5GS2B

Crystal structure of diabody complex with repebody and mbp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
268
structure length
268
Chain Sequence
TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLYLYHNQLQSLPKGVFDKLTNLTRLDLDNNQLQSLPEGVFDKLTQLKQLSLNDNQLKSVPDGVFDRLTSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Sugar binding protein/immune system
total genus 70
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gs2B00
1OTOA 4CNMA 2FT3A 1OZNA 2ID5A 4LI1A 3ZYNA 1KOOA 1JL5A 1P8VA 2Z62A 3FXIA 2O6RA 4XGOA 4EZGA 1XECA 1O6SA 5AWCA 4PSJA 3C6OB 4LSCA 4LSAA 1XEUA 1YRGA 4NKHA 4FHOA 1OTMA 3WPBA 4HQ1A 3O53A 2Z7XA 3G3AA 1OTNA 3UN9A 4CNCA 3UL7A 2Z66A 4U08A 2O6SA 3VQ2A 4LSXA 3C6NB 3WPGA 2OMZA 4CP6A 5A5CA 5IYXC 3WPFA 3CVRA 3RW6A 2Q4GW 2A0ZA 3C6PB 3ULUA 2WQUA 3REZA 3P72A 2JQDA 1KOHA 4Q62A 4Q3IA 4J4LA 3WPHA 4Z79A 5GS0A 4TZHA 1QYYA 2Z81A 3VQ1A 4V2CA 2JE1A 5HDHA 2UZXA 3SB4A 4UFRA 2WQVA 2Z65A 3ULVA 2Z82A 5FTTB 2V9TB 4MN8B 4V2DA 3RGXA 1H6TA 4AW4A 3G3BA 2ASSB 2WFHA 3W3JA 3G06A 3OGMB 3OGLB 4LSXC 3RGZA 3E6JA 4KT1A 3WPCA 2P1PB 4C2AB 4PERA 4H09A 3ZYJA 1M9LA 4Q3GA 1ZIWA 1DS9A 4MQWX 5HZLB 3UL8A 4G8AA 3W3GA 4LXSA 4LXRA 3E2JA 3WN4A 4KXFB 3OJAB 5AZ5A 1PGVA 1XKUA 3ULAA 1OOKG 1W8AA 2Z64A 2ASTB 4AY9X 3M19A 3OGKB 3BZ5A 4OQTA 3GOZA 5B0TA 3WPDA 3UL9A 4R6FA 1DFJI 4U09A 2OMVA 4ARRA 1XWDC 4NKGA 4CILA 4CC4C 2P1QB 4KNGA 4M7EA 4FD0A 5CMPA 2OMTA 3W3KA 5AWBA 2O6QA 4ECNA 4V2EA 4P91A 2OMYA 1U0ND 4R0AA 2RR6A 2Z63A 3A79B 4I6JB 1P9AG 4K17A 3E4GA 3OJAA 4R07A 4ECOA 2WQWA 5AWDA 1GWBA 3G39A 2P1NB 1M9SA 5B4PA 3O6NA 4R08A 4Z94G 4Z64C 3TSRE 1A4YA 4FS7A 1WWLA 1FS2A 1OGQA 5GMHA 3ZYOA 5GMGA 4WYKA 1O6VA 4IM6A 4J0MA 1DCEA 2BEXA 4L3AA 4WP6A 4Z61C 4GLPA 2P1OB 4U7LA 5IJCA 1M0ZA 4QXEA 3KJ4A 2P1MB 3PMHG 3W3LA 1K5DC 4QBZA 4C2BB 4XOSA 5GQRK 1M10B 4R5DA 3RFSA 4R6GA 4BSRA 4B8CD 4Z8GA 2V70A 3RW7A 1LTXA 3G04C 2IFGA 4LI2A 4GT6A 4R5CA 2ELLA 1IO0A 4BV4R 4PQ8A 4PKIG 3W3NA 3DZEA 2R9UA 1A9NA 2XOTA 4R6JA 4RCAB 3RJ0A 4PEQB 3RIZA 3WPEA 5IJBA 2WQXA 5D3IA 4R6AA 1D0BA 1H6UA 5B0NA 2UZYA 4FDWA 2RA8A 1P8TA 2CA6A 4R58A 5CMNA 2OMXA 4BSUA 4YEBB 1FQVA 2BNHA 1FT8A 2OMUA 4Y61B 4L3FA 3E3ZA 4RCWA 4P8SA 4BSSA 5LFNA 1SQ0B 5GMFA 5GS2B 1XCDA 2Z7XB 3JB9j 1K5GC 2V9SA 4U06A 1O6TA 3CIGA 4RWTC 4R09A 5IJDA 3WPIA 2JE0A 1G9UA 3CIYA 4XSQA 4QC0A 3M18A 3W3MA 2OMWA 4FMZA 1Z7XW 5AWAA 4FCGA 3RFEA 3RFJA 4CC4A 4M7EC 3ZYIA 2XWTC 4ARNA 2Y5QA 1FO1A
chains in the Genus database with same CATH superfamily
1OTOA 4CNMA 2FT3A 1OZNA 2ID5A 4LI1A 3ZYNA 1KOOA 1JL5A 1P8VA 2Z62A 3FXIA 2O6RA 4XGOA 4EZGA 1XECA 1O6SA 5AWCA 4PSJA 3C6OB 4LSCA 4LSAA 1XEUA 1YRGA 4NKHA 4FHOA 1OTMA 3WPBA 4HQ1A 3O53A 2Z7XA 3G3AA 1OTNA 3UN9A 4CNCA 3UL7A 2Z66A 4U08A 2O6SA 3VQ2A 4LSXA 3C6NB 3WPGA 2OMZA 4CP6A 5A5CA 5IYXC 3WPFA 3CVRA 3RW6A 2Q4GW 2A0ZA 3C6PB 3ULUA 2WQUA 3REZA 3P72A 2JQDA 1KOHA 4Q62A 4Q3IA 4J4LA 3WPHA 4Z79A 5GS0A 4TZHA 1QYYA 2Z81A 3VQ1A 4V2CA 2JE1A 5HDHA 2UZXA 3SB4A 4UFRA 2WQVA 2Z65A 3ULVA 2Z82A 5FTTB 2V9TB 4MN8B 4V2DA 3RGXA 1H6TA 4AW4A 3G3BA 2ASSB 2WFHA 3W3JA 3G06A 3OGMB 3OGLB 4LSXC 3RGZA 3E6JA 4KT1A 3WPCA 2P1PB 4C2AB 4PERA 4H09A 3ZYJA 1M9LA 4Q3GA 1ZIWA 1DS9A 4MQWX 5HZLB 3UL8A 4G8AA 3W3GA 4LXSA 4LXRA 3E2JA 3WN4A 4KXFB 3OJAB 5AZ5A 1PGVA 1XKUA 3ULAA 1OOKG 1W8AA 2Z64A 2ASTB 4AY9X 3M19A 3OGKB 3BZ5A 4OQTA 3GOZA 5B0TA 3WPDA 3UL9A 4R6FA 1DFJI 4U09A 2OMVA 4ARRA 1XWDC 4NKGA 4CILA 4CC4C 2P1QB 4KNGA 4M7EA 4FD0A 5CMPA 2OMTA 3W3KA 5AWBA 2O6QA 4ECNA 4V2EA 4P91A 2OMYA 1U0ND 4R0AA 2RR6A 2Z63A 3A79B 4I6JB 1P9AG 4K17A 3E4GA 3OJAA 4R07A 4ECOA 2WQWA 5AWDA 1GWBA 3G39A 2P1NB 1M9SA 5B4PA 3O6NA 4R08A 4Z94G 4Z64C 3TSRE 1A4YA 4FS7A 1WWLA 1FS2A 1OGQA 5GMHA 3ZYOA 5GMGA 4WYKA 1O6VA 4IM6A 4J0MA 1DCEA 2BEXA 4L3AA 4WP6A 4Z61C 4GLPA 2P1OB 4U7LA 5IJCA 1M0ZA 4QXEA 3KJ4A 2P1MB 3PMHG 4NZTM 3W3LA 1K5DC 4QBZA 4C2BB 4XOSA 5GQRK 1M10B 4R5DA 3RFSA 4R6GA 4BSRA 4B8CD 4Z8GA 2V70A 3RW7A 1LTXA 3G04C 2IFGA 4LI2A 4GT6A 4R5CA 2ELLA 1IO0A 4BV4R 4PQ8A 4PKIG 3W3NA 3DZEA 2R9UA 1A9NA 2XOTA 4R6JA 4RCAB 3RJ0A 4PEQB 3RIZA 3WPEA 5IJBA 2WQXA 5D3IA 4R6AA 1D0BA 1H6UA 5B0NA 2UZYA 4FDWA 2RA8A 1P8TA 2CA6A 4R58A 5CMNA 2OMXA 4BSUA 4YEBB 1FQVA 2BNHA 1FT8A 2OMUA 4Y61B 4L3FA 3E3ZA 4RCWA 4P8SA 4BSSA 5LFNA 1SQ0B 5GMFA 5GS2B 1XCDA 2Z7XB 3JB9j 1K5GC 2V9SA 4U06A 1O6TA 3CIGA 4RWTC 4R09A 5IJDA 3WPIA 2JE0A 1G9UA 3CIYA 4XSQA 4QC0A 3M18A 4NZRM 3W3MA 2OMWA 4FMZA 1Z7XW 5AWAA 4FCGA 3RFEA 3RFJA 4CC4A 4M7EC 3ZYIA 2XWTC 4ARNA 2Y5QA 1FO1A
chains in the Genus database with same CATH topology
1OTOA 4CNMA 2FT3A 1OZNA 2ID5A 4LI1A 3ZYNA 1KOOA 1JL5A 1P8VA 2Z62A 3FXIA 2O6RA 4XGOA 4EZGA 1XECA 1O6SA 5AWCA 4PSJA 3C6OB 4LSCA 4LSAA 1XEUA 1YRGA 4NKHA 4FHOA 1OTMA 3WPBA 4HQ1A 3O53A 2Z7XA 3G3AA 1OTNA 3UN9A 4CNCA 3UL7A 2Z66A 4U08A 2O6SA 3VQ2A 4LSXA 3C6NB 3WPGA 2OMZA 4CP6A 5A5CA 5IYXC 3WPFA 3CVRA 3RW6A 2Q4GW 2A0ZA 3C6PB 3ULUA 2WQUA 3REZA 3P72A 2JQDA 1KOHA 4Q62A 4Q3IA 4J4LA 3WPHA 4Z79A 5GS0A 4TZHA 1QYYA 2Z81A 3VQ1A 4V2CA 2JE1A 5HDHA 2UZXA 3SB4A 4UFRA 2WQVA 2Z65A 3ULVA 2Z82A 5FTTB 2V9TB 4MN8B 4V2DA 3RGXA 1H6TA 4AW4A 3G3BA 2ASSB 2WFHA 3W3JA 3G06A 3OGMB 3OGLB 4LSXC 3RGZA 3E6JA 4KT1A 3WPCA 2P1PB 4C2AB 4PERA 4H09A 3ZYJA 1M9LA 4Q3GA 1ZIWA 1DS9A 4MQWX 5HZLB 3UL8A 4G8AA 3W3GA 4LXSA 4LXRA 3E2JA 3WN4A 4KXFB 3OJAB 5AZ5A 1PGVA 1XKUA 3ULAA 1OOKG 1W8AA 2Z64A 2ASTB 4AY9X 3M19A 3OGKB 3BZ5A 4OQTA 3GOZA 5B0TA 3WPDA 3UL9A 4R6FA 1DFJI 4U09A 2OMVA 4ARRA 1XWDC 4NKGA 4CILA 4CC4C 2P1QB 4KNGA 4M7EA 4FD0A 5CMPA 2OMTA 3W3KA 5AWBA 2O6QA 4ECNA 4V2EA 4P91A 2OMYA 1U0ND 4R0AA 2RR6A 2Z63A 3A79B 4I6JB 1P9AG 4K17A 3E4GA 3OJAA 4R07A 4ECOA 2WQWA 5AWDA 1GWBA 3G39A 2P1NB 1M9SA 5B4PA 3O6NA 4R08A 4Z94G 4Z64C 3TSRE 1A4YA 4FS7A 1WWLA 1FS2A 1OGQA 5GMHA 3ZYOA 5GMGA 4WYKA 1O6VA 4IM6A 4J0MA 1DCEA 2BEXA 4L3AA 4WP6A 4Z61C 4GLPA 2P1OB 4U7LA 5IJCA 1M0ZA 4QXEA 3KJ4A 2P1MB 3PMHG 3W3LA 1K5DC 4QBZA 4C2BB 4XOSA 5GQRK 1M10B 4R5DA 3RFSA 4R6GA 4BSRA 4B8CD 4Z8GA 2V70A 3RW7A 1LTXA 3G04C 2IFGA 4LI2A 4GT6A 4R5CA 2ELLA 1IO0A 4BV4R 4PQ8A 4PKIG 3W3NA 3DZEA 2R9UA 1A9NA 2XOTA 4R6JA 4RCAB 3RJ0A 4PEQB 3RIZA 3WPEA 5IJBA 2WQXA 5D3IA 4R6AA 1D0BA 1H6UA 5B0NA 2UZYA 4FDWA 2RA8A 1P8TA 2CA6A 4R58A 5CMNA 2OMXA 4BSUA 4YEBB 1FQVA 2BNHA 1FT8A 2OMUA 4Y61B 4L3FA 3E3ZA 4RCWA 4P8SA 4BSSA 5LFNA 1SQ0B 5GMFA 5GS2B 1XCDA 2Z7XB 3JB9j 1K5GC 2V9SA 4U06A 1O6TA 3CIGA 4RWTC 4R09A 5IJDA 3WPIA 2JE0A 1G9UA 3CIYA 4XSQA 4QC0A 3M18A 3W3MA 2OMWA 4FMZA 1Z7XW 5AWAA 4FCGA 3RFEA 3RFJA 4CC4A 4M7EC 3ZYIA 2XWTC 4ARNA 2Y5QA 1FO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTO A;  4CNM A;  2FT3 A;  1OZN A;  2ID5 A;  4LI1 A;  3ZYN A;  1KOO A;  1JL5 A;  1P8V A;  2Z62 A;  3FXI A;  2O6R A;  4XGO A;  4EZG A;  1XEC A;  1O6S A;  5AWC A;  4PSJ A;  3C6O B;  4LSC A;  4LSA A;  1XEU A;  1YRG A;  4NKH A;  4FHO A;  1OTM A;  3WPB A;  4HQ1 A;  3O53 A;  2Z7X A;  3G3A A;  1OTN A;  3UN9 A;  4CNC A;  3UL7 A;  2Z66 A;  4U08 A;  2O6S A;  3VQ2 A;  4LSX A;  3C6N B;  3WPG A;  2OMZ A;  4CP6 A;  5A5C A;  5IYX C;  3WPF A;  3CVR A;  3RW6 A;  2Q4G W;  2A0Z A;  3C6P B;  3ULU A;  2WQU A;  3REZ A;  3P72 A;  2JQD A;  1KOH A;  4Q62 A;  4Q3I A;  4J4L A;  3WPH A;  4Z79 A;  5GS0 A;  4TZH A;  1QYY A;  2Z81 A;  3VQ1 A;  4V2C A;  2JE1 A;  5HDH A;  2UZX A;  3SB4 A;  4UFR A;  2WQV A;  2Z65 A;  3ULV A;  2Z82 A;  5FTT B;  2V9T B;  4MN8 B;  4V2D A;  3RGX A;  1H6T A;  4AW4 A;  3G3B A;  2ASS B;  2WFH A;  3W3J A;  3G06 A;  3OGM B;  3OGL B;  4LSX C;  3RGZ A;  3E6J A;  4KT1 A;  3WPC A;  2P1P B;  4C2A B;  4PER A;  4H09 A;  3ZYJ A;  1M9L A;  4Q3G A;  1ZIW A;  1DS9 A;  4MQW X;  5HZL B;  3UL8 A;  4G8A A;  3W3G A;  4LXS A;  4LXR A;  3E2J A;  3WN4 A;  4KXF B;  3OJA B;  5AZ5 A;  1PGV A;  1XKU A;  3ULA A;  1OOK G;  1W8A A;  2Z64 A;  2AST B;  4AY9 X;  3M19 A;  3OGK B;  3BZ5 A;  4OQT A;  3GOZ A;  5B0T A;  3WPD A;  3UL9 A;  4R6F A;  1DFJ I;  4U09 A;  2OMV A;  4ARR A;  1XWD C;  4NKG A;  4CIL A;  4CC4 C;  2P1Q B;  4KNG A;  4M7E A;  4FD0 A;  5CMP A;  2OMT A;  3W3K A;  5AWB A;  2O6Q A;  4ECN A;  4V2E A;  4P91 A;  2OMY A;  1U0N D;  4R0A A;  2RR6 A;  2Z63 A;  3A79 B;  4I6J B;  1P9A G;  4K17 A;  3E4G A;  3OJA A;  4R07 A;  4ECO A;  2WQW A;  5AWD A;  1GWB A;  3G39 A;  2P1N B;  1M9S A;  5B4P A;  3O6N A;  4R08 A;  4Z94 G;  4Z64 C;  3TSR E;  1A4Y A;  4FS7 A;  1WWL A;  1FS2 A;  1OGQ A;  5GMH A;  3ZYO A;  5GMG A;  4WYK A;  1O6V A;  4IM6 A;  4J0M A;  1DCE A;  2BEX A;  4L3A A;  4WP6 A;  4Z61 C;  4GLP A;  2P1O B;  4U7L A;  5IJC A;  1M0Z A;  4QXE A;  3KJ4 A;  2P1M B;  3PMH G;  3W3L A;  1K5D C;  4QBZ A;  4C2B B;  4XOS A;  5GQR K;  1M10 B;  4R5D A;  3RFS A;  4R6G A;  4BSR A;  4B8C D;  4Z8G A;  2V70 A;  3RW7 A;  1LTX A;  3G04 C;  2IFG A;  4LI2 A;  4GT6 A;  4R5C A;  2ELL A;  1IO0 A;  4BV4 R;  4PQ8 A;  4PKI G;  3W3N A;  3DZE A;  2R9U A;  1A9N A;  2XOT A;  4R6J A;  4RCA B;  3RJ0 A;  4PEQ B;  3RIZ A;  3WPE A;  5IJB A;  2WQX A;  5D3I A;  4R6A A;  1D0B A;  1H6U A;  5B0N A;  2UZY A;  4FDW A;  2RA8 A;  1P8T A;  2CA6 A;  4R58 A;  5CMN A;  2OMX A;  4BSU A;  4YEB B;  1FQV A;  2BNH A;  1FT8 A;  2OMU A;  4Y61 B;  4L3F A;  3E3Z A;  4RCW A;  4P8S A;  4BSS A;  5LFN A;  1SQ0 B;  5GMF A;  5GS2 B;  1XCD A;  2Z7X B;  3JB9 j;  1K5G C;  2V9S A;  4U06 A;  1O6T A;  3CIG A;  4RWT C;  4R09 A;  5IJD A;  3WPI A;  2JE0 A;  1G9U A;  3CIY A;  4XSQ A;  4QC0 A;  3M18 A;  3W3M A;  2OMW A;  4FMZ A;  1Z7X W;  5AWA A;  4FCG A;  3RFE A;  3RFJ A;  4CC4 A;  4M7E C;  3ZYI A;  2XWT C;  4ARN A;  2Y5Q A;  1FO1 A; 
#chains in the Genus database with same CATH topology
 1OTO A;  4CNM A;  2FT3 A;  1OZN A;  2ID5 A;  4LI1 A;  3ZYN A;  1KOO A;  1JL5 A;  1P8V A;  2Z62 A;  3FXI A;  2O6R A;  4XGO A;  4EZG A;  1XEC A;  1O6S A;  5AWC A;  4PSJ A;  3C6O B;  4LSC A;  4LSA A;  1XEU A;  1YRG A;  4NKH A;  4FHO A;  1OTM A;  3WPB A;  4HQ1 A;  3O53 A;  2Z7X A;  3G3A A;  1OTN A;  3UN9 A;  4CNC A;  3UL7 A;  2Z66 A;  4U08 A;  2O6S A;  3VQ2 A;  4LSX A;  3C6N B;  3WPG A;  2OMZ A;  4CP6 A;  5A5C A;  5IYX C;  3WPF A;  3CVR A;  3RW6 A;  2Q4G W;  2A0Z A;  3C6P B;  3ULU A;  2WQU A;  3REZ A;  3P72 A;  2JQD A;  1KOH A;  4Q62 A;  4Q3I A;  4J4L A;  3WPH A;  4Z79 A;  5GS0 A;  4TZH A;  1QYY A;  2Z81 A;  3VQ1 A;  4V2C A;  2JE1 A;  5HDH A;  2UZX A;  3SB4 A;  4UFR A;  2WQV A;  2Z65 A;  3ULV A;  2Z82 A;  5FTT B;  2V9T B;  4MN8 B;  4V2D A;  3RGX A;  1H6T A;  4AW4 A;  3G3B A;  2ASS B;  2WFH A;  3W3J A;  3G06 A;  3OGM B;  3OGL B;  4LSX C;  3RGZ A;  3E6J A;  4KT1 A;  3WPC A;  2P1P B;  4C2A B;  4PER A;  4H09 A;  3ZYJ A;  1M9L A;  4Q3G A;  1ZIW A;  1DS9 A;  4MQW X;  5HZL B;  3UL8 A;  4G8A A;  3W3G A;  4LXS A;  4LXR A;  3E2J A;  3WN4 A;  4KXF B;  3OJA B;  5AZ5 A;  1PGV A;  1XKU A;  3ULA A;  1OOK G;  1W8A A;  2Z64 A;  2AST B;  4AY9 X;  3M19 A;  3OGK B;  3BZ5 A;  4OQT A;  3GOZ A;  5B0T A;  3WPD A;  3UL9 A;  4R6F A;  1DFJ I;  4U09 A;  2OMV A;  4ARR A;  1XWD C;  4NKG A;  4CIL A;  4CC4 C;  2P1Q B;  4KNG A;  4M7E A;  4FD0 A;  5CMP A;  2OMT A;  3W3K A;  5AWB A;  2O6Q A;  4ECN A;  4V2E A;  4P91 A;  2OMY A;  1U0N D;  4R0A A;  2RR6 A;  2Z63 A;  3A79 B;  4I6J B;  1P9A G;  4K17 A;  3E4G A;  3OJA A;  4R07 A;  4ECO A;  2WQW A;  5AWD A;  1GWB A;  3G39 A;  2P1N B;  1M9S A;  5B4P A;  3O6N A;  4R08 A;  4Z94 G;  4Z64 C;  3TSR E;  1A4Y A;  4FS7 A;  1WWL A;  1FS2 A;  1OGQ A;  5GMH A;  3ZYO A;  5GMG A;  4WYK A;  1O6V A;  4IM6 A;  4J0M A;  1DCE A;  2BEX A;  4L3A A;  4WP6 A;  4Z61 C;  4GLP A;  2P1O B;  4U7L A;  5IJC A;  1M0Z A;  4QXE A;  3KJ4 A;  2P1M B;  3PMH G;  4NZT M;  3W3L A;  1K5D C;  4QBZ A;  4C2B B;  4XOS A;  5GQR K;  1M10 B;  4R5D A;  3RFS A;  4R6G A;  4BSR A;  4B8C D;  4Z8G A;  2V70 A;  3RW7 A;  1LTX A;  3G04 C;  2IFG A;  4LI2 A;  4GT6 A;  4R5C A;  2ELL A;  1IO0 A;  4BV4 R;  4PQ8 A;  4PKI G;  3W3N A;  3DZE A;  2R9U A;  1A9N A;  2XOT A;  4R6J A;  4RCA B;  3RJ0 A;  4PEQ B;  3RIZ A;  3WPE A;  5IJB A;  2WQX A;  5D3I A;  4R6A A;  1D0B A;  1H6U A;  5B0N A;  2UZY A;  4FDW A;  2RA8 A;  1P8T A;  2CA6 A;  4R58 A;  5CMN A;  2OMX A;  4BSU A;  4YEB B;  1FQV A;  2BNH A;  1FT8 A;  2OMU A;  4Y61 B;  4L3F A;  3E3Z A;  4RCW A;  4P8S A;  4BSS A;  5LFN A;  1SQ0 B;  5GMF A;  5GS2 B;  1XCD A;  2Z7X B;  3JB9 j;  1K5G C;  2V9S A;  4U06 A;  1O6T A;  3CIG A;  4RWT C;  4R09 A;  5IJD A;  3WPI A;  2JE0 A;  1G9U A;  3CIY A;  4XSQ A;  4QC0 A;  3M18 A;  4NZR M;  3W3M A;  2OMW A;  4FMZ A;  1Z7X W;  5AWA A;  4FCG A;  3RFE A;  3RFJ A;  4CC4 A;  4M7E C;  3ZYI A;  2XWT C;  4ARN A;  2Y5Q A;  1FO1 A; 
#chains in the Genus database with same CATH homology
 1OTO A;  4CNM A;  2FT3 A;  1OZN A;  2ID5 A;  4LI1 A;  3ZYN A;  1KOO A;  1JL5 A;  1P8V A;  2Z62 A;  3FXI A;  2O6R A;  4XGO A;  4EZG A;  1XEC A;  1O6S A;  5AWC A;  4PSJ A;  3C6O B;  4LSC A;  4LSA A;  1XEU A;  1YRG A;  4NKH A;  4FHO A;  1OTM A;  3WPB A;  4HQ1 A;  3O53 A;  2Z7X A;  3G3A A;  1OTN A;  3UN9 A;  4CNC A;  3UL7 A;  2Z66 A;  4U08 A;  2O6S A;  3VQ2 A;  4LSX A;  3C6N B;  3WPG A;  2OMZ A;  4CP6 A;  5A5C A;  5IYX C;  3WPF A;  3CVR A;  3RW6 A;  2Q4G W;  2A0Z A;  3C6P B;  3ULU A;  2WQU A;  3REZ A;  3P72 A;  2JQD A;  1KOH A;  4Q62 A;  4Q3I A;  4J4L A;  3WPH A;  4Z79 A;  5GS0 A;  4TZH A;  1QYY A;  2Z81 A;  3VQ1 A;  4V2C A;  2JE1 A;  5HDH A;  2UZX A;  3SB4 A;  4UFR A;  2WQV A;  2Z65 A;  3ULV A;  2Z82 A;  5FTT B;  2V9T B;  4MN8 B;  4V2D A;  3RGX A;  1H6T A;  4AW4 A;  3G3B A;  2ASS B;  2WFH A;  3W3J A;  3G06 A;  3OGM B;  3OGL B;  4LSX C;  3RGZ A;  3E6J A;  4KT1 A;  3WPC A;  2P1P B;  4C2A B;  4PER A;  4H09 A;  3ZYJ A;  1M9L A;  4Q3G A;  1ZIW A;  1DS9 A;  4MQW X;  5HZL B;  3UL8 A;  4G8A A;  3W3G A;  4LXS A;  4LXR A;  3E2J A;  3WN4 A;  4KXF B;  3OJA B;  5AZ5 A;  1PGV A;  1XKU A;  3ULA A;  1OOK G;  1W8A A;  2Z64 A;  2AST B;  4AY9 X;  3M19 A;  3OGK B;  3BZ5 A;  4OQT A;  3GOZ A;  5B0T A;  3WPD A;  3UL9 A;  4R6F A;  1DFJ I;  4U09 A;  2OMV A;  4ARR A;  1XWD C;  4NKG A;  4CIL A;  4CC4 C;  2P1Q B;  4KNG A;  4M7E A;  4FD0 A;  5CMP A;  2OMT A;  3W3K A;  5AWB A;  2O6Q A;  4ECN A;  4V2E A;  4P91 A;  2OMY A;  1U0N D;  4R0A A;  2RR6 A;  2Z63 A;  3A79 B;  4I6J B;  1P9A G;  4K17 A;  3E4G A;  3OJA A;  4R07 A;  4ECO A;  2WQW A;  5AWD A;  1GWB A;  3G39 A;  2P1N B;  1M9S A;  5B4P A;  3O6N A;  4R08 A;  4Z94 G;  4Z64 C;  3TSR E;  1A4Y A;  4FS7 A;  1WWL A;  1FS2 A;  1OGQ A;  5GMH A;  3ZYO A;  5GMG A;  4WYK A;  1O6V A;  4IM6 A;  4J0M A;  1DCE A;  2BEX A;  4L3A A;  4WP6 A;  4Z61 C;  4GLP A;  2P1O B;  4U7L A;  5IJC A;  1M0Z A;  4QXE A;  3KJ4 A;  2P1M B;  3PMH G;  3W3L A;  1K5D C;  4QBZ A;  4C2B B;  4XOS A;  5GQR K;  1M10 B;  4R5D A;  3RFS A;  4R6G A;  4BSR A;  4B8C D;  4Z8G A;  2V70 A;  3RW7 A;  1LTX A;  3G04 C;  2IFG A;  4LI2 A;  4GT6 A;  4R5C A;  2ELL A;  1IO0 A;  4BV4 R;  4PQ8 A;  4PKI G;  3W3N A;  3DZE A;  2R9U A;  1A9N A;  2XOT A;  4R6J A;  4RCA B;  3RJ0 A;  4PEQ B;  3RIZ A;  3WPE A;  5IJB A;  2WQX A;  5D3I A;  4R6A A;  1D0B A;  1H6U A;  5B0N A;  2UZY A;  4FDW A;  2RA8 A;  1P8T A;  2CA6 A;  4R58 A;  5CMN A;  2OMX A;  4BSU A;  4YEB B;  1FQV A;  2BNH A;  1FT8 A;  2OMU A;  4Y61 B;  4L3F A;  3E3Z A;  4RCW A;  4P8S A;  4BSS A;  5LFN A;  1SQ0 B;  5GMF A;  5GS2 B;  1XCD A;  2Z7X B;  3JB9 j;  1K5G C;  2V9S A;  4U06 A;  1O6T A;  3CIG A;  4RWT C;  4R09 A;  5IJD A;  3WPI A;  2JE0 A;  1G9U A;  3CIY A;  4XSQ A;  4QC0 A;  3M18 A;  3W3M A;  2OMW A;  4FMZ A;  1Z7X W;  5AWA A;  4FCG A;  3RFE A;  3RFJ A;  4CC4 A;  4M7E C;  3ZYI A;  2XWT C;  4ARN A;  2Y5Q A;  1FO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...