4R6GA

Crystal structure of computational designed leucine rich repeats dlrr_k in space group p22121
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
464
structure length
464
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNNLANLNDRVFEGLTNLTTLNLSNNNLARLWKHANPGGPIYFLKGLTNLTTLNLSNNGFDELPKEVFKDLTSLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTSLTTLNLSNNQLTSLPKGVLERLTNLKTLNLSNNQITKEVCRHVAELLKQAASLHELHLSNNNIGEEGAAELVEALLHPGSTLETLDLSNCNLTKEACREIARALKQATTLHELHLSNNNIGEEGAAELVEALLHPGSTLETLDLSNCNLTKEACREIARALKQATSLHELHLSNNNIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags De novo protein
molecule keywords leucine rich repeats DLRR_K
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
total genus 167
structure length 464
sequence length 464
ec nomenclature
pdb deposition date 2014-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r6gA00
3CIYA 2Z64A 3WPCA 4RWTC 4TZHA 3E6JA 4Z8GA 4XOSA 5B0NA 1QYYA 2V9SA 5GQRK 3RGZA 1P8VA 3G04C 5B0TA 1XKUA 1Z7XW 4MN8B 2OMYA 2P1OB 2P1MB 1FO1A 4P8SA 4FD0A 4ECOA 4WYKA 1PGVA 2IFGA 4IM6A 5AWDA 4R6FA 5HDHA 3G3BA 1M9LA 4NKHA 5FTTB 1M10B 1OGQA 5IYXC 4FDWA 3GOZA 1D0BA 3RFSA 3ZYOA 2CA6A 2P1QB 4LSCA 3RGXA 4U08A 3W3LA 2R9UA 3RIZA 2BNHA 4R0AA 2Z82A 1FQVA 2ID5A 2OMVA 3WPGA 2Z62A 4LSAA 4CC4C 2WQUA 1ZIWA 1H6TA 4AW4A 3ZYJA 4QBZA 4FMZA 1O6SA 1JL5A 3E2JA 3ULVA 2V9TB 5AWCA 4QC0A 4P91A 2XWTC 4FCGA 4Z61C 5CMPA 4U06A 2ASSB 3W3MA 5A5CA 4Q3GA 5B4PA 5AZ5A 1DS9A 1XWDC 4PSJA 4LI1A 5IJBA 1XECA 1A9NA 3WPDA 2ELLA 4PKIG 1G9UA 1K5GC 4R6AA 2JQDA 3W3KA 1SQ0B 3UL7A 2FT3A 3C6NB 2Q4GW 5GMHA 3ZYNA 2XOTA 4V2EA 5GMFA 4HQ1A 3WPEA 4Z64C 4NKGA 4XGOA 3PMHG 5LFNA 1IO0A 3G39A 4LSXA 3ULAA 2ASTB 2O6SA 4LXSA 4BV4R 1OTMA 4G8AA 3TSRE 4M7EC 4BSRA 1O6TA 3E4GA 1WWLA 2JE0A 2RA8A 5IJCA 5HZLB 3G06A 3OGLB 1U0ND 1XCDA 4Q3IA 3C6PB 2Y5QA 3RW6A 1K5DC 1P8TA 4L3AA 3M19A 4AY9X 3CVRA 3OJAB 4BSSA 4CNMA 3W3GA 2OMTA 2P1NB 4FHOA 4R09A 4OQTA 2WQVA 5IJDA 4C2AB 1M0ZA 3RW7A 1DCEA 1M9SA 2Z66A 1H6UA 3OJAA 3W3NA 3RFEA 3WPBA 3KJ4A 4GLPA 4I6JB 2P1PB 4CP6A 5AWAA 3M18A 4KXFB 5D3IA 3CIGA 2BEXA 4RCWA 4H09A 2JE1A 2Z7XB 4MQWX 3OGMB 2V70A 2OMZA 4R5DA 3C6OB 4Q62A 1OTOA 3VQ2A 4GT6A 4KNGA 5AWBA 3W3JA 2Z65A 5GS2B 2UZYA 3BZ5A 2RR6A 4WP6A 2Z7XA 4PEQB 1OTNA 3P72A 4M7EA 3OGKB 4K17A 4V2DA 3WN4A 2WFHA 3VQ1A 1LTXA 4J0MA 4PERA 1XEUA 2OMWA 3REZA 5GS0A 5CMNA 4PQ8A 1OZNA 1YRGA 1GWBA 4L3FA 4XSQA 4Z94G 4Y61B 4ARNA 3SB4A 4CNCA 3WPFA 2WQXA 3ULUA 4CC4A 2O6RA 4BSUA 1KOHA 3DZEA 4J4LA 1A4YA 3G3AA 2O6QA 3O6NA 4LSXC 1DFJI 2OMXA 1KOOA 4R58A 3FXIA 4R07A 5GMGA 3E3ZA 3UL8A 2Z63A 3WPHA 3O53A 4FS7A 2WQWA 4QXEA 4KT1A 3JB9j 4CILA 2A0ZA 4R6GA 2UZXA 3RJ0A 1FT8A 3ZYIA 4B8CD 1OOKG 4C2BB 3RFJA 4ECNA 3UN9A 4V2CA 3WPIA 4UFRA 4LXRA 4ARRA 1W8AA 1O6VA 4YEBB 1FS2A 4R6JA 3A79B 4LI2A 3UL9A 4R5CA 4Z79A 2OMUA 1P9AG 4U09A 4RCAB 4U7LA 2Z81A 4EZGA 4R08A
chains in the Genus database with same CATH superfamily
3CIYA 2Z64A 3WPCA 4RWTC 4TZHA 3E6JA 4Z8GA 4XOSA 5B0NA 1QYYA 2V9SA 5GQRK 3RGZA 1P8VA 3G04C 5B0TA 1XKUA 1Z7XW 4MN8B 2OMYA 2P1OB 2P1MB 1FO1A 4P8SA 4FD0A 4ECOA 4WYKA 1PGVA 2IFGA 4IM6A 5AWDA 4R6FA 5HDHA 3G3BA 1M9LA 4NKHA 5FTTB 1M10B 1OGQA 5IYXC 4FDWA 3GOZA 1D0BA 3RFSA 3ZYOA 2CA6A 2P1QB 4LSCA 3RGXA 4U08A 3W3LA 2R9UA 3RIZA 2BNHA 4R0AA 2Z82A 1FQVA 2ID5A 2OMVA 3WPGA 2Z62A 4LSAA 4CC4C 2WQUA 1ZIWA 1H6TA 4AW4A 3ZYJA 4QBZA 4FMZA 1O6SA 1JL5A 3E2JA 3ULVA 2V9TB 5AWCA 4QC0A 4P91A 2XWTC 4FCGA 4Z61C 5CMPA 4U06A 2ASSB 3W3MA 5A5CA 4Q3GA 5B4PA 5AZ5A 1DS9A 1XWDC 4PSJA 4LI1A 5IJBA 1XECA 1A9NA 3WPDA 2ELLA 4PKIG 1G9UA 1K5GC 4R6AA 2JQDA 3W3KA 1SQ0B 3UL7A 2FT3A 3C6NB 2Q4GW 5GMHA 3ZYNA 2XOTA 4V2EA 5GMFA 4HQ1A 3WPEA 4Z64C 4NKGA 4XGOA 3PMHG 5LFNA 1IO0A 3G39A 4LSXA 3ULAA 4NZRM 2ASTB 2O6SA 4LXSA 4BV4R 1OTMA 4G8AA 3TSRE 4M7EC 4BSRA 1O6TA 3E4GA 1WWLA 2JE0A 2RA8A 5IJCA 5HZLB 3G06A 3OGLB 1U0ND 1XCDA 4Q3IA 3C6PB 2Y5QA 3RW6A 1K5DC 1P8TA 4L3AA 3M19A 4AY9X 3CVRA 3OJAB 4BSSA 4CNMA 3W3GA 2OMTA 2P1NB 4FHOA 4R09A 4OQTA 2WQVA 5IJDA 4C2AB 1M0ZA 3RW7A 1DCEA 1M9SA 2Z66A 1H6UA 3OJAA 3W3NA 3RFEA 3WPBA 3KJ4A 4GLPA 4I6JB 2P1PB 4CP6A 5AWAA 3M18A 4KXFB 5D3IA 3CIGA 2BEXA 4RCWA 4H09A 2JE1A 2Z7XB 4MQWX 3OGMB 2V70A 4NZTM 2OMZA 4R5DA 3C6OB 4Q62A 1OTOA 3VQ2A 4GT6A 4KNGA 5AWBA 3W3JA 2Z65A 5GS2B 2UZYA 3BZ5A 2RR6A 4WP6A 2Z7XA 4PEQB 1OTNA 3P72A 4M7EA 3OGKB 4K17A 4V2DA 3WN4A 2WFHA 3VQ1A 1LTXA 4J0MA 4PERA 1XEUA 2OMWA 3REZA 5GS0A 5CMNA 4PQ8A 1OZNA 1YRGA 1GWBA 4L3FA 4XSQA 4Z94G 4Y61B 4ARNA 3SB4A 4CNCA 3WPFA 2WQXA 3ULUA 4CC4A 2O6RA 4BSUA 1KOHA 3DZEA 4J4LA 1A4YA 3G3AA 2O6QA 3O6NA 4LSXC 1DFJI 2OMXA 1KOOA 4R58A 3FXIA 4R07A 5GMGA 3E3ZA 3UL8A 2Z63A 3WPHA 3O53A 4FS7A 2WQWA 4QXEA 4KT1A 3JB9j 4CILA 2A0ZA 4R6GA 2UZXA 3RJ0A 1FT8A 3ZYIA 4B8CD 1OOKG 4C2BB 3RFJA 4ECNA 3UN9A 4V2CA 3WPIA 4UFRA 4LXRA 4ARRA 1W8AA 1O6VA 4YEBB 1FS2A 4R6JA 3A79B 4LI2A 3UL9A 4R5CA 4Z79A 2OMUA 1P9AG 4U09A 4RCAB 4U7LA 2Z81A 4EZGA 4R08A
chains in the Genus database with same CATH topology
3CIYA 2Z64A 3WPCA 4RWTC 4TZHA 3E6JA 4Z8GA 4XOSA 5B0NA 1QYYA 2V9SA 5GQRK 3RGZA 1P8VA 3G04C 5B0TA 1XKUA 1Z7XW 4MN8B 2OMYA 2P1OB 2P1MB 1FO1A 4P8SA 4FD0A 4ECOA 4WYKA 1PGVA 2IFGA 4IM6A 5AWDA 4R6FA 5HDHA 3G3BA 1M9LA 4NKHA 5FTTB 1M10B 1OGQA 5IYXC 4FDWA 3GOZA 1D0BA 3RFSA 3ZYOA 2CA6A 2P1QB 4LSCA 3RGXA 4U08A 3W3LA 2R9UA 3RIZA 2BNHA 4R0AA 2Z82A 1FQVA 2ID5A 2OMVA 3WPGA 2Z62A 4LSAA 4CC4C 2WQUA 1ZIWA 1H6TA 4AW4A 3ZYJA 4QBZA 4FMZA 1O6SA 1JL5A 3E2JA 3ULVA 2V9TB 5AWCA 4QC0A 4P91A 2XWTC 4FCGA 4Z61C 5CMPA 4U06A 2ASSB 3W3MA 5A5CA 4Q3GA 5B4PA 5AZ5A 1DS9A 1XWDC 4PSJA 4LI1A 5IJBA 1XECA 1A9NA 3WPDA 2ELLA 4PKIG 1G9UA 1K5GC 4R6AA 2JQDA 3W3KA 1SQ0B 3UL7A 2FT3A 3C6NB 2Q4GW 5GMHA 3ZYNA 2XOTA 4V2EA 5GMFA 4HQ1A 3WPEA 4Z64C 4NKGA 4XGOA 3PMHG 5LFNA 1IO0A 3G39A 4LSXA 3ULAA 2ASTB 2O6SA 4LXSA 4BV4R 1OTMA 4G8AA 3TSRE 4M7EC 4BSRA 1O6TA 3E4GA 1WWLA 2JE0A 2RA8A 5IJCA 5HZLB 3G06A 3OGLB 1U0ND 1XCDA 4Q3IA 3C6PB 2Y5QA 3RW6A 1K5DC 1P8TA 4L3AA 3M19A 4AY9X 3CVRA 3OJAB 4BSSA 4CNMA 3W3GA 2OMTA 2P1NB 4FHOA 4R09A 4OQTA 2WQVA 5IJDA 4C2AB 1M0ZA 3RW7A 1DCEA 1M9SA 2Z66A 1H6UA 3OJAA 3W3NA 3RFEA 3WPBA 3KJ4A 4GLPA 4I6JB 2P1PB 4CP6A 5AWAA 3M18A 4KXFB 5D3IA 3CIGA 2BEXA 4RCWA 4H09A 2JE1A 2Z7XB 4MQWX 3OGMB 2V70A 2OMZA 4R5DA 3C6OB 4Q62A 1OTOA 3VQ2A 4GT6A 4KNGA 5AWBA 3W3JA 2Z65A 5GS2B 2UZYA 3BZ5A 2RR6A 4WP6A 2Z7XA 4PEQB 1OTNA 3P72A 4M7EA 3OGKB 4K17A 4V2DA 3WN4A 2WFHA 3VQ1A 1LTXA 4J0MA 4PERA 1XEUA 2OMWA 3REZA 5GS0A 5CMNA 4PQ8A 1OZNA 1YRGA 1GWBA 4L3FA 4XSQA 4Z94G 4Y61B 4ARNA 3SB4A 4CNCA 3WPFA 2WQXA 3ULUA 4CC4A 2O6RA 4BSUA 1KOHA 3DZEA 4J4LA 1A4YA 3G3AA 2O6QA 3O6NA 4LSXC 1DFJI 2OMXA 1KOOA 4R58A 3FXIA 4R07A 5GMGA 3E3ZA 3UL8A 2Z63A 3WPHA 3O53A 4FS7A 2WQWA 4QXEA 4KT1A 3JB9j 4CILA 2A0ZA 4R6GA 2UZXA 3RJ0A 1FT8A 3ZYIA 4B8CD 1OOKG 4C2BB 3RFJA 4ECNA 3UN9A 4V2CA 3WPIA 4UFRA 4LXRA 4ARRA 1W8AA 1O6VA 4YEBB 1FS2A 4R6JA 3A79B 4LI2A 3UL9A 4R5CA 4Z79A 2OMUA 1P9AG 4U09A 4RCAB 4U7LA 2Z81A 4EZGA 4R08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIY A;  2Z64 A;  3WPC A;  4RWT C;  4TZH A;  3E6J A;  4Z8G A;  4XOS A;  5B0N A;  1QYY A;  2V9S A;  5GQR K;  3RGZ A;  1P8V A;  3G04 C;  5B0T A;  1XKU A;  1Z7X W;  4MN8 B;  2OMY A;  2P1O B;  2P1M B;  1FO1 A;  4P8S A;  4FD0 A;  4ECO A;  4WYK A;  1PGV A;  2IFG A;  4IM6 A;  5AWD A;  4R6F A;  5HDH A;  3G3B A;  1M9L A;  4NKH A;  5FTT B;  1M10 B;  1OGQ A;  5IYX C;  4FDW A;  3GOZ A;  1D0B A;  3RFS A;  3ZYO A;  2CA6 A;  2P1Q B;  4LSC A;  3RGX A;  4U08 A;  3W3L A;  2R9U A;  3RIZ A;  2BNH A;  4R0A A;  2Z82 A;  1FQV A;  2ID5 A;  2OMV A;  3WPG A;  2Z62 A;  4LSA A;  4CC4 C;  2WQU A;  1ZIW A;  1H6T A;  4AW4 A;  3ZYJ A;  4QBZ A;  4FMZ A;  1O6S A;  1JL5 A;  3E2J A;  3ULV A;  2V9T B;  5AWC A;  4QC0 A;  4P91 A;  2XWT C;  4FCG A;  4Z61 C;  5CMP A;  4U06 A;  2ASS B;  3W3M A;  5A5C A;  4Q3G A;  5B4P A;  5AZ5 A;  1DS9 A;  1XWD C;  4PSJ A;  4LI1 A;  5IJB A;  1XEC A;  1A9N A;  3WPD A;  2ELL A;  4PKI G;  1G9U A;  1K5G C;  4R6A A;  2JQD A;  3W3K A;  1SQ0 B;  3UL7 A;  2FT3 A;  3C6N B;  2Q4G W;  5GMH A;  3ZYN A;  2XOT A;  4V2E A;  5GMF A;  4HQ1 A;  3WPE A;  4Z64 C;  4NKG A;  4XGO A;  3PMH G;  5LFN A;  1IO0 A;  3G39 A;  4LSX A;  3ULA A;  2AST B;  2O6S A;  4LXS A;  4BV4 R;  1OTM A;  4G8A A;  3TSR E;  4M7E C;  4BSR A;  1O6T A;  3E4G A;  1WWL A;  2JE0 A;  2RA8 A;  5IJC A;  5HZL B;  3G06 A;  3OGL B;  1U0N D;  1XCD A;  4Q3I A;  3C6P B;  2Y5Q A;  3RW6 A;  1K5D C;  1P8T A;  4L3A A;  3M19 A;  4AY9 X;  3CVR A;  3OJA B;  4BSS A;  4CNM A;  3W3G A;  2OMT A;  2P1N B;  4FHO A;  4R09 A;  4OQT A;  2WQV A;  5IJD A;  4C2A B;  1M0Z A;  3RW7 A;  1DCE A;  1M9S A;  2Z66 A;  1H6U A;  3OJA A;  3W3N A;  3RFE A;  3WPB A;  3KJ4 A;  4GLP A;  4I6J B;  2P1P B;  4CP6 A;  5AWA A;  3M18 A;  4KXF B;  5D3I A;  3CIG A;  2BEX A;  4RCW A;  4H09 A;  2JE1 A;  2Z7X B;  4MQW X;  3OGM B;  2V70 A;  2OMZ A;  4R5D A;  3C6O B;  4Q62 A;  1OTO A;  3VQ2 A;  4GT6 A;  4KNG A;  5AWB A;  3W3J A;  2Z65 A;  5GS2 B;  2UZY A;  3BZ5 A;  2RR6 A;  4WP6 A;  2Z7X A;  4PEQ B;  1OTN A;  3P72 A;  4M7E A;  3OGK B;  4K17 A;  4V2D A;  3WN4 A;  2WFH A;  3VQ1 A;  1LTX A;  4J0M A;  4PER A;  1XEU A;  2OMW A;  3REZ A;  5GS0 A;  5CMN A;  4PQ8 A;  1OZN A;  1YRG A;  1GWB A;  4L3F A;  4XSQ A;  4Z94 G;  4Y61 B;  4ARN A;  3SB4 A;  4CNC A;  3WPF A;  2WQX A;  3ULU A;  4CC4 A;  2O6R A;  4BSU A;  1KOH A;  3DZE A;  4J4L A;  1A4Y A;  3G3A A;  2O6Q A;  3O6N A;  4LSX C;  1DFJ I;  2OMX A;  1KOO A;  4R58 A;  3FXI A;  4R07 A;  5GMG A;  3E3Z A;  3UL8 A;  2Z63 A;  3WPH A;  3O53 A;  4FS7 A;  2WQW A;  4QXE A;  4KT1 A;  3JB9 j;  4CIL A;  2A0Z A;  4R6G A;  2UZX A;  3RJ0 A;  1FT8 A;  3ZYI A;  4B8C D;  1OOK G;  4C2B B;  3RFJ A;  4ECN A;  3UN9 A;  4V2C A;  3WPI A;  4UFR A;  4LXR A;  4ARR A;  1W8A A;  1O6V A;  4YEB B;  1FS2 A;  4R6J A;  3A79 B;  4LI2 A;  3UL9 A;  4R5C A;  4Z79 A;  2OMU A;  1P9A G;  4U09 A;  4RCA B;  4U7L A;  2Z81 A;  4EZG A;  4R08 A; 
#chains in the Genus database with same CATH topology
 3CIY A;  2Z64 A;  3WPC A;  4RWT C;  4TZH A;  3E6J A;  4Z8G A;  4XOS A;  5B0N A;  1QYY A;  2V9S A;  5GQR K;  3RGZ A;  1P8V A;  3G04 C;  5B0T A;  1XKU A;  1Z7X W;  4MN8 B;  2OMY A;  2P1O B;  2P1M B;  1FO1 A;  4P8S A;  4FD0 A;  4ECO A;  4WYK A;  1PGV A;  2IFG A;  4IM6 A;  5AWD A;  4R6F A;  5HDH A;  3G3B A;  1M9L A;  4NKH A;  5FTT B;  1M10 B;  1OGQ A;  5IYX C;  4FDW A;  3GOZ A;  1D0B A;  3RFS A;  3ZYO A;  2CA6 A;  2P1Q B;  4LSC A;  3RGX A;  4U08 A;  3W3L A;  2R9U A;  3RIZ A;  2BNH A;  4R0A A;  2Z82 A;  1FQV A;  2ID5 A;  2OMV A;  3WPG A;  2Z62 A;  4LSA A;  4CC4 C;  2WQU A;  1ZIW A;  1H6T A;  4AW4 A;  3ZYJ A;  4QBZ A;  4FMZ A;  1O6S A;  1JL5 A;  3E2J A;  3ULV A;  2V9T B;  5AWC A;  4QC0 A;  4P91 A;  2XWT C;  4FCG A;  4Z61 C;  5CMP A;  4U06 A;  2ASS B;  3W3M A;  5A5C A;  4Q3G A;  5B4P A;  5AZ5 A;  1DS9 A;  1XWD C;  4PSJ A;  4LI1 A;  5IJB A;  1XEC A;  1A9N A;  3WPD A;  2ELL A;  4PKI G;  1G9U A;  1K5G C;  4R6A A;  2JQD A;  3W3K A;  1SQ0 B;  3UL7 A;  2FT3 A;  3C6N B;  2Q4G W;  5GMH A;  3ZYN A;  2XOT A;  4V2E A;  5GMF A;  4HQ1 A;  3WPE A;  4Z64 C;  4NKG A;  4XGO A;  3PMH G;  5LFN A;  1IO0 A;  3G39 A;  4LSX A;  3ULA A;  4NZR M;  2AST B;  2O6S A;  4LXS A;  4BV4 R;  1OTM A;  4G8A A;  3TSR E;  4M7E C;  4BSR A;  1O6T A;  3E4G A;  1WWL A;  2JE0 A;  2RA8 A;  5IJC A;  5HZL B;  3G06 A;  3OGL B;  1U0N D;  1XCD A;  4Q3I A;  3C6P B;  2Y5Q A;  3RW6 A;  1K5D C;  1P8T A;  4L3A A;  3M19 A;  4AY9 X;  3CVR A;  3OJA B;  4BSS A;  4CNM A;  3W3G A;  2OMT A;  2P1N B;  4FHO A;  4R09 A;  4OQT A;  2WQV A;  5IJD A;  4C2A B;  1M0Z A;  3RW7 A;  1DCE A;  1M9S A;  2Z66 A;  1H6U A;  3OJA A;  3W3N A;  3RFE A;  3WPB A;  3KJ4 A;  4GLP A;  4I6J B;  2P1P B;  4CP6 A;  5AWA A;  3M18 A;  4KXF B;  5D3I A;  3CIG A;  2BEX A;  4RCW A;  4H09 A;  2JE1 A;  2Z7X B;  4MQW X;  3OGM B;  2V70 A;  4NZT M;  2OMZ A;  4R5D A;  3C6O B;  4Q62 A;  1OTO A;  3VQ2 A;  4GT6 A;  4KNG A;  5AWB A;  3W3J A;  2Z65 A;  5GS2 B;  2UZY A;  3BZ5 A;  2RR6 A;  4WP6 A;  2Z7X A;  4PEQ B;  1OTN A;  3P72 A;  4M7E A;  3OGK B;  4K17 A;  4V2D A;  3WN4 A;  2WFH A;  3VQ1 A;  1LTX A;  4J0M A;  4PER A;  1XEU A;  2OMW A;  3REZ A;  5GS0 A;  5CMN A;  4PQ8 A;  1OZN A;  1YRG A;  1GWB A;  4L3F A;  4XSQ A;  4Z94 G;  4Y61 B;  4ARN A;  3SB4 A;  4CNC A;  3WPF A;  2WQX A;  3ULU A;  4CC4 A;  2O6R A;  4BSU A;  1KOH A;  3DZE A;  4J4L A;  1A4Y A;  3G3A A;  2O6Q A;  3O6N A;  4LSX C;  1DFJ I;  2OMX A;  1KOO A;  4R58 A;  3FXI A;  4R07 A;  5GMG A;  3E3Z A;  3UL8 A;  2Z63 A;  3WPH A;  3O53 A;  4FS7 A;  2WQW A;  4QXE A;  4KT1 A;  3JB9 j;  4CIL A;  2A0Z A;  4R6G A;  2UZX A;  3RJ0 A;  1FT8 A;  3ZYI A;  4B8C D;  1OOK G;  4C2B B;  3RFJ A;  4ECN A;  3UN9 A;  4V2C A;  3WPI A;  4UFR A;  4LXR A;  4ARR A;  1W8A A;  1O6V A;  4YEB B;  1FS2 A;  4R6J A;  3A79 B;  4LI2 A;  3UL9 A;  4R5C A;  4Z79 A;  2OMU A;  1P9A G;  4U09 A;  4RCA B;  4U7L A;  2Z81 A;  4EZG A;  4R08 A; 
#chains in the Genus database with same CATH homology
 3CIY A;  2Z64 A;  3WPC A;  4RWT C;  4TZH A;  3E6J A;  4Z8G A;  4XOS A;  5B0N A;  1QYY A;  2V9S A;  5GQR K;  3RGZ A;  1P8V A;  3G04 C;  5B0T A;  1XKU A;  1Z7X W;  4MN8 B;  2OMY A;  2P1O B;  2P1M B;  1FO1 A;  4P8S A;  4FD0 A;  4ECO A;  4WYK A;  1PGV A;  2IFG A;  4IM6 A;  5AWD A;  4R6F A;  5HDH A;  3G3B A;  1M9L A;  4NKH A;  5FTT B;  1M10 B;  1OGQ A;  5IYX C;  4FDW A;  3GOZ A;  1D0B A;  3RFS A;  3ZYO A;  2CA6 A;  2P1Q B;  4LSC A;  3RGX A;  4U08 A;  3W3L A;  2R9U A;  3RIZ A;  2BNH A;  4R0A A;  2Z82 A;  1FQV A;  2ID5 A;  2OMV A;  3WPG A;  2Z62 A;  4LSA A;  4CC4 C;  2WQU A;  1ZIW A;  1H6T A;  4AW4 A;  3ZYJ A;  4QBZ A;  4FMZ A;  1O6S A;  1JL5 A;  3E2J A;  3ULV A;  2V9T B;  5AWC A;  4QC0 A;  4P91 A;  2XWT C;  4FCG A;  4Z61 C;  5CMP A;  4U06 A;  2ASS B;  3W3M A;  5A5C A;  4Q3G A;  5B4P A;  5AZ5 A;  1DS9 A;  1XWD C;  4PSJ A;  4LI1 A;  5IJB A;  1XEC A;  1A9N A;  3WPD A;  2ELL A;  4PKI G;  1G9U A;  1K5G C;  4R6A A;  2JQD A;  3W3K A;  1SQ0 B;  3UL7 A;  2FT3 A;  3C6N B;  2Q4G W;  5GMH A;  3ZYN A;  2XOT A;  4V2E A;  5GMF A;  4HQ1 A;  3WPE A;  4Z64 C;  4NKG A;  4XGO A;  3PMH G;  5LFN A;  1IO0 A;  3G39 A;  4LSX A;  3ULA A;  2AST B;  2O6S A;  4LXS A;  4BV4 R;  1OTM A;  4G8A A;  3TSR E;  4M7E C;  4BSR A;  1O6T A;  3E4G A;  1WWL A;  2JE0 A;  2RA8 A;  5IJC A;  5HZL B;  3G06 A;  3OGL B;  1U0N D;  1XCD A;  4Q3I A;  3C6P B;  2Y5Q A;  3RW6 A;  1K5D C;  1P8T A;  4L3A A;  3M19 A;  4AY9 X;  3CVR A;  3OJA B;  4BSS A;  4CNM A;  3W3G A;  2OMT A;  2P1N B;  4FHO A;  4R09 A;  4OQT A;  2WQV A;  5IJD A;  4C2A B;  1M0Z A;  3RW7 A;  1DCE A;  1M9S A;  2Z66 A;  1H6U A;  3OJA A;  3W3N A;  3RFE A;  3WPB A;  3KJ4 A;  4GLP A;  4I6J B;  2P1P B;  4CP6 A;  5AWA A;  3M18 A;  4KXF B;  5D3I A;  3CIG A;  2BEX A;  4RCW A;  4H09 A;  2JE1 A;  2Z7X B;  4MQW X;  3OGM B;  2V70 A;  2OMZ A;  4R5D A;  3C6O B;  4Q62 A;  1OTO A;  3VQ2 A;  4GT6 A;  4KNG A;  5AWB A;  3W3J A;  2Z65 A;  5GS2 B;  2UZY A;  3BZ5 A;  2RR6 A;  4WP6 A;  2Z7X A;  4PEQ B;  1OTN A;  3P72 A;  4M7E A;  3OGK B;  4K17 A;  4V2D A;  3WN4 A;  2WFH A;  3VQ1 A;  1LTX A;  4J0M A;  4PER A;  1XEU A;  2OMW A;  3REZ A;  5GS0 A;  5CMN A;  4PQ8 A;  1OZN A;  1YRG A;  1GWB A;  4L3F A;  4XSQ A;  4Z94 G;  4Y61 B;  4ARN A;  3SB4 A;  4CNC A;  3WPF A;  2WQX A;  3ULU A;  4CC4 A;  2O6R A;  4BSU A;  1KOH A;  3DZE A;  4J4L A;  1A4Y A;  3G3A A;  2O6Q A;  3O6N A;  4LSX C;  1DFJ I;  2OMX A;  1KOO A;  4R58 A;  3FXI A;  4R07 A;  5GMG A;  3E3Z A;  3UL8 A;  2Z63 A;  3WPH A;  3O53 A;  4FS7 A;  2WQW A;  4QXE A;  4KT1 A;  3JB9 j;  4CIL A;  2A0Z A;  4R6G A;  2UZX A;  3RJ0 A;  1FT8 A;  3ZYI A;  4B8C D;  1OOK G;  4C2B B;  3RFJ A;  4ECN A;  3UN9 A;  4V2C A;  3WPI A;  4UFR A;  4LXR A;  4ARR A;  1W8A A;  1O6V A;  4YEB B;  1FS2 A;  4R6J A;  3A79 B;  4LI2 A;  3UL9 A;  4R5C A;  4Z79 A;  2OMU A;  1P9A G;  4U09 A;  4RCA B;  4U7L A;  2Z81 A;  4EZG A;  4R08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...