FQVA 4R07A 5GS2B 2JE1A 2RA8A 3REZA 3RGZA 3ZYJA 5GQRK 4CNCA 1H6TA 4QBZA 2FT3A 3WPCA 4FS7A 1FT8A 4YEBB 1D0BA 3WPHA 2OMXA 2Z65A 5GMGA 3C6OB 2Z66A 4RCAB 2P1MB 4Q62A 1OZNA 5IJCA 3PMHG 3WN4A 3SB4A 1YRGA 4WP6A 4CNMA 3UL8A 3JB9j 3TSRE 4LI2A 4AY9X 2ASSB 1M10B
chains in the Genus database with same CATH superfamily
2WQWA 4ECOA 4LXRA 2ID5A 1DCEA 4Q3GA 1WWLA 4P8SA 3A79B 4LSXA 4FMZA 3CVRA 3O6NA 1ZIWA 2P1OB 5CMNA 2Y5QA 4P91A 4FCGA 3RIZA 1FO1A 4UFRA 1P8TA 3E3ZA 4R6JA 1FS2A 5GMFA 3OGLB 3UN9A 4HQ1A 4QXEA 4PEQB 4NZTM 3G3BA 4R6GA 3VQ2A 3E6JA 1QYYA 4V2DA 1PGVA 2BNHA 5GMHA 4OQTA 4TZHA 1M0ZA 5AWAA 1O6SA 2OMTA 2A0ZA 3W3JA 3WPDA 3WPEA 5AWBA 1XECA 1H6UA 1K5DC 3KJ4A 3FXIA 4L3FA 4Y61B 3OGMB 3RFJA 3E4GA 3P72A 4GLPA 3CIYA 5B0TA 4PKIG 1A9NA 3UL7A 3C6PB 1KOOA 5AWDA 3O53A 3ULAA 5IJBA 3RGXA 4PSJA 4AW4A 3WPBA 4MQWX 1Z7XW 4FHOA 4EZGA 4R6AA 3CIGA 3OJAA 2Z7XA 4C2AB 3ULVA 3W3GA 4CP6A 2Z82A 1W8AA 3C6NB 3OGKB 4NKHA 1IO0A 4M7EA 1P8VA 4R6FA 3DZEA 1LTXA 1OTNA 3UL9A 4Z79A 5D3IA 1GWBA 1M9LA 2Z62A 1DFJI 1XCDA 2P1QB 4BSRA 1P9AG 3E2JA 5LFNA 4LSXC 4ECNA 4CC4C 4R0AA 4RCWA 4V2CA 1O6TA 3M19A 1O6VA 4GT6A 4PERA 1M9SA 4MN8B 2Z63A 4K17A 4Z8GA 4I6JB 2CA6A 4KXFB 2OMVA 4U7LA 3ZYIA 1K5GC 4U06A 3G39A 4XSQA 3W3NA 2P1PB 4LXSA 3VQ1A 4LSCA 3W3LA 2V9SA 4R5DA 2UZYA 3RW7A 1XWDC 2XOTA 5HDHA 3RJ0A 3WPIA 4XGOA 4Z64C 4BSSA 2OMWA 4Z61C 1DS9A 2WQUA 1SQ0B 2JE0A 2V70A 1OGQA 2P1NB 1G9UA 5HZLB 4BSUA 5B0NA 4U09A 1OTOA 4NKGA 4QC0A 2WFHA 4Q3IA 5IYXC 4R58A 3M18A 1A4YA 3ULUA 4R5CA 4LI1A 3G3AA 4NZRM 3RFEA 4R08A 2O6QA 2Z81A 3RW6A 3G06A 5CMPA 4B8CD 4KT1A 3W3KA 4V2EA 2OMZA 2Q4GW 3BZ5A 3WPGA 4Z94G 1OTMA 3G04C 3RFSA 1U0ND 4G8AA 4CILA 4L3AA 5AZ5A 3WPFA 2WQXA 4J4LA 5B4PA 3ZYNA 3OJAB 2O6SA 2Z7XB 2WQVA 4KNGA 4FDWA 4WYKA 4XOSA 4IM6A 4CC4A 2Z64A 3ZYOA 1JL5A 5IJDA 2JQDA 2RR6A 3GOZA 4J0MA 3W3MA 1XKUA 4C2BB 1OOKG 2R9UA 1KOHA 4FD0A 2V9TB 5GS0A 2XWTC 4RWTC 2BEXA 2OMUA 4ARNA 4R09A 4M7EC 5A5CA 4U08A 2O6RA 2ASTB 4PQ8A 5FTTB 4ARRA 2ELLA 2OMYA 4H09A 4BV4R 2IFGA 1XEUA 2UZXA 4LSAA 5AWCA 1FQVA 4R07A 5GS2B 2JE1A 2RA8A 3REZA 3RGZA 3ZYJA 5GQRK 4CNCA 1H6TA 4QBZA 2FT3A 3WPCA 4FS7A 1FT8A 4YEBB 1D0BA 3WPHA 2OMXA 2Z65A 5GMGA 3C6OB 2Z66A 4RCAB 2P1MB 4Q62A 1OZNA 5IJCA 3PMHG 3WN4A 3SB4A 1YRGA 4WP6A 4CNMA 3UL8A 3JB9j 3TSRE 4LI2A 4AY9X 2ASSB 1M10B
chains in the Genus database with same CATH topology
2WQWA 4ECOA 4LXRA 2ID5A 1DCEA 4Q3GA 1WWLA 4P8SA 3A79B 4LSXA 4FMZA 3CVRA 3O6NA 1ZIWA 2P1OB 5CMNA 2Y5QA 4P91A 4FCGA 3RIZA 1FO1A 4UFRA 1P8TA 3E3ZA 4R6JA 1FS2A 5GMFA 3OGLB 3UN9A 4HQ1A 4QXEA 4PEQB 3G3BA 4R6GA 3VQ2A 3E6JA 1QYYA 4V2DA 1PGVA 2BNHA 5GMHA 4OQTA 4TZHA 1M0ZA 5AWAA 1O6SA 2OMTA 2A0ZA 3W3JA 3WPDA 3WPEA 5AWBA 1XECA 1H6UA 1K5DC 3KJ4A 3FXIA 4L3FA 4Y61B 3OGMB 3RFJA 3E4GA 3P72A 4GLPA 3CIYA 5B0TA 4PKIG 1A9NA 3UL7A 3C6PB 1KOOA 5AWDA 3O53A 3ULAA 5IJBA 3RGXA 4PSJA 4AW4A 3WPBA 4MQWX 1Z7XW 4FHOA 4EZGA 4R6AA 3CIGA 3OJAA 2Z7XA 4C2AB 3ULVA 3W3GA 4CP6A 2Z82A 1W8AA 3C6NB 3OGKB 4NKHA 1IO0A 4M7EA 1P8VA 4R6FA 3DZEA 1LTXA 1OTNA 3UL9A 4Z79A 5D3IA 1GWBA 1M9LA 2Z62A 1DFJI 1XCDA 2P1QB 4BSRA 1P9AG 3E2JA 5LFNA 4LSXC 4ECNA 4CC4C 4R0AA 4RCWA 4V2CA 1O6TA 3M19A 1O6VA 4GT6A 4PERA 1M9SA 4MN8B 2Z63A 4K17A 4Z8GA 4I6JB 2CA6A 4KXFB 2OMVA 4U7LA 3ZYIA 1K5GC 4U06A 3G39A 4XSQA 3W3NA 2P1PB 4LXSA 3VQ1A 4LSCA 3W3LA 2V9SA 4R5DA 2UZYA 3RW7A 1XWDC 2XOTA 5HDHA 3RJ0A 3WPIA 4XGOA 4Z64C 4BSSA 2OMWA 4Z61C 1DS9A 2WQUA 1SQ0B 2JE0A 2V70A 1OGQA 2P1NB 1G9UA 5HZLB 4BSUA 5B0NA 4U09A 1OTOA 4NKGA 4QC0A 2WFHA 4Q3IA 5IYXC 4R58A 3M18A 1A4YA 3ULUA 4R5CA 4LI1A 3G3AA 4R08A 3RFEA 2O6QA 2Z81A 3RW6A 3G06A 5CMPA 4B8CD 4KT1A 3W3KA 4V2EA 2OMZA 2Q4GW 3BZ5A 3WPGA 4Z94G 1OTMA 3G04C 3RFSA 1U0ND 4G8AA 4CILA 4L3AA 5AZ5A 3WPFA 2WQXA 4J4LA 5B4PA 3ZYNA 3OJAB 2O6SA 2Z7XB 2WQVA 4KNGA 4FDWA 4WYKA 4XOSA 4IM6A 4CC4A 2Z64A 3ZYOA 1JL5A 5IJDA 2JQDA 2RR6A 3GOZA 4J0MA 3W3MA 1XKUA 4C2BB 1OOKG 2R9UA 1KOHA 4FD0A 2V9TB 5GS0A 2XWTC 4RWTC 2BEXA 2OMUA 4ARNA 4R09A 4M7EC 5A5CA 4U08A 2O6RA 2ASTB 4PQ8A 5FTTB 4ARRA 2ELLA 2OMYA 4H09A 4BV4R 2IFGA 1XEUA 2UZXA 4LSAA 5AWCA 1FQVA 4R07A 5GS2B 2JE1A 2RA8A 3REZA 3RGZA 3ZYJA 5GQRK 4CNCA 1H6TA 4QBZA 2FT3A 3WPCA 4FS7A 1FT8A 4YEBB 1D0BA 3WPHA 2OMXA 2Z65A 5GMGA 3C6OB 2Z66A 4RCAB 2P1MB 4Q62A 1OZNA 5IJCA 3PMHG 3WN4A 3SB4A 1YRGA 4WP6A 4CNMA 3UL8A 3JB9j 3TSRE 4LI2A 4AY9X 2ASSB 1M10B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQW A;  4ECO A;  4LXR A;  2ID5 A;  1DCE A;  4Q3G A;  1WWL A;  4P8S A;  3A79 B;  4LSX A;  4FMZ A;  3CVR A;  3O6N A;  1ZIW A;  2P1O B;  5CMN A;  2Y5Q A;  4P91 A;  4FCG A;  3RIZ A;  1FO1 A;  4UFR A;  1P8T A;  3E3Z A;  4R6J A;  1FS2 A;  5GMF A;  3OGL B;  3UN9 A;  4HQ1 A;  4QXE A;  4PEQ B;  3G3B A;  4R6G A;  3VQ2 A;  3E6J A;  1QYY A;  4V2D A;  1PGV A;  2BNH A;  5GMH A;  4OQT A;  4TZH A;  1M0Z A;  5AWA A;  1O6S A;  2OMT A;  2A0Z A;  3W3J A;  3WPD A;  3WPE A;  5AWB A;  1XEC A;  1H6U A;  1K5D C;  3KJ4 A;  3FXI A;  4L3F A;  4Y61 B;  3OGM B;  3RFJ A;  3E4G A;  3P72 A;  4GLP A;  3CIY A;  5B0T A;  4PKI G;  1A9N A;  3UL7 A;  3C6P B;  1KOO A;  5AWD A;  3O53 A;  3ULA A;  5IJB A;  3RGX A;  4PSJ A;  4AW4 A;  3WPB A;  4MQW X;  1Z7X W;  4FHO A;  4EZG A;  4R6A A;  3CIG A;  3OJA A;  2Z7X A;  4C2A B;  3ULV A;  3W3G A;  4CP6 A;  2Z82 A;  1W8A A;  3C6N B;  3OGK B;  4NKH A;  1IO0 A;  4M7E A;  1P8V A;  4R6F A;  3DZE A;  1LTX A;  1OTN A;  3UL9 A;  4Z79 A;  5D3I A;  1GWB A;  1M9L A;  2Z62 A;  1DFJ I;  1XCD A;  2P1Q B;  4BSR A;  1P9A G;  3E2J A;  5LFN A;  4LSX C;  4ECN A;  4CC4 C;  4R0A A;  4RCW A;  4V2C A;  1O6T A;  3M19 A;  1O6V A;  4GT6 A;  4PER A;  1M9S A;  4MN8 B;  2Z63 A;  4K17 A;  4Z8G A;  4I6J B;  2CA6 A;  4KXF B;  2OMV A;  4U7L A;  3ZYI A;  1K5G C;  4U06 A;  3G39 A;  4XSQ A;  3W3N A;  2P1P B;  4LXS A;  3VQ1 A;  4LSC A;  3W3L A;  2V9S A;  4R5D A;  2UZY A;  3RW7 A;  1XWD C;  2XOT A;  5HDH A;  3RJ0 A;  3WPI A;  4XGO A;  4Z64 C;  4BSS A;  2OMW A;  4Z61 C;  1DS9 A;  2WQU A;  1SQ0 B;  2JE0 A;  2V70 A;  1OGQ A;  2P1N B;  1G9U A;  5HZL B;  4BSU A;  5B0N A;  4U09 A;  1OTO A;  4NKG A;  4QC0 A;  2WFH A;  4Q3I A;  5IYX C;  4R58 A;  3M18 A;  1A4Y A;  3ULU A;  4R5C A;  4LI1 A;  3G3A A;  4R08 A;  3RFE A;  2O6Q A;  2Z81 A;  3RW6 A;  3G06 A;  5CMP A;  4B8C D;  4KT1 A;  3W3K A;  4V2E A;  2OMZ A;  2Q4G W;  3BZ5 A;  3WPG A;  4Z94 G;  1OTM A;  3G04 C;  3RFS A;  1U0N D;  4G8A A;  4CIL A;  4L3A A;  5AZ5 A;  3WPF A;  2WQX A;  4J4L A;  5B4P A;  3ZYN A;  3OJA B;  2O6S A;  2Z7X B;  2WQV A;  4KNG A;  4FDW A;  4WYK A;  4XOS A;  4IM6 A;  4CC4 A;  2Z64 A;  3ZYO A;  1JL5 A;  5IJD A;  2JQD A;  2RR6 A;  3GOZ A;  4J0M A;  3W3M A;  1XKU A;  4C2B B;  1OOK G;  2R9U A;  1KOH A;  4FD0 A;  2V9T B;  5GS0 A;  2XWT C;  4RWT C;  2BEX A;  2OMU A;  4ARN A;  4R09 A;  4M7E C;  5A5C A;  4U08 A;  2O6R A;  2AST B;  4PQ8 A;  5FTT B;  4ARR A;  2ELL A;  2OMY A;  4H09 A;  4BV4 R;  2IFG A;  1XEU A;  2UZX A;  4LSA A;  5AWC A;  1FQV A;  4R07 A;  5GS2 B;  2JE1 A;  2RA8 A;  3REZ A;  3RGZ A;  3ZYJ A;  5GQR K;  4CNC A;  1H6T A;  4QBZ A;  2FT3 A;  3WPC A;  4FS7 A;  1FT8 A;  4YEB B;  1D0B A;  3WPH A;  2OMX A;  2Z65 A;  5GMG A;  3C6O B;  2Z66 A;  4RCA B;  2P1M B;  4Q62 A;  1OZN A;  5IJC A;  3PMH G;  3WN4 A;  3SB4 A;  1YRG A;  4WP6 A;  4CNM A;  3UL8 A;  3JB9 j;  3TSR E;  4LI2 A;  4AY9 X;  2ASS B;  1M10 B; 
#chains in the Genus database with same CATH topology
 2WQW A;  4ECO A;  4LXR A;  2ID5 A;  1DCE A;  4Q3G A;  1WWL A;  4P8S A;  3A79 B;  4LSX A;  4FMZ A;  3CVR A;  3O6N A;  1ZIW A;  2P1O B;  5CMN A;  2Y5Q A;  4P91 A;  4FCG A;  3RIZ A;  1FO1 A;  4UFR A;  1P8T A;  3E3Z A;  4R6J A;  1FS2 A;  5GMF A;  3OGL B;  3UN9 A;  4HQ1 A;  4QXE A;  4PEQ B;  4NZT M;  3G3B A;  4R6G A;  3VQ2 A;  3E6J A;  1QYY A;  4V2D A;  1PGV A;  2BNH A;  5GMH A;  4OQT A;  4TZH A;  1M0Z A;  5AWA A;  1O6S A;  2OMT A;  2A0Z A;  3W3J A;  3WPD A;  3WPE A;  5AWB A;  1XEC A;  1H6U A;  1K5D C;  3KJ4 A;  3FXI A;  4L3F A;  4Y61 B;  3OGM B;  3RFJ A;  3E4G A;  3P72 A;  4GLP A;  3CIY A;  5B0T A;  4PKI G;  1A9N A;  3UL7 A;  3C6P B;  1KOO A;  5AWD A;  3O53 A;  3ULA A;  5IJB A;  3RGX A;  4PSJ A;  4AW4 A;  3WPB A;  4MQW X;  1Z7X W;  4FHO A;  4EZG A;  4R6A A;  3CIG A;  3OJA A;  2Z7X A;  4C2A B;  3ULV A;  3W3G A;  4CP6 A;  2Z82 A;  1W8A A;  3C6N B;  3OGK B;  4NKH A;  1IO0 A;  4M7E A;  1P8V A;  4R6F A;  3DZE A;  1LTX A;  1OTN A;  3UL9 A;  4Z79 A;  5D3I A;  1GWB A;  1M9L A;  2Z62 A;  1DFJ I;  1XCD A;  2P1Q B;  4BSR A;  1P9A G;  3E2J A;  5LFN A;  4LSX C;  4ECN A;  4CC4 C;  4R0A A;  4RCW A;  4V2C A;  1O6T A;  3M19 A;  1O6V A;  4GT6 A;  4PER A;  1M9S A;  4MN8 B;  2Z63 A;  4K17 A;  4Z8G A;  4I6J B;  2CA6 A;  4KXF B;  2OMV A;  4U7L A;  3ZYI A;  1K5G C;  4U06 A;  3G39 A;  4XSQ A;  3W3N A;  2P1P B;  4LXS A;  3VQ1 A;  4LSC A;  3W3L A;  2V9S A;  4R5D A;  2UZY A;  3RW7 A;  1XWD C;  2XOT A;  5HDH A;  3RJ0 A;  3WPI A;  4XGO A;  4Z64 C;  4BSS A;  2OMW A;  4Z61 C;  1DS9 A;  2WQU A;  1SQ0 B;  2JE0 A;  2V70 A;  1OGQ A;  2P1N B;  1G9U A;  5HZL B;  4BSU A;  5B0N A;  4U09 A;  1OTO A;  4NKG A;  4QC0 A;  2WFH A;  4Q3I A;  5IYX C;  4R58 A;  3M18 A;  1A4Y A;  3ULU A;  4R5C A;  4LI1 A;  3G3A A;  4NZR M;  3RFE A;  4R08 A;  2O6Q A;  2Z81 A;  3RW6 A;  3G06 A;  5CMP A;  4B8C D;  4KT1 A;  3W3K A;  4V2E A;  2OMZ A;  2Q4G W;  3BZ5 A;  3WPG A;  4Z94 G;  1OTM A;  3G04 C;  3RFS A;  1U0N D;  4G8A A;  4CIL A;  4L3A A;  5AZ5 A;  3WPF A;  2WQX A;  4J4L A;  5B4P A;  3ZYN A;  3OJA B;  2O6S A;  2Z7X B;  2WQV A;  4KNG A;  4FDW A;  4WYK A;  4XOS A;  4IM6 A;  4CC4 A;  2Z64 A;  3ZYO A;  1JL5 A;  5IJD A;  2JQD A;  2RR6 A;  3GOZ A;  4J0M A;  3W3M A;  1XKU A;  4C2B B;  1OOK G;  2R9U A;  1KOH A;  4FD0 A;  2V9T B;  5GS0 A;  2XWT C;  4RWT C;  2BEX A;  2OMU A;  4ARN A;  4R09 A;  4M7E C;  5A5C A;  4U08 A;  2O6R A;  2AST B;  4PQ8 A;  5FTT B;  4ARR A;  2ELL A;  2OMY A;  4H09 A;  4BV4 R;  2IFG A;  1XEU A;  2UZX A;  4LSA A;  5AWC A;  1FQV A;  4R07 A;  5GS2 B;  2JE1 A;  2RA8 A;  3REZ A;  3RGZ A;  3ZYJ A;  5GQR K;  4CNC A;  1H6T A;  4QBZ A;  2FT3 A;  3WPC A;  4FS7 A;  1FT8 A;  4YEB B;  1D0B A;  3WPH A;  2OMX A;  2Z65 A;  5GMG A;  3C6O B;  2Z66 A;  4RCA B;  2P1M B;  4Q62 A;  1OZN A;  5IJC A;  3PMH G;  3WN4 A;  3SB4 A;  1YRG A;  4WP6 A;  4CNM A;  3UL8 A;  3JB9 j;  3TSR E;  4LI2 A;  4AY9 X;  2ASS B;  1M10 B; 
#chains in the Genus database with same CATH homology
 2WQW A;  4ECO A;  4LXR A;  2ID5 A;  1DCE A;  4Q3G A;  1WWL A;  4P8S A;  3A79 B;  4LSX A;  4FMZ A;  3CVR A;  3O6N A;  1ZIW A;  2P1O B;  5CMN A;  2Y5Q A;  4P91 A;  4FCG A;  3RIZ A;  1FO1 A;  4UFR A;  1P8T A;  3E3Z A;  4R6J A;  1FS2 A;  5GMF A;  3OGL B;  3UN9 A;  4HQ1 A;  4QXE A;  4PEQ B;  3G3B A;  4R6G A;  3VQ2 A;  3E6J A;  1QYY A;  4V2D A;  1PGV A;  2BNH A;  5GMH A;  4OQT A;  4TZH A;  1M0Z A;  5AWA A;  1O6S A;  2OMT A;  2A0Z A;  3W3J A;  3WPD A;  3WPE A;  5AWB A;  1XEC A;  1H6U A;  1K5D C;  3KJ4 A;  3FXI A;  4L3F A;  4Y61 B;  3OGM B;  3RFJ A;  3E4G A;  3P72 A;  4GLP A;  3CIY A;  5B0T A;  4PKI G;  1A9N A;  3UL7 A;  3C6P B;  1KOO A;  5AWD A;  3O53 A;  3ULA A;  5IJB A;  3RGX A;  4PSJ A;  4AW4 A;  3WPB A;  4MQW X;  1Z7X W;  4FHO A;  4EZG A;  4R6A A;  3CIG A;  3OJA A;  2Z7X A;  4C2A B;  3ULV A;  3W3G A;  4CP6 A;  2Z82 A;  1W8A A;  3C6N B;  3OGK B;  4NKH A;  1IO0 A;  4M7E A;  1P8V A;  4R6F A;  3DZE A;  1LTX A;  1OTN A;  3UL9 A;  4Z79 A;  5D3I A;  1GWB A;  1M9L A;  2Z62 A;  1DFJ I;  1XCD A;  2P1Q B;  4BSR A;  1P9A G;  3E2J A;  5LFN A;  4LSX C;  4ECN A;  4CC4 C;  4R0A A;  4RCW A;  4V2C A;  1O6T A;  3M19 A;  1O6V A;  4GT6 A;  4PER A;  1M9S A;  4MN8 B;  2Z63 A;  4K17 A;  4Z8G A;  4I6J B;  2CA6 A;  4KXF B;  2OMV A;  4U7L A;  3ZYI A;  1K5G C;  4U06 A;  3G39 A;  4XSQ A;  3W3N A;  2P1P B;  4LXS A;  3VQ1 A;  4LSC A;  3W3L A;  2V9S A;  4R5D A;  2UZY A;  3RW7 A;  1XWD C;  2XOT A;  5HDH A;  3RJ0 A;  3WPI A;  4XGO A;  4Z64 C;  4BSS A;  2OMW A;  4Z61 C;  1DS9 A;  2WQU A;  1SQ0 B;  2JE0 A;  2V70 A;  1OGQ A;  2P1N B;  1G9U A;  5HZL B;  4BSU A;  5B0N A;  4U09 A;  1OTO A;  4NKG A;  4QC0 A;  2WFH A;  4Q3I A;  5IYX C;  4R58 A;  3M18 A;  1A4Y A;  3ULU A;  4R5C A;  4LI1 A;  3G3A A;  4R08 A;  3RFE A;  2O6Q A;  2Z81 A;  3RW6 A;  3G06 A;  5CMP A;  4B8C D;  4KT1 A;  3W3K A;  4V2E A;  2OMZ A;  2Q4G W;  3BZ5 A;  3WPG A;  4Z94 G;  1OTM A;  3G04 C;  3RFS A;  1U0N D;  4G8A A;  4CIL A;  4L3A A;  5AZ5 A;  3WPF A;  2WQX A;  4J4L A;  5B4P A;  3ZYN A;  3OJA B;  2O6S A;  2Z7X B;  2WQV A;  4KNG A;  4FDW A;  4WYK A;  4XOS A;  4IM6 A;  4CC4 A;  2Z64 A;  3ZYO A;  1JL5 A;  5IJD A;  2JQD A;  2RR6 A;  3GOZ A;  4J0M A;  3W3M A;  1XKU A;  4C2B B;  1OOK G;  2R9U A;  1KOH A;  4FD0 A;  2V9T B;  5GS0 A;  2XWT C;  4RWT C;  2BEX A;  2OMU A;  4ARN A;  4R09 A;  4M7E C;  5A5C A;  4U08 A;  2O6R A;  2AST B;  4PQ8 A;  5FTT B;  4ARR A;  2ELL A;  2OMY A;  4H09 A;  4BV4 R;  2IFG A;  1XEU A;  2UZX A;  4LSA A;  5AWC A;  1FQV A;  4R07 A;  5GS2 B;  2JE1 A;  2RA8 A;  3REZ A;  3RGZ A;  3ZYJ A;  5GQR K;  4CNC A;  1H6T A;  4QBZ A;  2FT3 A;  3WPC A;  4FS7 A;  1FT8 A;  4YEB B;  1D0B A;  3WPH A;  2OMX A;  2Z65 A;  5GMG A;  3C6O B;  2Z66 A;  4RCA B;  2P1M B;  4Q62 A;  1OZN A;  5IJC A;  3PMH G;  3WN4 A;  3SB4 A;  1YRG A;  4WP6 A;  4CNM A;  3UL8 A;  3JB9 j;  3TSR E;  4LI2 A;  4AY9 X;  2ASS B;  1M10 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...