4R6GA

Crystal structure of computational designed leucine rich repeats dlrr_k in space group p22121
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
464
structure length
464
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNNLANLNDRVFEGLTNLTTLNLSNNNLARLWKHANPGGPIYFLKGLTNLTTLNLSNNGFDELPKEVFKDLTSLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTSLTTLNLSNNQLTSLPKGVLERLTNLKTLNLSNNQITKEVCRHVAELLKQAASLHELHLSNNNIGEEGAAELVEALLHPGSTLETLDLSNCNLTKEACREIARALKQATTLHELHLSNNNIGEEGAAELVEALLHPGSTLETLDLSNCNLTKEACREIARALKQATSLHELHLSNNNIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords leucine rich repeats DLRR_K
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 167
structure length 464
sequence length 464
ec nomenclature
pdb deposition date 2014-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r6gA00
1H6TA 4R09A 4QXEA 4M7EC 1FQVA 2ASSB 2ELLA 4U08A 2Z81A 1KOHA 3UN9A 4UFRA 1D0BA 2OMUA 1A9NA 5B4PA 4I6JB 1OOKG 4M7EA 4AY9X 1IO0A 1XEUA 3DZEA 4H09A 4FS7A 3RFSA 4WYKA 4KXFB 2XWTC 4FD0A 4ECOA 3RJ0A 3RIZA 4L3AA 4GLPA 3W3KA 2RR6A 1JL5A 1W8AA 4WP6A 3VQ2A 3CIGA 4BSUA 4EZGA 4RCAB 4J4LA 2WQWA 1XWDC 4Z8GA 3OJAB 3WPGA 2UZXA 1SQ0B 2P1NB 1GWBA 4C2AB 1M0ZA 4FCGA 3PMHG 2O6QA 1P8TA 4FHOA 4R58A 3OJAA 4BSRA 4V2EA 3RFEA 2Z62A 4TZHA 2OMYA 1A4YA 4PERA 4V2CA 3VQ1A 4R6FA 3W3NA 3W3LA 1DCEA 1PGVA 5LFNA 3KJ4A 3RW7A 4P8SA 4QC0A 3RGZA 3CIYA 3CVRA 3G3AA 3SB4A 5AWCA 3OGKB 1FS2A 3ZYJA 1P9AG 2P1QB 3TSRE 5HDHA 3O53A 2V9SA 1G9UA 1FT8A 2OMXA 4XSQA 2V70A 4J0MA 3WPBA 4G8AA 2Q4GW 1WWLA 4YEBB 3E3ZA 1OTOA 5IJDA 1O6TA 3E6JA 3WN4A 2Z65A 4HQ1A 3ULAA 2OMZA 5A5CA 1P8VA 2BNHA 3RW6A 3RGXA 4XOSA 4LSXC 4V2DA 4Z94G 3ULVA 3ZYOA 2CA6A 1K5DC 4ECNA 4R08A 2OMVA 5IYXC 4Z61C 4LSXA 3WPFA 3UL9A 4C2BB 3JB9j 4R6AA 2JE0A 4P91A 2RA8A 2FT3A 4MN8B 2UZYA 1M9LA 2ASTB 3C6PB 4Q3IA 4Q62A 4R07A 1OTMA 3WPIA 4Q3GA 1DS9A 2Z64A 5CMPA 4Z79A 5AWBA 4LSCA 3WPEA 5IJCA 3ZYNA 4U09A 5GMFA 1LTXA 4LSAA 1K5GC 2R9UA 5D3IA 3ULUA 4GT6A 2WFHA 2OMTA 3W3MA 4K17A 1O6SA 1XCDA 2Z7XB 4ARNA 2O6SA 5GS2B 5AWDA 5AWAA 3UL8A 2Y5QA 2Z63A 1FO1A 1O6VA 4R0AA 3E2JA 4CNCA 2Z7XA 2A0ZA 5IJBA 2Z66A 4B8CD 3WPHA 4AW4A 1XECA 4PSJA 1KOOA 3C6NB 4Y61B 4U06A 4LI2A 2WQUA 3G3BA 3OGMB 2ID5A 4PEQB 4QBZA 3BZ5A 3G06A 3UL7A 3OGLB 5GMGA 4R5DA 1Z7XW 4KNGA 4CILA 3WPCA 1OZNA 3W3GA 4FMZA 4NKGA 3FXIA 5B0TA 4R6JA 5AZ5A 2V9TB 1XKUA 4RCWA 4FDWA 4OQTA 4XGOA 3WPDA 1OTNA 3P72A 2WQXA 3REZA 4LXRA 3M19A 5FTTB 3GOZA 1OGQA 1H6UA 2IFGA 4R5CA 4ARRA 4PKIG 4IM6A 4CC4C 2O6RA 4MQWX 2Z82A 4CNMA 4LXSA 2P1PB 3ZYIA 3G04C 4L3FA 4BV4R 4CP6A 1M9SA 3G39A 4PQ8A 4CC4A 2WQVA 2P1OB 4KT1A 1YRGA 5GQRK 3A79B 3C6OB 2P1MB 2JE1A 5GMHA 4LI1A 2XOTA 3RFJA 5B0NA 2JQDA 4U7LA 1U0ND 2OMWA 4NKHA 5HZLB 5GS0A 4RWTC 4BSSA 3W3JA 3O6NA 3M18A 2BEXA 4Z64C 1M10B 3E4GA 1DFJI 4R6GA 1ZIWA 5CMNA 1QYYA
chains in the Genus database with same CATH superfamily
1H6TA 4R09A 4QXEA 4M7EC 1FQVA 4NZRM 2ASSB 2ELLA 4U08A 2Z81A 1KOHA 3UN9A 4UFRA 1D0BA 2OMUA 1A9NA 5B4PA 4I6JB 1OOKG 4M7EA 4AY9X 1IO0A 1XEUA 3DZEA 4H09A 4FS7A 3RFSA 4WYKA 4KXFB 2XWTC 4FD0A 4ECOA 3RJ0A 3RIZA 4L3AA 4GLPA 3W3KA 2RR6A 1JL5A 1W8AA 4WP6A 3VQ2A 3CIGA 4BSUA 4EZGA 4RCAB 4J4LA 2WQWA 1XWDC 4Z8GA 3OJAB 3WPGA 2UZXA 1SQ0B 2P1NB 1GWBA 4C2AB 1M0ZA 4FCGA 3PMHG 2O6QA 1P8TA 4FHOA 4R58A 3OJAA 4BSRA 4V2EA 3RFEA 2Z62A 4TZHA 2OMYA 1A4YA 4PERA 4V2CA 3VQ1A 4R6FA 3W3NA 3W3LA 1DCEA 1PGVA 5LFNA 3KJ4A 3RW7A 4P8SA 4QC0A 3RGZA 3CIYA 3CVRA 3G3AA 3SB4A 5AWCA 3OGKB 1FS2A 3ZYJA 1P9AG 2P1QB 3TSRE 5HDHA 3O53A 2V9SA 1G9UA 1FT8A 2OMXA 4XSQA 2V70A 4J0MA 3WPBA 4G8AA 2Q4GW 1WWLA 4YEBB 3E3ZA 1OTOA 5IJDA 1O6TA 3E6JA 3WN4A 2Z65A 4HQ1A 3ULAA 2OMZA 5A5CA 1P8VA 2BNHA 3RW6A 3RGXA 4XOSA 4LSXC 4V2DA 4Z94G 3ULVA 3ZYOA 2CA6A 1K5DC 4ECNA 4R08A 2OMVA 5IYXC 4Z61C 4LSXA 3WPFA 3UL9A 4C2BB 3JB9j 4R6AA 2JE0A 4P91A 2RA8A 2FT3A 4MN8B 2UZYA 1M9LA 2ASTB 3C6PB 4Q3IA 4Q62A 4R07A 1OTMA 3WPIA 4Q3GA 1DS9A 2Z64A 5CMPA 4Z79A 5AWBA 4LSCA 3WPEA 5IJCA 3ZYNA 4U09A 5GMFA 1LTXA 4LSAA 1K5GC 2R9UA 5D3IA 3ULUA 4GT6A 2WFHA 2OMTA 3W3MA 4K17A 1O6SA 1XCDA 2Z7XB 4ARNA 2O6SA 5GS2B 5AWDA 5AWAA 3UL8A 2Y5QA 2Z63A 1FO1A 1O6VA 4R0AA 3E2JA 4CNCA 2Z7XA 2A0ZA 5IJBA 2Z66A 4B8CD 3WPHA 4AW4A 1XECA 4PSJA 1KOOA 3C6NB 4Y61B 4U06A 4LI2A 2WQUA 3G3BA 3OGMB 2ID5A 4PEQB 4QBZA 3BZ5A 3G06A 3UL7A 3OGLB 5GMGA 4R5DA 1Z7XW 4KNGA 4CILA 3WPCA 1OZNA 4NZTM 3W3GA 4FMZA 4NKGA 3FXIA 5B0TA 4R6JA 5AZ5A 2V9TB 1XKUA 4RCWA 4FDWA 4OQTA 4XGOA 3WPDA 1OTNA 3P72A 2WQXA 3REZA 4LXRA 3M19A 5FTTB 3GOZA 1OGQA 1H6UA 2IFGA 4R5CA 4ARRA 4PKIG 4IM6A 4CC4C 2O6RA 4MQWX 2Z82A 4CNMA 4LXSA 2P1PB 3ZYIA 3G04C 4L3FA 4BV4R 4CP6A 1M9SA 3G39A 4PQ8A 4CC4A 2WQVA 2P1OB 4KT1A 1YRGA 5GQRK 3A79B 3C6OB 2P1MB 2JE1A 5GMHA 4LI1A 2XOTA 3RFJA 5B0NA 2JQDA 4U7LA 1U0ND 2OMWA 4NKHA 5HZLB 5GS0A 4RWTC 4BSSA 3W3JA 3O6NA 3M18A 2BEXA 4Z64C 1M10B 3E4GA 1DFJI 4R6GA 1ZIWA 5CMNA 1QYYA
chains in the Genus database with same CATH topology
1H6TA 4R09A 4QXEA 4M7EC 1FQVA 2ASSB 2ELLA 4U08A 2Z81A 1KOHA 3UN9A 4UFRA 1D0BA 2OMUA 1A9NA 5B4PA 4I6JB 1OOKG 4M7EA 4AY9X 1IO0A 1XEUA 3DZEA 4H09A 4FS7A 3RFSA 4WYKA 4KXFB 2XWTC 4FD0A 4ECOA 3RJ0A 3RIZA 4L3AA 4GLPA 3W3KA 2RR6A 1JL5A 1W8AA 4WP6A 3VQ2A 3CIGA 4BSUA 4EZGA 4RCAB 4J4LA 2WQWA 1XWDC 4Z8GA 3OJAB 3WPGA 2UZXA 1SQ0B 2P1NB 1GWBA 4C2AB 1M0ZA 4FCGA 3PMHG 2O6QA 1P8TA 4FHOA 4R58A 3OJAA 4BSRA 4V2EA 3RFEA 2Z62A 4TZHA 2OMYA 1A4YA 4PERA 4V2CA 3VQ1A 4R6FA 3W3NA 3W3LA 1DCEA 1PGVA 5LFNA 3KJ4A 3RW7A 4P8SA 4QC0A 3RGZA 3CIYA 3CVRA 3G3AA 3SB4A 5AWCA 3OGKB 1FS2A 3ZYJA 1P9AG 2P1QB 3TSRE 5HDHA 3O53A 2V9SA 1G9UA 1FT8A 2OMXA 4XSQA 2V70A 4J0MA 3WPBA 4G8AA 2Q4GW 1WWLA 4YEBB 3E3ZA 1OTOA 5IJDA 1O6TA 3E6JA 3WN4A 2Z65A 4HQ1A 3ULAA 2OMZA 5A5CA 1P8VA 2BNHA 3RW6A 3RGXA 4XOSA 4LSXC 4V2DA 4Z94G 3ULVA 3ZYOA 2CA6A 1K5DC 4ECNA 4R08A 2OMVA 5IYXC 4Z61C 4LSXA 3WPFA 3UL9A 4C2BB 3JB9j 4R6AA 2JE0A 4P91A 2RA8A 2FT3A 4MN8B 2UZYA 1M9LA 2ASTB 3C6PB 4Q3IA 4Q62A 4R07A 1OTMA 3WPIA 4Q3GA 1DS9A 2Z64A 5CMPA 4Z79A 5AWBA 4LSCA 3WPEA 5IJCA 3ZYNA 4U09A 5GMFA 1LTXA 4LSAA 1K5GC 2R9UA 5D3IA 3ULUA 4GT6A 2WFHA 2OMTA 3W3MA 4K17A 1O6SA 1XCDA 2Z7XB 4ARNA 2O6SA 5GS2B 5AWDA 5AWAA 3UL8A 2Y5QA 2Z63A 1FO1A 1O6VA 4R0AA 3E2JA 4CNCA 2Z7XA 2A0ZA 5IJBA 2Z66A 4B8CD 3WPHA 4AW4A 1XECA 4PSJA 1KOOA 3C6NB 4Y61B 4U06A 4LI2A 2WQUA 3G3BA 3OGMB 2ID5A 4PEQB 4QBZA 3BZ5A 3G06A 3UL7A 3OGLB 5GMGA 4R5DA 1Z7XW 4KNGA 4CILA 3WPCA 1OZNA 3W3GA 4FMZA 4NKGA 3FXIA 5B0TA 4R6JA 5AZ5A 2V9TB 1XKUA 4RCWA 4FDWA 4OQTA 4XGOA 3WPDA 1OTNA 3P72A 2WQXA 3REZA 4LXRA 3M19A 5FTTB 3GOZA 1OGQA 1H6UA 2IFGA 4R5CA 4ARRA 4PKIG 4IM6A 4CC4C 2O6RA 4MQWX 2Z82A 4CNMA 4LXSA 2P1PB 3ZYIA 3G04C 4L3FA 4BV4R 4CP6A 1M9SA 3G39A 4PQ8A 4CC4A 2WQVA 2P1OB 4KT1A 1YRGA 5GQRK 3A79B 3C6OB 2P1MB 2JE1A 5GMHA 4LI1A 2XOTA 3RFJA 5B0NA 2JQDA 4U7LA 1U0ND 2OMWA 4NKHA 5HZLB 5GS0A 4RWTC 4BSSA 3W3JA 3O6NA 3M18A 2BEXA 4Z64C 1M10B 3E4GA 1DFJI 4R6GA 1ZIWA 5CMNA 1QYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6T A;  4R09 A;  4QXE A;  4M7E C;  1FQV A;  2ASS B;  2ELL A;  4U08 A;  2Z81 A;  1KOH A;  3UN9 A;  4UFR A;  1D0B A;  2OMU A;  1A9N A;  5B4P A;  4I6J B;  1OOK G;  4M7E A;  4AY9 X;  1IO0 A;  1XEU A;  3DZE A;  4H09 A;  4FS7 A;  3RFS A;  4WYK A;  4KXF B;  2XWT C;  4FD0 A;  4ECO A;  3RJ0 A;  3RIZ A;  4L3A A;  4GLP A;  3W3K A;  2RR6 A;  1JL5 A;  1W8A A;  4WP6 A;  3VQ2 A;  3CIG A;  4BSU A;  4EZG A;  4RCA B;  4J4L A;  2WQW A;  1XWD C;  4Z8G A;  3OJA B;  3WPG A;  2UZX A;  1SQ0 B;  2P1N B;  1GWB A;  4C2A B;  1M0Z A;  4FCG A;  3PMH G;  2O6Q A;  1P8T A;  4FHO A;  4R58 A;  3OJA A;  4BSR A;  4V2E A;  3RFE A;  2Z62 A;  4TZH A;  2OMY A;  1A4Y A;  4PER A;  4V2C A;  3VQ1 A;  4R6F A;  3W3N A;  3W3L A;  1DCE A;  1PGV A;  5LFN A;  3KJ4 A;  3RW7 A;  4P8S A;  4QC0 A;  3RGZ A;  3CIY A;  3CVR A;  3G3A A;  3SB4 A;  5AWC A;  3OGK B;  1FS2 A;  3ZYJ A;  1P9A G;  2P1Q B;  3TSR E;  5HDH A;  3O53 A;  2V9S A;  1G9U A;  1FT8 A;  2OMX A;  4XSQ A;  2V70 A;  4J0M A;  3WPB A;  4G8A A;  2Q4G W;  1WWL A;  4YEB B;  3E3Z A;  1OTO A;  5IJD A;  1O6T A;  3E6J A;  3WN4 A;  2Z65 A;  4HQ1 A;  3ULA A;  2OMZ A;  5A5C A;  1P8V A;  2BNH A;  3RW6 A;  3RGX A;  4XOS A;  4LSX C;  4V2D A;  4Z94 G;  3ULV A;  3ZYO A;  2CA6 A;  1K5D C;  4ECN A;  4R08 A;  2OMV A;  5IYX C;  4Z61 C;  4LSX A;  3WPF A;  3UL9 A;  4C2B B;  3JB9 j;  4R6A A;  2JE0 A;  4P91 A;  2RA8 A;  2FT3 A;  4MN8 B;  2UZY A;  1M9L A;  2AST B;  3C6P B;  4Q3I A;  4Q62 A;  4R07 A;  1OTM A;  3WPI A;  4Q3G A;  1DS9 A;  2Z64 A;  5CMP A;  4Z79 A;  5AWB A;  4LSC A;  3WPE A;  5IJC A;  3ZYN A;  4U09 A;  5GMF A;  1LTX A;  4LSA A;  1K5G C;  2R9U A;  5D3I A;  3ULU A;  4GT6 A;  2WFH A;  2OMT A;  3W3M A;  4K17 A;  1O6S A;  1XCD A;  2Z7X B;  4ARN A;  2O6S A;  5GS2 B;  5AWD A;  5AWA A;  3UL8 A;  2Y5Q A;  2Z63 A;  1FO1 A;  1O6V A;  4R0A A;  3E2J A;  4CNC A;  2Z7X A;  2A0Z A;  5IJB A;  2Z66 A;  4B8C D;  3WPH A;  4AW4 A;  1XEC A;  4PSJ A;  1KOO A;  3C6N B;  4Y61 B;  4U06 A;  4LI2 A;  2WQU A;  3G3B A;  3OGM B;  2ID5 A;  4PEQ B;  4QBZ A;  3BZ5 A;  3G06 A;  3UL7 A;  3OGL B;  5GMG A;  4R5D A;  1Z7X W;  4KNG A;  4CIL A;  3WPC A;  1OZN A;  3W3G A;  4FMZ A;  4NKG A;  3FXI A;  5B0T A;  4R6J A;  5AZ5 A;  2V9T B;  1XKU A;  4RCW A;  4FDW A;  4OQT A;  4XGO A;  3WPD A;  1OTN A;  3P72 A;  2WQX A;  3REZ A;  4LXR A;  3M19 A;  5FTT B;  3GOZ A;  1OGQ A;  1H6U A;  2IFG A;  4R5C A;  4ARR A;  4PKI G;  4IM6 A;  4CC4 C;  2O6R A;  4MQW X;  2Z82 A;  4CNM A;  4LXS A;  2P1P B;  3ZYI A;  3G04 C;  4L3F A;  4BV4 R;  4CP6 A;  1M9S A;  3G39 A;  4PQ8 A;  4CC4 A;  2WQV A;  2P1O B;  4KT1 A;  1YRG A;  5GQR K;  3A79 B;  3C6O B;  2P1M B;  2JE1 A;  5GMH A;  4LI1 A;  2XOT A;  3RFJ A;  5B0N A;  2JQD A;  4U7L A;  1U0N D;  2OMW A;  4NKH A;  5HZL B;  5GS0 A;  4RWT C;  4BSS A;  3W3J A;  3O6N A;  3M18 A;  2BEX A;  4Z64 C;  1M10 B;  3E4G A;  1DFJ I;  4R6G A;  1ZIW A;  5CMN A;  1QYY A; 
#chains in the Genus database with same CATH topology
 1H6T A;  4R09 A;  4QXE A;  4M7E C;  1FQV A;  4NZR M;  2ASS B;  2ELL A;  4U08 A;  2Z81 A;  1KOH A;  3UN9 A;  4UFR A;  1D0B A;  2OMU A;  1A9N A;  5B4P A;  4I6J B;  1OOK G;  4M7E A;  4AY9 X;  1IO0 A;  1XEU A;  3DZE A;  4H09 A;  4FS7 A;  3RFS A;  4WYK A;  4KXF B;  2XWT C;  4FD0 A;  4ECO A;  3RJ0 A;  3RIZ A;  4L3A A;  4GLP A;  3W3K A;  2RR6 A;  1JL5 A;  1W8A A;  4WP6 A;  3VQ2 A;  3CIG A;  4BSU A;  4EZG A;  4RCA B;  4J4L A;  2WQW A;  1XWD C;  4Z8G A;  3OJA B;  3WPG A;  2UZX A;  1SQ0 B;  2P1N B;  1GWB A;  4C2A B;  1M0Z A;  4FCG A;  3PMH G;  2O6Q A;  1P8T A;  4FHO A;  4R58 A;  3OJA A;  4BSR A;  4V2E A;  3RFE A;  2Z62 A;  4TZH A;  2OMY A;  1A4Y A;  4PER A;  4V2C A;  3VQ1 A;  4R6F A;  3W3N A;  3W3L A;  1DCE A;  1PGV A;  5LFN A;  3KJ4 A;  3RW7 A;  4P8S A;  4QC0 A;  3RGZ A;  3CIY A;  3CVR A;  3G3A A;  3SB4 A;  5AWC A;  3OGK B;  1FS2 A;  3ZYJ A;  1P9A G;  2P1Q B;  3TSR E;  5HDH A;  3O53 A;  2V9S A;  1G9U A;  1FT8 A;  2OMX A;  4XSQ A;  2V70 A;  4J0M A;  3WPB A;  4G8A A;  2Q4G W;  1WWL A;  4YEB B;  3E3Z A;  1OTO A;  5IJD A;  1O6T A;  3E6J A;  3WN4 A;  2Z65 A;  4HQ1 A;  3ULA A;  2OMZ A;  5A5C A;  1P8V A;  2BNH A;  3RW6 A;  3RGX A;  4XOS A;  4LSX C;  4V2D A;  4Z94 G;  3ULV A;  3ZYO A;  2CA6 A;  1K5D C;  4ECN A;  4R08 A;  2OMV A;  5IYX C;  4Z61 C;  4LSX A;  3WPF A;  3UL9 A;  4C2B B;  3JB9 j;  4R6A A;  2JE0 A;  4P91 A;  2RA8 A;  2FT3 A;  4MN8 B;  2UZY A;  1M9L A;  2AST B;  3C6P B;  4Q3I A;  4Q62 A;  4R07 A;  1OTM A;  3WPI A;  4Q3G A;  1DS9 A;  2Z64 A;  5CMP A;  4Z79 A;  5AWB A;  4LSC A;  3WPE A;  5IJC A;  3ZYN A;  4U09 A;  5GMF A;  1LTX A;  4LSA A;  1K5G C;  2R9U A;  5D3I A;  3ULU A;  4GT6 A;  2WFH A;  2OMT A;  3W3M A;  4K17 A;  1O6S A;  1XCD A;  2Z7X B;  4ARN A;  2O6S A;  5GS2 B;  5AWD A;  5AWA A;  3UL8 A;  2Y5Q A;  2Z63 A;  1FO1 A;  1O6V A;  4R0A A;  3E2J A;  4CNC A;  2Z7X A;  2A0Z A;  5IJB A;  2Z66 A;  4B8C D;  3WPH A;  4AW4 A;  1XEC A;  4PSJ A;  1KOO A;  3C6N B;  4Y61 B;  4U06 A;  4LI2 A;  2WQU A;  3G3B A;  3OGM B;  2ID5 A;  4PEQ B;  4QBZ A;  3BZ5 A;  3G06 A;  3UL7 A;  3OGL B;  5GMG A;  4R5D A;  1Z7X W;  4KNG A;  4CIL A;  3WPC A;  1OZN A;  4NZT M;  3W3G A;  4FMZ A;  4NKG A;  3FXI A;  5B0T A;  4R6J A;  5AZ5 A;  2V9T B;  1XKU A;  4RCW A;  4FDW A;  4OQT A;  4XGO A;  3WPD A;  1OTN A;  3P72 A;  2WQX A;  3REZ A;  4LXR A;  3M19 A;  5FTT B;  3GOZ A;  1OGQ A;  1H6U A;  2IFG A;  4R5C A;  4ARR A;  4PKI G;  4IM6 A;  4CC4 C;  2O6R A;  4MQW X;  2Z82 A;  4CNM A;  4LXS A;  2P1P B;  3ZYI A;  3G04 C;  4L3F A;  4BV4 R;  4CP6 A;  1M9S A;  3G39 A;  4PQ8 A;  4CC4 A;  2WQV A;  2P1O B;  4KT1 A;  1YRG A;  5GQR K;  3A79 B;  3C6O B;  2P1M B;  2JE1 A;  5GMH A;  4LI1 A;  2XOT A;  3RFJ A;  5B0N A;  2JQD A;  4U7L A;  1U0N D;  2OMW A;  4NKH A;  5HZL B;  5GS0 A;  4RWT C;  4BSS A;  3W3J A;  3O6N A;  3M18 A;  2BEX A;  4Z64 C;  1M10 B;  3E4G A;  1DFJ I;  4R6G A;  1ZIW A;  5CMN A;  1QYY A; 
#chains in the Genus database with same CATH homology
 1H6T A;  4R09 A;  4QXE A;  4M7E C;  1FQV A;  2ASS B;  2ELL A;  4U08 A;  2Z81 A;  1KOH A;  3UN9 A;  4UFR A;  1D0B A;  2OMU A;  1A9N A;  5B4P A;  4I6J B;  1OOK G;  4M7E A;  4AY9 X;  1IO0 A;  1XEU A;  3DZE A;  4H09 A;  4FS7 A;  3RFS A;  4WYK A;  4KXF B;  2XWT C;  4FD0 A;  4ECO A;  3RJ0 A;  3RIZ A;  4L3A A;  4GLP A;  3W3K A;  2RR6 A;  1JL5 A;  1W8A A;  4WP6 A;  3VQ2 A;  3CIG A;  4BSU A;  4EZG A;  4RCA B;  4J4L A;  2WQW A;  1XWD C;  4Z8G A;  3OJA B;  3WPG A;  2UZX A;  1SQ0 B;  2P1N B;  1GWB A;  4C2A B;  1M0Z A;  4FCG A;  3PMH G;  2O6Q A;  1P8T A;  4FHO A;  4R58 A;  3OJA A;  4BSR A;  4V2E A;  3RFE A;  2Z62 A;  4TZH A;  2OMY A;  1A4Y A;  4PER A;  4V2C A;  3VQ1 A;  4R6F A;  3W3N A;  3W3L A;  1DCE A;  1PGV A;  5LFN A;  3KJ4 A;  3RW7 A;  4P8S A;  4QC0 A;  3RGZ A;  3CIY A;  3CVR A;  3G3A A;  3SB4 A;  5AWC A;  3OGK B;  1FS2 A;  3ZYJ A;  1P9A G;  2P1Q B;  3TSR E;  5HDH A;  3O53 A;  2V9S A;  1G9U A;  1FT8 A;  2OMX A;  4XSQ A;  2V70 A;  4J0M A;  3WPB A;  4G8A A;  2Q4G W;  1WWL A;  4YEB B;  3E3Z A;  1OTO A;  5IJD A;  1O6T A;  3E6J A;  3WN4 A;  2Z65 A;  4HQ1 A;  3ULA A;  2OMZ A;  5A5C A;  1P8V A;  2BNH A;  3RW6 A;  3RGX A;  4XOS A;  4LSX C;  4V2D A;  4Z94 G;  3ULV A;  3ZYO A;  2CA6 A;  1K5D C;  4ECN A;  4R08 A;  2OMV A;  5IYX C;  4Z61 C;  4LSX A;  3WPF A;  3UL9 A;  4C2B B;  3JB9 j;  4R6A A;  2JE0 A;  4P91 A;  2RA8 A;  2FT3 A;  4MN8 B;  2UZY A;  1M9L A;  2AST B;  3C6P B;  4Q3I A;  4Q62 A;  4R07 A;  1OTM A;  3WPI A;  4Q3G A;  1DS9 A;  2Z64 A;  5CMP A;  4Z79 A;  5AWB A;  4LSC A;  3WPE A;  5IJC A;  3ZYN A;  4U09 A;  5GMF A;  1LTX A;  4LSA A;  1K5G C;  2R9U A;  5D3I A;  3ULU A;  4GT6 A;  2WFH A;  2OMT A;  3W3M A;  4K17 A;  1O6S A;  1XCD A;  2Z7X B;  4ARN A;  2O6S A;  5GS2 B;  5AWD A;  5AWA A;  3UL8 A;  2Y5Q A;  2Z63 A;  1FO1 A;  1O6V A;  4R0A A;  3E2J A;  4CNC A;  2Z7X A;  2A0Z A;  5IJB A;  2Z66 A;  4B8C D;  3WPH A;  4AW4 A;  1XEC A;  4PSJ A;  1KOO A;  3C6N B;  4Y61 B;  4U06 A;  4LI2 A;  2WQU A;  3G3B A;  3OGM B;  2ID5 A;  4PEQ B;  4QBZ A;  3BZ5 A;  3G06 A;  3UL7 A;  3OGL B;  5GMG A;  4R5D A;  1Z7X W;  4KNG A;  4CIL A;  3WPC A;  1OZN A;  3W3G A;  4FMZ A;  4NKG A;  3FXI A;  5B0T A;  4R6J A;  5AZ5 A;  2V9T B;  1XKU A;  4RCW A;  4FDW A;  4OQT A;  4XGO A;  3WPD A;  1OTN A;  3P72 A;  2WQX A;  3REZ A;  4LXR A;  3M19 A;  5FTT B;  3GOZ A;  1OGQ A;  1H6U A;  2IFG A;  4R5C A;  4ARR A;  4PKI G;  4IM6 A;  4CC4 C;  2O6R A;  4MQW X;  2Z82 A;  4CNM A;  4LXS A;  2P1P B;  3ZYI A;  3G04 C;  4L3F A;  4BV4 R;  4CP6 A;  1M9S A;  3G39 A;  4PQ8 A;  4CC4 A;  2WQV A;  2P1O B;  4KT1 A;  1YRG A;  5GQR K;  3A79 B;  3C6O B;  2P1M B;  2JE1 A;  5GMH A;  4LI1 A;  2XOT A;  3RFJ A;  5B0N A;  2JQD A;  4U7L A;  1U0N D;  2OMW A;  4NKH A;  5HZL B;  5GS0 A;  4RWT C;  4BSS A;  3W3J A;  3O6N A;  3M18 A;  2BEX A;  4Z64 C;  1M10 B;  3E4G A;  1DFJ I;  4R6G A;  1ZIW A;  5CMN A;  1QYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...