2O6SA

Structural diversity of the hagfish variable lymphocyte receptors b59
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
CPSRCSCSGTTVECYSQGRTSVPTGIPAQTTYLDLETNSLKSLPNGVFDELTSLTQLYLGGNKLQSLPNGVFNKLTSLTYLNLSTNQLQSLPNGVFDKLTQLKELALNTNQLQSLPDGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Variable lymphocyte receptor B
publication title Structural diversity of the hagfish variable lymphocyte receptors
pubmed doi rcsb
source organism Eptatretus burgeri
total genus 59
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2o6sA00
1DS9A 5FTTB 1K5GC 2O6QA 4P8SA 4Z94G 2P1MB 5A5CA 4ARNA 3W3KA 4Z79A 1D0BA 4J0MA 2Z7XB 4GLPA 4U09A 4LSXA 4BSRA 5IYXC 4R5CA 4CILA 2UZYA 4UFRA 5GMGA 1M9SA 5D3IA 4R5DA 1XEUA 4NKHA 2XOTA 2BNHA 4U7LA 1FT8A 4B8CD 5HDHA 4PQ8A 3RIZA 1O6VA 4XOSA 3OGKB 3ULVA 1H6TA 2R9UA 3W3LA 1OGQA 1Z7XW 1KOHA 3WPEA 2WQXA 4RWTC 3E6JA 4XSQA 2WFHA 2P1PB 5IJDA 4Q3IA 3UL8A 2RR6A 4LXSA 4OQTA 2Z66A 4U06A 4RCAB 3BZ5A 1M9LA 4R07A 2A0ZA 1P8TA 1O6SA 4BSUA 3RGZA 3WPCA 2OMXA 2XWTC 5AZ5A 4WP6A 3WPBA 1LTXA 1FS2A 3C6NB 3UL9A 4V2CA 4QBZA 4PEQB 3RFEA 1P8VA 4FDWA 4LI1A 1K5DC 3REZA 1WWLA 2JQDA 3VQ2A 1A9NA 4M7EC 4CNMA 3RW6A 2P1OB 4KNGA 4L3AA 3DZEA 4YEBB 4R6GA 3C6PB 4CC4A 3TSRE 4FD0A 4KT1A 5B4PA 4HQ1A 4R08A 4LI2A 4I6JB 4FCGA 3C6OB 3M19A 4FMZA 3W3MA 4LSCA 2Z65A 5GS2B 2OMYA 4ECOA 2OMUA 1FO1A 4XGOA 3G06A 3E2JA 2Z81A 3SB4A 1OTNA 2P1NB 5HZLB 4H09A 5GMFA 2Z82A 4TZHA 3W3GA 3ZYNA 5B0TA 1OTOA 2Z64A 4RCWA 3ZYJA 4Z64C 5CMNA 4FHOA 3WN4A 4GT6A 3M18A 3CIGA 4QC0A 1KOOA 2OMTA 4C2AB 4FS7A 3RW7A 5IJBA 3WPHA 4CP6A 3CIYA 2CA6A 4BV4R 1DFJI 4CNCA 3OGMB 3FXIA 3JB9j 4LXRA 3OJAA 4R09A 3G39A 5AWBA 2WQUA 2V9TB 2O6SA 2IFGA 4R58A 4R6FA 5IJCA 5AWDA 4Q3GA 1QYYA 1DCEA 2ELLA 4AY9X 4R0AA 1OZNA 2V70A 2FT3A 1JL5A 5LFNA 3PMHG 4AW4A 3UL7A 2BEXA 4LSXC 2OMWA 2JE0A 2O6RA 3ZYOA 2Q4GW 3ULUA 3WPFA 1M0ZA 4BSSA 4Z61C 4V2EA 4C2BB 1OOKG 2V9SA 2Z7XA 3G3AA 3ULAA 2ASTB 3W3NA 2ASSB 4KXFB 5CMPA 3P72A 2WQVA 2WQWA 4Y61B 4M7EA 2Z63A 3WPGA 1P9AG 5B0NA 4NKGA 1FQVA 4QXEA 3E4GA 3O6NA 4R6AA 3WPDA 4K17A 4ARRA 1OTMA 4LSAA 2OMVA 1G9UA 4PKIG 3RFSA 1M10B 3UN9A 1U0ND 1O6TA 1SQ0B 4WYKA 3G04C 3A79B 1XKUA 4G8AA 4ECNA 3CVRA 1YRGA 1IO0A 1XWDC 5GS0A 5GQRK 4R6JA 3KJ4A 3RJ0A 2P1QB 4V2DA 4Z8GA 3RFJA 3GOZA 2ID5A 1A4YA 1H6UA 2Y5QA 1ZIWA 5AWAA 3OGLB 4MN8B 1PGVA 3OJAB 4IM6A 4Q62A 3W3JA 4J4LA 3WPIA 5AWCA 2Z62A 2OMZA 5GMHA 3O53A 3E3ZA 4CC4C 4PERA 4EZGA 3G3BA 1XECA 1GWBA 4L3FA 3ZYIA 1XCDA 4PSJA 4P91A 2JE1A 3RGXA 4U08A 2RA8A 4MQWX 1W8AA 2UZXA 3VQ1A
chains in the Genus database with same CATH superfamily
1DS9A 5FTTB 1K5GC 2O6QA 4P8SA 4Z94G 2P1MB 5A5CA 4ARNA 3W3KA 4Z79A 1D0BA 4J0MA 2Z7XB 4GLPA 4U09A 4LSXA 4BSRA 5IYXC 4R5CA 4CILA 2UZYA 4UFRA 5GMGA 1M9SA 5D3IA 4R5DA 1XEUA 4NKHA 2XOTA 2BNHA 4U7LA 1FT8A 4B8CD 5HDHA 4PQ8A 3RIZA 1O6VA 4XOSA 3OGKB 3ULVA 1H6TA 2R9UA 3W3LA 1OGQA 1Z7XW 1KOHA 3WPEA 2WQXA 4RWTC 3E6JA 4XSQA 2WFHA 2P1PB 5IJDA 4Q3IA 3UL8A 2RR6A 4LXSA 4OQTA 2Z66A 4U06A 4RCAB 3BZ5A 1M9LA 4R07A 2A0ZA 1P8TA 1O6SA 4BSUA 3RGZA 3WPCA 2OMXA 2XWTC 5AZ5A 4WP6A 3WPBA 1LTXA 1FS2A 3C6NB 3UL9A 4V2CA 4QBZA 4PEQB 3RFEA 1P8VA 4FDWA 4LI1A 1K5DC 3REZA 1WWLA 2JQDA 3VQ2A 1A9NA 4M7EC 4CNMA 3RW6A 2P1OB 4KNGA 4L3AA 3DZEA 4YEBB 4R6GA 3C6PB 4CC4A 3TSRE 4FD0A 4KT1A 5B4PA 4HQ1A 4R08A 4LI2A 4I6JB 4FCGA 3C6OB 3M19A 4FMZA 3W3MA 4LSCA 2Z65A 5GS2B 2OMYA 4ECOA 2OMUA 1FO1A 4XGOA 3G06A 3E2JA 2Z81A 3SB4A 1OTNA 2P1NB 5HZLB 4H09A 5GMFA 2Z82A 4TZHA 3W3GA 3ZYNA 5B0TA 1OTOA 2Z64A 4RCWA 3ZYJA 4Z64C 5CMNA 4FHOA 3WN4A 4GT6A 3M18A 3CIGA 4QC0A 1KOOA 2OMTA 4C2AB 4FS7A 3RW7A 5IJBA 3WPHA 4CP6A 3CIYA 2CA6A 4BV4R 1DFJI 4CNCA 3OGMB 3FXIA 3JB9j 4LXRA 3OJAA 4R09A 4NZTM 3G39A 5AWBA 2WQUA 2V9TB 2O6SA 2IFGA 4R58A 4R6FA 5IJCA 5AWDA 4Q3GA 1QYYA 1DCEA 2ELLA 4AY9X 4R0AA 1OZNA 2V70A 2FT3A 1JL5A 5LFNA 3PMHG 4NZRM 4AW4A 3UL7A 2BEXA 4LSXC 2OMWA 2JE0A 2O6RA 3ZYOA 2Q4GW 3ULUA 3WPFA 1M0ZA 4BSSA 4Z61C 4V2EA 4C2BB 1OOKG 2V9SA 2Z7XA 3G3AA 3ULAA 2ASTB 3W3NA 2ASSB 4KXFB 5CMPA 3P72A 2WQVA 2WQWA 4Y61B 4M7EA 2Z63A 3WPGA 1P9AG 5B0NA 4NKGA 1FQVA 4QXEA 3E4GA 3O6NA 4R6AA 3WPDA 4K17A 4ARRA 1OTMA 4LSAA 2OMVA 1G9UA 4PKIG 3RFSA 1M10B 3UN9A 1U0ND 1O6TA 1SQ0B 4WYKA 3G04C 3A79B 1XKUA 4G8AA 4ECNA 3CVRA 1YRGA 1IO0A 1XWDC 5GS0A 5GQRK 4R6JA 3KJ4A 3RJ0A 2P1QB 4V2DA 4Z8GA 3RFJA 3GOZA 2ID5A 1A4YA 1H6UA 2Y5QA 1ZIWA 5AWAA 3OGLB 4MN8B 1PGVA 3OJAB 4IM6A 4Q62A 3W3JA 4J4LA 3WPIA 5AWCA 2Z62A 2OMZA 5GMHA 3O53A 3E3ZA 4CC4C 4PERA 4EZGA 3G3BA 1XECA 1GWBA 4L3FA 3ZYIA 1XCDA 4PSJA 4P91A 2JE1A 3RGXA 4U08A 2RA8A 4MQWX 1W8AA 2UZXA 3VQ1A
chains in the Genus database with same CATH topology
1DS9A 5FTTB 1K5GC 2O6QA 4P8SA 4Z94G 2P1MB 5A5CA 4ARNA 3W3KA 4Z79A 1D0BA 4J0MA 2Z7XB 4GLPA 4U09A 4LSXA 4BSRA 5IYXC 4R5CA 4CILA 2UZYA 4UFRA 5GMGA 1M9SA 5D3IA 4R5DA 1XEUA 4NKHA 2XOTA 2BNHA 4U7LA 1FT8A 4B8CD 5HDHA 4PQ8A 3RIZA 1O6VA 4XOSA 3OGKB 3ULVA 1H6TA 2R9UA 3W3LA 1OGQA 1Z7XW 1KOHA 3WPEA 2WQXA 4RWTC 3E6JA 4XSQA 2WFHA 2P1PB 5IJDA 4Q3IA 3UL8A 2RR6A 4LXSA 4OQTA 2Z66A 4U06A 4RCAB 3BZ5A 1M9LA 4R07A 2A0ZA 1P8TA 1O6SA 4BSUA 3RGZA 3WPCA 2OMXA 2XWTC 5AZ5A 4WP6A 3WPBA 1LTXA 1FS2A 3C6NB 3UL9A 4V2CA 4QBZA 4PEQB 3RFEA 1P8VA 4FDWA 4LI1A 1K5DC 3REZA 1WWLA 2JQDA 3VQ2A 1A9NA 4M7EC 4CNMA 3RW6A 2P1OB 4KNGA 4L3AA 3DZEA 4YEBB 4R6GA 3C6PB 4CC4A 3TSRE 4FD0A 4KT1A 5B4PA 4HQ1A 4R08A 4LI2A 4I6JB 4FCGA 3C6OB 3M19A 4FMZA 3W3MA 4LSCA 2Z65A 5GS2B 2OMYA 4ECOA 2OMUA 1FO1A 4XGOA 3G06A 3E2JA 2Z81A 3SB4A 1OTNA 2P1NB 5HZLB 4H09A 5GMFA 2Z82A 4TZHA 3W3GA 3ZYNA 5B0TA 1OTOA 2Z64A 4RCWA 3ZYJA 4Z64C 5CMNA 4FHOA 3WN4A 4GT6A 3M18A 3CIGA 4QC0A 1KOOA 2OMTA 4C2AB 4FS7A 3RW7A 5IJBA 3WPHA 4CP6A 3CIYA 2CA6A 4BV4R 1DFJI 4CNCA 3OGMB 3FXIA 3JB9j 4LXRA 3OJAA 4R09A 3G39A 5AWBA 2WQUA 2V9TB 2O6SA 2IFGA 4R58A 4R6FA 5IJCA 5AWDA 4Q3GA 1QYYA 1DCEA 2ELLA 4AY9X 4R0AA 1OZNA 2V70A 2FT3A 1JL5A 5LFNA 3PMHG 4AW4A 3UL7A 2BEXA 4LSXC 2OMWA 2JE0A 2O6RA 3ZYOA 2Q4GW 3ULUA 3WPFA 1M0ZA 4BSSA 4Z61C 4V2EA 4C2BB 1OOKG 2V9SA 2Z7XA 3G3AA 3ULAA 2ASTB 3W3NA 2ASSB 4KXFB 5CMPA 3P72A 2WQVA 2WQWA 4Y61B 4M7EA 2Z63A 3WPGA 1P9AG 5B0NA 4NKGA 1FQVA 4QXEA 3E4GA 3O6NA 4R6AA 3WPDA 4K17A 4ARRA 1OTMA 4LSAA 2OMVA 1G9UA 4PKIG 3RFSA 1M10B 3UN9A 1U0ND 1O6TA 1SQ0B 4WYKA 3G04C 3A79B 1XKUA 4G8AA 4ECNA 3CVRA 1YRGA 1IO0A 1XWDC 5GS0A 5GQRK 4R6JA 3KJ4A 3RJ0A 2P1QB 4V2DA 4Z8GA 3RFJA 3GOZA 2ID5A 1A4YA 1H6UA 2Y5QA 1ZIWA 5AWAA 3OGLB 4MN8B 1PGVA 3OJAB 4IM6A 4Q62A 3W3JA 4J4LA 3WPIA 5AWCA 2Z62A 2OMZA 5GMHA 3O53A 3E3ZA 4CC4C 4PERA 4EZGA 3G3BA 1XECA 1GWBA 4L3FA 3ZYIA 1XCDA 4PSJA 4P91A 2JE1A 3RGXA 4U08A 2RA8A 4MQWX 1W8AA 2UZXA 3VQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DS9 A;  5FTT B;  1K5G C;  2O6Q A;  4P8S A;  4Z94 G;  2P1M B;  5A5C A;  4ARN A;  3W3K A;  4Z79 A;  1D0B A;  4J0M A;  2Z7X B;  4GLP A;  4U09 A;  4LSX A;  4BSR A;  5IYX C;  4R5C A;  4CIL A;  2UZY A;  4UFR A;  5GMG A;  1M9S A;  5D3I A;  4R5D A;  1XEU A;  4NKH A;  2XOT A;  2BNH A;  4U7L A;  1FT8 A;  4B8C D;  5HDH A;  4PQ8 A;  3RIZ A;  1O6V A;  4XOS A;  3OGK B;  3ULV A;  1H6T A;  2R9U A;  3W3L A;  1OGQ A;  1Z7X W;  1KOH A;  3WPE A;  2WQX A;  4RWT C;  3E6J A;  4XSQ A;  2WFH A;  2P1P B;  5IJD A;  4Q3I A;  3UL8 A;  2RR6 A;  4LXS A;  4OQT A;  2Z66 A;  4U06 A;  4RCA B;  3BZ5 A;  1M9L A;  4R07 A;  2A0Z A;  1P8T A;  1O6S A;  4BSU A;  3RGZ A;  3WPC A;  2OMX A;  2XWT C;  5AZ5 A;  4WP6 A;  3WPB A;  1LTX A;  1FS2 A;  3C6N B;  3UL9 A;  4V2C A;  4QBZ A;  4PEQ B;  3RFE A;  1P8V A;  4FDW A;  4LI1 A;  1K5D C;  3REZ A;  1WWL A;  2JQD A;  3VQ2 A;  1A9N A;  4M7E C;  4CNM A;  3RW6 A;  2P1O B;  4KNG A;  4L3A A;  3DZE A;  4YEB B;  4R6G A;  3C6P B;  4CC4 A;  3TSR E;  4FD0 A;  4KT1 A;  5B4P A;  4HQ1 A;  4R08 A;  4LI2 A;  4I6J B;  4FCG A;  3C6O B;  3M19 A;  4FMZ A;  3W3M A;  4LSC A;  2Z65 A;  5GS2 B;  2OMY A;  4ECO A;  2OMU A;  1FO1 A;  4XGO A;  3G06 A;  3E2J A;  2Z81 A;  3SB4 A;  1OTN A;  2P1N B;  5HZL B;  4H09 A;  5GMF A;  2Z82 A;  4TZH A;  3W3G A;  3ZYN A;  5B0T A;  1OTO A;  2Z64 A;  4RCW A;  3ZYJ A;  4Z64 C;  5CMN A;  4FHO A;  3WN4 A;  4GT6 A;  3M18 A;  3CIG A;  4QC0 A;  1KOO A;  2OMT A;  4C2A B;  4FS7 A;  3RW7 A;  5IJB A;  3WPH A;  4CP6 A;  3CIY A;  2CA6 A;  4BV4 R;  1DFJ I;  4CNC A;  3OGM B;  3FXI A;  3JB9 j;  4LXR A;  3OJA A;  4R09 A;  3G39 A;  5AWB A;  2WQU A;  2V9T B;  2O6S A;  2IFG A;  4R58 A;  4R6F A;  5IJC A;  5AWD A;  4Q3G A;  1QYY A;  1DCE A;  2ELL A;  4AY9 X;  4R0A A;  1OZN A;  2V70 A;  2FT3 A;  1JL5 A;  5LFN A;  3PMH G;  4AW4 A;  3UL7 A;  2BEX A;  4LSX C;  2OMW A;  2JE0 A;  2O6R A;  3ZYO A;  2Q4G W;  3ULU A;  3WPF A;  1M0Z A;  4BSS A;  4Z61 C;  4V2E A;  4C2B B;  1OOK G;  2V9S A;  2Z7X A;  3G3A A;  3ULA A;  2AST B;  3W3N A;  2ASS B;  4KXF B;  5CMP A;  3P72 A;  2WQV A;  2WQW A;  4Y61 B;  4M7E A;  2Z63 A;  3WPG A;  1P9A G;  5B0N A;  4NKG A;  1FQV A;  4QXE A;  3E4G A;  3O6N A;  4R6A A;  3WPD A;  4K17 A;  4ARR A;  1OTM A;  4LSA A;  2OMV A;  1G9U A;  4PKI G;  3RFS A;  1M10 B;  3UN9 A;  1U0N D;  1O6T A;  1SQ0 B;  4WYK A;  3G04 C;  3A79 B;  1XKU A;  4G8A A;  4ECN A;  3CVR A;  1YRG A;  1IO0 A;  1XWD C;  5GS0 A;  5GQR K;  4R6J A;  3KJ4 A;  3RJ0 A;  2P1Q B;  4V2D A;  4Z8G A;  3RFJ A;  3GOZ A;  2ID5 A;  1A4Y A;  1H6U A;  2Y5Q A;  1ZIW A;  5AWA A;  3OGL B;  4MN8 B;  1PGV A;  3OJA B;  4IM6 A;  4Q62 A;  3W3J A;  4J4L A;  3WPI A;  5AWC A;  2Z62 A;  2OMZ A;  5GMH A;  3O53 A;  3E3Z A;  4CC4 C;  4PER A;  4EZG A;  3G3B A;  1XEC A;  1GWB A;  4L3F A;  3ZYI A;  1XCD A;  4PSJ A;  4P91 A;  2JE1 A;  3RGX A;  4U08 A;  2RA8 A;  4MQW X;  1W8A A;  2UZX A;  3VQ1 A; 
#chains in the Genus database with same CATH topology
 1DS9 A;  5FTT B;  1K5G C;  2O6Q A;  4P8S A;  4Z94 G;  2P1M B;  5A5C A;  4ARN A;  3W3K A;  4Z79 A;  1D0B A;  4J0M A;  2Z7X B;  4GLP A;  4U09 A;  4LSX A;  4BSR A;  5IYX C;  4R5C A;  4CIL A;  2UZY A;  4UFR A;  5GMG A;  1M9S A;  5D3I A;  4R5D A;  1XEU A;  4NKH A;  2XOT A;  2BNH A;  4U7L A;  1FT8 A;  4B8C D;  5HDH A;  4PQ8 A;  3RIZ A;  1O6V A;  4XOS A;  3OGK B;  3ULV A;  1H6T A;  2R9U A;  3W3L A;  1OGQ A;  1Z7X W;  1KOH A;  3WPE A;  2WQX A;  4RWT C;  3E6J A;  4XSQ A;  2WFH A;  2P1P B;  5IJD A;  4Q3I A;  3UL8 A;  2RR6 A;  4LXS A;  4OQT A;  2Z66 A;  4U06 A;  4RCA B;  3BZ5 A;  1M9L A;  4R07 A;  2A0Z A;  1P8T A;  1O6S A;  4BSU A;  3RGZ A;  3WPC A;  2OMX A;  2XWT C;  5AZ5 A;  4WP6 A;  3WPB A;  1LTX A;  1FS2 A;  3C6N B;  3UL9 A;  4V2C A;  4QBZ A;  4PEQ B;  3RFE A;  1P8V A;  4FDW A;  4LI1 A;  1K5D C;  3REZ A;  1WWL A;  2JQD A;  3VQ2 A;  1A9N A;  4M7E C;  4CNM A;  3RW6 A;  2P1O B;  4KNG A;  4L3A A;  3DZE A;  4YEB B;  4R6G A;  3C6P B;  4CC4 A;  3TSR E;  4FD0 A;  4KT1 A;  5B4P A;  4HQ1 A;  4R08 A;  4LI2 A;  4I6J B;  4FCG A;  3C6O B;  3M19 A;  4FMZ A;  3W3M A;  4LSC A;  2Z65 A;  5GS2 B;  2OMY A;  4ECO A;  2OMU A;  1FO1 A;  4XGO A;  3G06 A;  3E2J A;  2Z81 A;  3SB4 A;  1OTN A;  2P1N B;  5HZL B;  4H09 A;  5GMF A;  2Z82 A;  4TZH A;  3W3G A;  3ZYN A;  5B0T A;  1OTO A;  2Z64 A;  4RCW A;  3ZYJ A;  4Z64 C;  5CMN A;  4FHO A;  3WN4 A;  4GT6 A;  3M18 A;  3CIG A;  4QC0 A;  1KOO A;  2OMT A;  4C2A B;  4FS7 A;  3RW7 A;  5IJB A;  3WPH A;  4CP6 A;  3CIY A;  2CA6 A;  4BV4 R;  1DFJ I;  4CNC A;  3OGM B;  3FXI A;  3JB9 j;  4LXR A;  3OJA A;  4R09 A;  4NZT M;  3G39 A;  5AWB A;  2WQU A;  2V9T B;  2O6S A;  2IFG A;  4R58 A;  4R6F A;  5IJC A;  5AWD A;  4Q3G A;  1QYY A;  1DCE A;  2ELL A;  4AY9 X;  4R0A A;  1OZN A;  2V70 A;  2FT3 A;  1JL5 A;  5LFN A;  3PMH G;  4NZR M;  4AW4 A;  3UL7 A;  2BEX A;  4LSX C;  2OMW A;  2JE0 A;  2O6R A;  3ZYO A;  2Q4G W;  3ULU A;  3WPF A;  1M0Z A;  4BSS A;  4Z61 C;  4V2E A;  4C2B B;  1OOK G;  2V9S A;  2Z7X A;  3G3A A;  3ULA A;  2AST B;  3W3N A;  2ASS B;  4KXF B;  5CMP A;  3P72 A;  2WQV A;  2WQW A;  4Y61 B;  4M7E A;  2Z63 A;  3WPG A;  1P9A G;  5B0N A;  4NKG A;  1FQV A;  4QXE A;  3E4G A;  3O6N A;  4R6A A;  3WPD A;  4K17 A;  4ARR A;  1OTM A;  4LSA A;  2OMV A;  1G9U A;  4PKI G;  3RFS A;  1M10 B;  3UN9 A;  1U0N D;  1O6T A;  1SQ0 B;  4WYK A;  3G04 C;  3A79 B;  1XKU A;  4G8A A;  4ECN A;  3CVR A;  1YRG A;  1IO0 A;  1XWD C;  5GS0 A;  5GQR K;  4R6J A;  3KJ4 A;  3RJ0 A;  2P1Q B;  4V2D A;  4Z8G A;  3RFJ A;  3GOZ A;  2ID5 A;  1A4Y A;  1H6U A;  2Y5Q A;  1ZIW A;  5AWA A;  3OGL B;  4MN8 B;  1PGV A;  3OJA B;  4IM6 A;  4Q62 A;  3W3J A;  4J4L A;  3WPI A;  5AWC A;  2Z62 A;  2OMZ A;  5GMH A;  3O53 A;  3E3Z A;  4CC4 C;  4PER A;  4EZG A;  3G3B A;  1XEC A;  1GWB A;  4L3F A;  3ZYI A;  1XCD A;  4PSJ A;  4P91 A;  2JE1 A;  3RGX A;  4U08 A;  2RA8 A;  4MQW X;  1W8A A;  2UZX A;  3VQ1 A; 
#chains in the Genus database with same CATH homology
 1DS9 A;  5FTT B;  1K5G C;  2O6Q A;  4P8S A;  4Z94 G;  2P1M B;  5A5C A;  4ARN A;  3W3K A;  4Z79 A;  1D0B A;  4J0M A;  2Z7X B;  4GLP A;  4U09 A;  4LSX A;  4BSR A;  5IYX C;  4R5C A;  4CIL A;  2UZY A;  4UFR A;  5GMG A;  1M9S A;  5D3I A;  4R5D A;  1XEU A;  4NKH A;  2XOT A;  2BNH A;  4U7L A;  1FT8 A;  4B8C D;  5HDH A;  4PQ8 A;  3RIZ A;  1O6V A;  4XOS A;  3OGK B;  3ULV A;  1H6T A;  2R9U A;  3W3L A;  1OGQ A;  1Z7X W;  1KOH A;  3WPE A;  2WQX A;  4RWT C;  3E6J A;  4XSQ A;  2WFH A;  2P1P B;  5IJD A;  4Q3I A;  3UL8 A;  2RR6 A;  4LXS A;  4OQT A;  2Z66 A;  4U06 A;  4RCA B;  3BZ5 A;  1M9L A;  4R07 A;  2A0Z A;  1P8T A;  1O6S A;  4BSU A;  3RGZ A;  3WPC A;  2OMX A;  2XWT C;  5AZ5 A;  4WP6 A;  3WPB A;  1LTX A;  1FS2 A;  3C6N B;  3UL9 A;  4V2C A;  4QBZ A;  4PEQ B;  3RFE A;  1P8V A;  4FDW A;  4LI1 A;  1K5D C;  3REZ A;  1WWL A;  2JQD A;  3VQ2 A;  1A9N A;  4M7E C;  4CNM A;  3RW6 A;  2P1O B;  4KNG A;  4L3A A;  3DZE A;  4YEB B;  4R6G A;  3C6P B;  4CC4 A;  3TSR E;  4FD0 A;  4KT1 A;  5B4P A;  4HQ1 A;  4R08 A;  4LI2 A;  4I6J B;  4FCG A;  3C6O B;  3M19 A;  4FMZ A;  3W3M A;  4LSC A;  2Z65 A;  5GS2 B;  2OMY A;  4ECO A;  2OMU A;  1FO1 A;  4XGO A;  3G06 A;  3E2J A;  2Z81 A;  3SB4 A;  1OTN A;  2P1N B;  5HZL B;  4H09 A;  5GMF A;  2Z82 A;  4TZH A;  3W3G A;  3ZYN A;  5B0T A;  1OTO A;  2Z64 A;  4RCW A;  3ZYJ A;  4Z64 C;  5CMN A;  4FHO A;  3WN4 A;  4GT6 A;  3M18 A;  3CIG A;  4QC0 A;  1KOO A;  2OMT A;  4C2A B;  4FS7 A;  3RW7 A;  5IJB A;  3WPH A;  4CP6 A;  3CIY A;  2CA6 A;  4BV4 R;  1DFJ I;  4CNC A;  3OGM B;  3FXI A;  3JB9 j;  4LXR A;  3OJA A;  4R09 A;  3G39 A;  5AWB A;  2WQU A;  2V9T B;  2O6S A;  2IFG A;  4R58 A;  4R6F A;  5IJC A;  5AWD A;  4Q3G A;  1QYY A;  1DCE A;  2ELL A;  4AY9 X;  4R0A A;  1OZN A;  2V70 A;  2FT3 A;  1JL5 A;  5LFN A;  3PMH G;  4AW4 A;  3UL7 A;  2BEX A;  4LSX C;  2OMW A;  2JE0 A;  2O6R A;  3ZYO A;  2Q4G W;  3ULU A;  3WPF A;  1M0Z A;  4BSS A;  4Z61 C;  4V2E A;  4C2B B;  1OOK G;  2V9S A;  2Z7X A;  3G3A A;  3ULA A;  2AST B;  3W3N A;  2ASS B;  4KXF B;  5CMP A;  3P72 A;  2WQV A;  2WQW A;  4Y61 B;  4M7E A;  2Z63 A;  3WPG A;  1P9A G;  5B0N A;  4NKG A;  1FQV A;  4QXE A;  3E4G A;  3O6N A;  4R6A A;  3WPD A;  4K17 A;  4ARR A;  1OTM A;  4LSA A;  2OMV A;  1G9U A;  4PKI G;  3RFS A;  1M10 B;  3UN9 A;  1U0N D;  1O6T A;  1SQ0 B;  4WYK A;  3G04 C;  3A79 B;  1XKU A;  4G8A A;  4ECN A;  3CVR A;  1YRG A;  1IO0 A;  1XWD C;  5GS0 A;  5GQR K;  4R6J A;  3KJ4 A;  3RJ0 A;  2P1Q B;  4V2D A;  4Z8G A;  3RFJ A;  3GOZ A;  2ID5 A;  1A4Y A;  1H6U A;  2Y5Q A;  1ZIW A;  5AWA A;  3OGL B;  4MN8 B;  1PGV A;  3OJA B;  4IM6 A;  4Q62 A;  3W3J A;  4J4L A;  3WPI A;  5AWC A;  2Z62 A;  2OMZ A;  5GMH A;  3O53 A;  3E3Z A;  4CC4 C;  4PER A;  4EZG A;  3G3B A;  1XEC A;  1GWB A;  4L3F A;  3ZYI A;  1XCD A;  4PSJ A;  4P91 A;  2JE1 A;  3RGX A;  4U08 A;  2RA8 A;  4MQW X;  1W8A A;  2UZX A;  3VQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...