2O6SA

Structural diversity of the hagfish variable lymphocyte receptors b59
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
CPSRCSCSGTTVECYSQGRTSVPTGIPAQTTYLDLETNSLKSLPNGVFDELTSLTQLYLGGNKLQSLPNGVFNKLTSLTYLNLSTNQLQSLPNGVFDKLTQLKELALNTNQLQSLPDGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor B
publication title Structural diversity of the hagfish variable lymphocyte receptors
pubmed doi rcsb
source organism Eptatretus burgeri
molecule tags Immune system
total genus 59
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2o6sA00
4Z8GA 3E4GA 4P91A 4CP6A 1OTMA 2Z66A 3E2JA 3G3AA 1A9NA 4KT1A 5HDHA 3W3LA 3RFJA 3P72A 3M19A 2OMWA 3RIZA 1XKUA 1FQVA 4Q3IA 3WPBA 4LSXA 1D0BA 5IJDA 3DZEA 5AWCA 4QBZA 1O6SA 5GS0A 1WWLA 4Y61B 4R5CA 4U08A 4Z61C 3REZA 3WPGA 2OMXA 4LXSA 2UZXA 1M0ZA 3ULVA 3UL8A 2Z63A 3TSRE 2WQUA 5CMPA 1XCDA 4C2AB 2Z7XB 2O6QA 4CNMA 2WFHA 5GMFA 1IO0A 4Q62A 4R6GA 2RR6A 3OGMB 1YRGA 2O6RA 5D3IA 4PSJA 4R09A 2Z62A 1M10B 4GLPA 5IYXC 1OTNA 2ASTB 1A4YA 4ARRA 4L3AA 1LTXA 3WPEA 3E3ZA 3WPIA 1P9AG 4GT6A 3W3KA 2Y5QA 2R9UA 1FS2A 2OMZA 1W8AA 4PEQB 3PMHG 5GMHA 3CIGA 3FXIA 4FD0A 1OGQA 3WPCA 3W3JA 4XGOA 3G39A 4R6AA 4H09A 1P8TA 4R08A 1M9SA 4IM6A 4MQWX 4L3FA 4ECOA 3G06A 2IFGA 1KOHA 4XOSA 4ARNA 1GWBA 4HQ1A 2V9SA 2V9TB 3ULAA 2ELLA 2XOTA 2WQWA 1DFJI 3O6NA 3G04C 3WN4A 3OGKB 3ZYOA 3A79B 1FT8A 3CVRA 4FDWA 4LXRA 2ID5A 5HZLB 3RGZA 2JE0A 1XECA 4PERA 1XEUA 4WYKA 3WPHA 5AWBA 2Z64A 2P1OB 3OGLB 1QYYA 3M18A 4FS7A 1SQ0B 2WQXA 4R6FA 2P1NB 4J0MA 4LSAA 4LI2A 3RGXA 4Z64C 3ULUA 2OMYA 3C6PB 4XSQA 1XWDC 5A5CA 4QXEA 2Z65A 2Z82A 4FMZA 5B4PA 4R58A 5B0NA 5IJBA 1OTOA 3CIYA 3KJ4A 3G3BA 1H6TA 2A0ZA 3C6NB 1PGVA 2UZYA 5IJCA 4NKGA 4BSSA 2P1PB 1H6UA 4WP6A 4R07A 1DCEA 4KXFB 3UL7A 1U0ND 3SB4A 4BSUA 1DS9A 2FT3A 5AZ5A 4J4LA 2BNHA 4MN8B 4RCWA 4PKIG 4U09A 4AY9X 4Z79A 3VQ2A 4UFRA 4BSRA 4K17A 3RW7A 5GMGA 2OMVA 4FCGA 5CMNA 4M7EC 4R5DA 2O6SA 4CNCA 4C2BB 4R0AA 5AWAA 2Z7XA 4V2EA 4TZHA 3W3GA 3OJAA 4QC0A 4RCAB 4U06A 4KNGA 4ECNA 3WPFA 1KOOA 4LSCA 4B8CD 4FHOA 3ZYJA 1G9UA 5B0TA 2JQDA 5GS2B 2CA6A 1OOKG 1M9LA 4P8SA 2RA8A 4EZGA 3RW6A 2XWTC 4CC4C 2P1MB 3WPDA 4LI1A 2JE1A 3W3NA 4V2CA 3W3MA 4Z94G 2WQVA 4YEBB 2P1QB 3ZYIA 2Q4GW 4PQ8A 4V2DA 3OJAB 4M7EA 5GQRK 1ZIWA 5AWDA 3GOZA 1K5DC 3RJ0A 2V70A 5FTTB 2BEXA 4OQTA 2Z81A 4BV4R 3RFSA 4U7LA 4NKHA 4I6JB 1P8VA 4Q3GA 4LSXC 4R6JA 2OMTA 4RWTC 1JL5A 5LFNA 4G8AA 1K5GC 3UN9A 1O6TA 3RFEA 1OZNA 2OMUA 1FO1A 4AW4A 4CC4A 3UL9A 3BZ5A 3ZYNA 3C6OB 3VQ1A 1O6VA 3E6JA 1Z7XW 4CILA 3JB9j 2ASSB 3O53A
chains in the Genus database with same CATH superfamily
4Z8GA 3E4GA 4P91A 4CP6A 1OTMA 2Z66A 3E2JA 3G3AA 1A9NA 4KT1A 5HDHA 3W3LA 3RFJA 3P72A 3M19A 2OMWA 3RIZA 1XKUA 1FQVA 4Q3IA 3WPBA 4LSXA 1D0BA 5IJDA 3DZEA 5AWCA 4QBZA 1O6SA 5GS0A 1WWLA 4Y61B 4R5CA 4U08A 4Z61C 3REZA 3WPGA 2OMXA 4LXSA 2UZXA 1M0ZA 3ULVA 4NZTM 3UL8A 2Z63A 3TSRE 2WQUA 5CMPA 1XCDA 4C2AB 2Z7XB 2O6QA 4CNMA 2WFHA 5GMFA 1IO0A 4Q62A 4R6GA 2RR6A 3OGMB 1YRGA 2O6RA 5D3IA 4PSJA 4R09A 2Z62A 1M10B 4GLPA 5IYXC 1OTNA 2ASTB 1A4YA 4ARRA 4L3AA 1LTXA 3WPEA 3E3ZA 3WPIA 1P9AG 4GT6A 3W3KA 2Y5QA 2R9UA 1FS2A 2OMZA 1W8AA 4PEQB 3PMHG 5GMHA 3CIGA 3FXIA 4FD0A 1OGQA 3WPCA 3W3JA 4XGOA 3G39A 4R6AA 4H09A 1P8TA 4R08A 1M9SA 4IM6A 4MQWX 4L3FA 4ECOA 3G06A 2IFGA 1KOHA 4XOSA 4ARNA 1GWBA 4HQ1A 2V9SA 2V9TB 3ULAA 2ELLA 2XOTA 2WQWA 1DFJI 3O6NA 3G04C 3WN4A 3OGKB 3ZYOA 3A79B 1FT8A 3CVRA 4FDWA 4LXRA 2ID5A 5HZLB 3RGZA 2JE0A 1XECA 4PERA 1XEUA 4WYKA 3WPHA 5AWBA 2Z64A 2P1OB 3OGLB 1QYYA 3M18A 4FS7A 1SQ0B 2WQXA 4R6FA 2P1NB 4J0MA 4LSAA 4LI2A 3RGXA 4Z64C 3ULUA 2OMYA 3C6PB 4XSQA 1XWDC 5A5CA 4QXEA 2Z65A 2Z82A 4FMZA 5B4PA 4R58A 5B0NA 5IJBA 1OTOA 3CIYA 3KJ4A 3G3BA 1H6TA 2A0ZA 3C6NB 1PGVA 2UZYA 5IJCA 4NKGA 4BSSA 2P1PB 1H6UA 4WP6A 4R07A 1DCEA 4KXFB 3UL7A 1U0ND 3SB4A 4NZRM 4BSUA 1DS9A 2FT3A 5AZ5A 4J4LA 2BNHA 4MN8B 4RCWA 4PKIG 4U09A 4AY9X 4Z79A 3VQ2A 4UFRA 4BSRA 4K17A 3RW7A 5GMGA 2OMVA 4FCGA 5CMNA 4M7EC 4R5DA 2O6SA 4CNCA 4C2BB 4R0AA 5AWAA 2Z7XA 4V2EA 4TZHA 3W3GA 3OJAA 4QC0A 4RCAB 4U06A 4KNGA 4ECNA 3WPFA 1KOOA 4LSCA 4B8CD 4FHOA 3ZYJA 1G9UA 5B0TA 2JQDA 5GS2B 2CA6A 1OOKG 1M9LA 4P8SA 2RA8A 4EZGA 3RW6A 2XWTC 4CC4C 2P1MB 3WPDA 4LI1A 2JE1A 3W3NA 4V2CA 3W3MA 4Z94G 2WQVA 4YEBB 2P1QB 3ZYIA 2Q4GW 4PQ8A 4V2DA 3OJAB 4M7EA 5GQRK 1ZIWA 5AWDA 3GOZA 1K5DC 3RJ0A 2V70A 5FTTB 2BEXA 4OQTA 2Z81A 4BV4R 3RFSA 4U7LA 4NKHA 4I6JB 1P8VA 4Q3GA 4LSXC 4R6JA 2OMTA 4RWTC 1JL5A 5LFNA 4G8AA 1K5GC 3UN9A 1O6TA 3RFEA 1OZNA 2OMUA 1FO1A 4AW4A 4CC4A 3UL9A 3BZ5A 3ZYNA 3C6OB 3VQ1A 1O6VA 3E6JA 1Z7XW 4CILA 3JB9j 2ASSB 3O53A
chains in the Genus database with same CATH topology
4Z8GA 3E4GA 4P91A 4CP6A 1OTMA 2Z66A 3E2JA 3G3AA 1A9NA 4KT1A 5HDHA 3W3LA 3RFJA 3P72A 3M19A 2OMWA 3RIZA 1XKUA 1FQVA 4Q3IA 3WPBA 4LSXA 1D0BA 5IJDA 3DZEA 5AWCA 4QBZA 1O6SA 5GS0A 1WWLA 4Y61B 4R5CA 4U08A 4Z61C 3REZA 3WPGA 2OMXA 4LXSA 2UZXA 1M0ZA 3ULVA 3UL8A 2Z63A 3TSRE 2WQUA 5CMPA 1XCDA 4C2AB 2Z7XB 2O6QA 4CNMA 2WFHA 5GMFA 1IO0A 4Q62A 4R6GA 2RR6A 3OGMB 1YRGA 2O6RA 5D3IA 4PSJA 4R09A 2Z62A 1M10B 4GLPA 5IYXC 1OTNA 2ASTB 1A4YA 4ARRA 4L3AA 1LTXA 3WPEA 3E3ZA 3WPIA 1P9AG 4GT6A 3W3KA 2Y5QA 2R9UA 1FS2A 2OMZA 1W8AA 4PEQB 3PMHG 5GMHA 3CIGA 3FXIA 4FD0A 1OGQA 3WPCA 3W3JA 4XGOA 3G39A 4R6AA 4H09A 1P8TA 4R08A 1M9SA 4IM6A 4MQWX 4L3FA 4ECOA 3G06A 2IFGA 1KOHA 4XOSA 4ARNA 1GWBA 4HQ1A 2V9SA 2V9TB 3ULAA 2ELLA 2XOTA 2WQWA 1DFJI 3O6NA 3G04C 3WN4A 3OGKB 3ZYOA 3A79B 1FT8A 3CVRA 4FDWA 4LXRA 2ID5A 5HZLB 3RGZA 2JE0A 1XECA 4PERA 1XEUA 4WYKA 3WPHA 5AWBA 2Z64A 2P1OB 3OGLB 1QYYA 3M18A 4FS7A 1SQ0B 2WQXA 4R6FA 2P1NB 4J0MA 4LSAA 4LI2A 3RGXA 4Z64C 3ULUA 2OMYA 3C6PB 4XSQA 1XWDC 5A5CA 4QXEA 2Z65A 2Z82A 4FMZA 5B4PA 4R58A 5B0NA 5IJBA 1OTOA 3CIYA 3KJ4A 3G3BA 1H6TA 2A0ZA 3C6NB 1PGVA 2UZYA 5IJCA 4NKGA 4BSSA 2P1PB 1H6UA 4WP6A 4R07A 1DCEA 4KXFB 3UL7A 1U0ND 3SB4A 4BSUA 1DS9A 2FT3A 5AZ5A 4J4LA 2BNHA 4MN8B 4RCWA 4PKIG 4U09A 4AY9X 4Z79A 3VQ2A 4UFRA 4BSRA 4K17A 3RW7A 5GMGA 2OMVA 4FCGA 5CMNA 4M7EC 4R5DA 2O6SA 4CNCA 4C2BB 4R0AA 5AWAA 2Z7XA 4V2EA 4TZHA 3W3GA 3OJAA 4QC0A 4RCAB 4U06A 4KNGA 4ECNA 3WPFA 1KOOA 4LSCA 4B8CD 4FHOA 3ZYJA 1G9UA 5B0TA 2JQDA 5GS2B 2CA6A 1OOKG 1M9LA 4P8SA 2RA8A 4EZGA 3RW6A 2XWTC 4CC4C 2P1MB 3WPDA 4LI1A 2JE1A 3W3NA 4V2CA 3W3MA 4Z94G 2WQVA 4YEBB 2P1QB 3ZYIA 2Q4GW 4PQ8A 4V2DA 3OJAB 4M7EA 5GQRK 1ZIWA 5AWDA 3GOZA 1K5DC 3RJ0A 2V70A 5FTTB 2BEXA 4OQTA 2Z81A 4BV4R 3RFSA 4U7LA 4NKHA 4I6JB 1P8VA 4Q3GA 4LSXC 4R6JA 2OMTA 4RWTC 1JL5A 5LFNA 4G8AA 1K5GC 3UN9A 1O6TA 3RFEA 1OZNA 2OMUA 1FO1A 4AW4A 4CC4A 3UL9A 3BZ5A 3ZYNA 3C6OB 3VQ1A 1O6VA 3E6JA 1Z7XW 4CILA 3JB9j 2ASSB 3O53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8G A;  3E4G A;  4P91 A;  4CP6 A;  1OTM A;  2Z66 A;  3E2J A;  3G3A A;  1A9N A;  4KT1 A;  5HDH A;  3W3L A;  3RFJ A;  3P72 A;  3M19 A;  2OMW A;  3RIZ A;  1XKU A;  1FQV A;  4Q3I A;  3WPB A;  4LSX A;  1D0B A;  5IJD A;  3DZE A;  5AWC A;  4QBZ A;  1O6S A;  5GS0 A;  1WWL A;  4Y61 B;  4R5C A;  4U08 A;  4Z61 C;  3REZ A;  3WPG A;  2OMX A;  4LXS A;  2UZX A;  1M0Z A;  3ULV A;  3UL8 A;  2Z63 A;  3TSR E;  2WQU A;  5CMP A;  1XCD A;  4C2A B;  2Z7X B;  2O6Q A;  4CNM A;  2WFH A;  5GMF A;  1IO0 A;  4Q62 A;  4R6G A;  2RR6 A;  3OGM B;  1YRG A;  2O6R A;  5D3I A;  4PSJ A;  4R09 A;  2Z62 A;  1M10 B;  4GLP A;  5IYX C;  1OTN A;  2AST B;  1A4Y A;  4ARR A;  4L3A A;  1LTX A;  3WPE A;  3E3Z A;  3WPI A;  1P9A G;  4GT6 A;  3W3K A;  2Y5Q A;  2R9U A;  1FS2 A;  2OMZ A;  1W8A A;  4PEQ B;  3PMH G;  5GMH A;  3CIG A;  3FXI A;  4FD0 A;  1OGQ A;  3WPC A;  3W3J A;  4XGO A;  3G39 A;  4R6A A;  4H09 A;  1P8T A;  4R08 A;  1M9S A;  4IM6 A;  4MQW X;  4L3F A;  4ECO A;  3G06 A;  2IFG A;  1KOH A;  4XOS A;  4ARN A;  1GWB A;  4HQ1 A;  2V9S A;  2V9T B;  3ULA A;  2ELL A;  2XOT A;  2WQW A;  1DFJ I;  3O6N A;  3G04 C;  3WN4 A;  3OGK B;  3ZYO A;  3A79 B;  1FT8 A;  3CVR A;  4FDW A;  4LXR A;  2ID5 A;  5HZL B;  3RGZ A;  2JE0 A;  1XEC A;  4PER A;  1XEU A;  4WYK A;  3WPH A;  5AWB A;  2Z64 A;  2P1O B;  3OGL B;  1QYY A;  3M18 A;  4FS7 A;  1SQ0 B;  2WQX A;  4R6F A;  2P1N B;  4J0M A;  4LSA A;  4LI2 A;  3RGX A;  4Z64 C;  3ULU A;  2OMY A;  3C6P B;  4XSQ A;  1XWD C;  5A5C A;  4QXE A;  2Z65 A;  2Z82 A;  4FMZ A;  5B4P A;  4R58 A;  5B0N A;  5IJB A;  1OTO A;  3CIY A;  3KJ4 A;  3G3B A;  1H6T A;  2A0Z A;  3C6N B;  1PGV A;  2UZY A;  5IJC A;  4NKG A;  4BSS A;  2P1P B;  1H6U A;  4WP6 A;  4R07 A;  1DCE A;  4KXF B;  3UL7 A;  1U0N D;  3SB4 A;  4BSU A;  1DS9 A;  2FT3 A;  5AZ5 A;  4J4L A;  2BNH A;  4MN8 B;  4RCW A;  4PKI G;  4U09 A;  4AY9 X;  4Z79 A;  3VQ2 A;  4UFR A;  4BSR A;  4K17 A;  3RW7 A;  5GMG A;  2OMV A;  4FCG A;  5CMN A;  4M7E C;  4R5D A;  2O6S A;  4CNC A;  4C2B B;  4R0A A;  5AWA A;  2Z7X A;  4V2E A;  4TZH A;  3W3G A;  3OJA A;  4QC0 A;  4RCA B;  4U06 A;  4KNG A;  4ECN A;  3WPF A;  1KOO A;  4LSC A;  4B8C D;  4FHO A;  3ZYJ A;  1G9U A;  5B0T A;  2JQD A;  5GS2 B;  2CA6 A;  1OOK G;  1M9L A;  4P8S A;  2RA8 A;  4EZG A;  3RW6 A;  2XWT C;  4CC4 C;  2P1M B;  3WPD A;  4LI1 A;  2JE1 A;  3W3N A;  4V2C A;  3W3M A;  4Z94 G;  2WQV A;  4YEB B;  2P1Q B;  3ZYI A;  2Q4G W;  4PQ8 A;  4V2D A;  3OJA B;  4M7E A;  5GQR K;  1ZIW A;  5AWD A;  3GOZ A;  1K5D C;  3RJ0 A;  2V70 A;  5FTT B;  2BEX A;  4OQT A;  2Z81 A;  4BV4 R;  3RFS A;  4U7L A;  4NKH A;  4I6J B;  1P8V A;  4Q3G A;  4LSX C;  4R6J A;  2OMT A;  4RWT C;  1JL5 A;  5LFN A;  4G8A A;  1K5G C;  3UN9 A;  1O6T A;  3RFE A;  1OZN A;  2OMU A;  1FO1 A;  4AW4 A;  4CC4 A;  3UL9 A;  3BZ5 A;  3ZYN A;  3C6O B;  3VQ1 A;  1O6V A;  3E6J A;  1Z7X W;  4CIL A;  3JB9 j;  2ASS B;  3O53 A; 
#chains in the Genus database with same CATH topology
 4Z8G A;  3E4G A;  4P91 A;  4CP6 A;  1OTM A;  2Z66 A;  3E2J A;  3G3A A;  1A9N A;  4KT1 A;  5HDH A;  3W3L A;  3RFJ A;  3P72 A;  3M19 A;  2OMW A;  3RIZ A;  1XKU A;  1FQV A;  4Q3I A;  3WPB A;  4LSX A;  1D0B A;  5IJD A;  3DZE A;  5AWC A;  4QBZ A;  1O6S A;  5GS0 A;  1WWL A;  4Y61 B;  4R5C A;  4U08 A;  4Z61 C;  3REZ A;  3WPG A;  2OMX A;  4LXS A;  2UZX A;  1M0Z A;  3ULV A;  4NZT M;  3UL8 A;  2Z63 A;  3TSR E;  2WQU A;  5CMP A;  1XCD A;  4C2A B;  2Z7X B;  2O6Q A;  4CNM A;  2WFH A;  5GMF A;  1IO0 A;  4Q62 A;  4R6G A;  2RR6 A;  3OGM B;  1YRG A;  2O6R A;  5D3I A;  4PSJ A;  4R09 A;  2Z62 A;  1M10 B;  4GLP A;  5IYX C;  1OTN A;  2AST B;  1A4Y A;  4ARR A;  4L3A A;  1LTX A;  3WPE A;  3E3Z A;  3WPI A;  1P9A G;  4GT6 A;  3W3K A;  2Y5Q A;  2R9U A;  1FS2 A;  2OMZ A;  1W8A A;  4PEQ B;  3PMH G;  5GMH A;  3CIG A;  3FXI A;  4FD0 A;  1OGQ A;  3WPC A;  3W3J A;  4XGO A;  3G39 A;  4R6A A;  4H09 A;  1P8T A;  4R08 A;  1M9S A;  4IM6 A;  4MQW X;  4L3F A;  4ECO A;  3G06 A;  2IFG A;  1KOH A;  4XOS A;  4ARN A;  1GWB A;  4HQ1 A;  2V9S A;  2V9T B;  3ULA A;  2ELL A;  2XOT A;  2WQW A;  1DFJ I;  3O6N A;  3G04 C;  3WN4 A;  3OGK B;  3ZYO A;  3A79 B;  1FT8 A;  3CVR A;  4FDW A;  4LXR A;  2ID5 A;  5HZL B;  3RGZ A;  2JE0 A;  1XEC A;  4PER A;  1XEU A;  4WYK A;  3WPH A;  5AWB A;  2Z64 A;  2P1O B;  3OGL B;  1QYY A;  3M18 A;  4FS7 A;  1SQ0 B;  2WQX A;  4R6F A;  2P1N B;  4J0M A;  4LSA A;  4LI2 A;  3RGX A;  4Z64 C;  3ULU A;  2OMY A;  3C6P B;  4XSQ A;  1XWD C;  5A5C A;  4QXE A;  2Z65 A;  2Z82 A;  4FMZ A;  5B4P A;  4R58 A;  5B0N A;  5IJB A;  1OTO A;  3CIY A;  3KJ4 A;  3G3B A;  1H6T A;  2A0Z A;  3C6N B;  1PGV A;  2UZY A;  5IJC A;  4NKG A;  4BSS A;  2P1P B;  1H6U A;  4WP6 A;  4R07 A;  1DCE A;  4KXF B;  3UL7 A;  1U0N D;  3SB4 A;  4NZR M;  4BSU A;  1DS9 A;  2FT3 A;  5AZ5 A;  4J4L A;  2BNH A;  4MN8 B;  4RCW A;  4PKI G;  4U09 A;  4AY9 X;  4Z79 A;  3VQ2 A;  4UFR A;  4BSR A;  4K17 A;  3RW7 A;  5GMG A;  2OMV A;  4FCG A;  5CMN A;  4M7E C;  4R5D A;  2O6S A;  4CNC A;  4C2B B;  4R0A A;  5AWA A;  2Z7X A;  4V2E A;  4TZH A;  3W3G A;  3OJA A;  4QC0 A;  4RCA B;  4U06 A;  4KNG A;  4ECN A;  3WPF A;  1KOO A;  4LSC A;  4B8C D;  4FHO A;  3ZYJ A;  1G9U A;  5B0T A;  2JQD A;  5GS2 B;  2CA6 A;  1OOK G;  1M9L A;  4P8S A;  2RA8 A;  4EZG A;  3RW6 A;  2XWT C;  4CC4 C;  2P1M B;  3WPD A;  4LI1 A;  2JE1 A;  3W3N A;  4V2C A;  3W3M A;  4Z94 G;  2WQV A;  4YEB B;  2P1Q B;  3ZYI A;  2Q4G W;  4PQ8 A;  4V2D A;  3OJA B;  4M7E A;  5GQR K;  1ZIW A;  5AWD A;  3GOZ A;  1K5D C;  3RJ0 A;  2V70 A;  5FTT B;  2BEX A;  4OQT A;  2Z81 A;  4BV4 R;  3RFS A;  4U7L A;  4NKH A;  4I6J B;  1P8V A;  4Q3G A;  4LSX C;  4R6J A;  2OMT A;  4RWT C;  1JL5 A;  5LFN A;  4G8A A;  1K5G C;  3UN9 A;  1O6T A;  3RFE A;  1OZN A;  2OMU A;  1FO1 A;  4AW4 A;  4CC4 A;  3UL9 A;  3BZ5 A;  3ZYN A;  3C6O B;  3VQ1 A;  1O6V A;  3E6J A;  1Z7X W;  4CIL A;  3JB9 j;  2ASS B;  3O53 A; 
#chains in the Genus database with same CATH homology
 4Z8G A;  3E4G A;  4P91 A;  4CP6 A;  1OTM A;  2Z66 A;  3E2J A;  3G3A A;  1A9N A;  4KT1 A;  5HDH A;  3W3L A;  3RFJ A;  3P72 A;  3M19 A;  2OMW A;  3RIZ A;  1XKU A;  1FQV A;  4Q3I A;  3WPB A;  4LSX A;  1D0B A;  5IJD A;  3DZE A;  5AWC A;  4QBZ A;  1O6S A;  5GS0 A;  1WWL A;  4Y61 B;  4R5C A;  4U08 A;  4Z61 C;  3REZ A;  3WPG A;  2OMX A;  4LXS A;  2UZX A;  1M0Z A;  3ULV A;  3UL8 A;  2Z63 A;  3TSR E;  2WQU A;  5CMP A;  1XCD A;  4C2A B;  2Z7X B;  2O6Q A;  4CNM A;  2WFH A;  5GMF A;  1IO0 A;  4Q62 A;  4R6G A;  2RR6 A;  3OGM B;  1YRG A;  2O6R A;  5D3I A;  4PSJ A;  4R09 A;  2Z62 A;  1M10 B;  4GLP A;  5IYX C;  1OTN A;  2AST B;  1A4Y A;  4ARR A;  4L3A A;  1LTX A;  3WPE A;  3E3Z A;  3WPI A;  1P9A G;  4GT6 A;  3W3K A;  2Y5Q A;  2R9U A;  1FS2 A;  2OMZ A;  1W8A A;  4PEQ B;  3PMH G;  5GMH A;  3CIG A;  3FXI A;  4FD0 A;  1OGQ A;  3WPC A;  3W3J A;  4XGO A;  3G39 A;  4R6A A;  4H09 A;  1P8T A;  4R08 A;  1M9S A;  4IM6 A;  4MQW X;  4L3F A;  4ECO A;  3G06 A;  2IFG A;  1KOH A;  4XOS A;  4ARN A;  1GWB A;  4HQ1 A;  2V9S A;  2V9T B;  3ULA A;  2ELL A;  2XOT A;  2WQW A;  1DFJ I;  3O6N A;  3G04 C;  3WN4 A;  3OGK B;  3ZYO A;  3A79 B;  1FT8 A;  3CVR A;  4FDW A;  4LXR A;  2ID5 A;  5HZL B;  3RGZ A;  2JE0 A;  1XEC A;  4PER A;  1XEU A;  4WYK A;  3WPH A;  5AWB A;  2Z64 A;  2P1O B;  3OGL B;  1QYY A;  3M18 A;  4FS7 A;  1SQ0 B;  2WQX A;  4R6F A;  2P1N B;  4J0M A;  4LSA A;  4LI2 A;  3RGX A;  4Z64 C;  3ULU A;  2OMY A;  3C6P B;  4XSQ A;  1XWD C;  5A5C A;  4QXE A;  2Z65 A;  2Z82 A;  4FMZ A;  5B4P A;  4R58 A;  5B0N A;  5IJB A;  1OTO A;  3CIY A;  3KJ4 A;  3G3B A;  1H6T A;  2A0Z A;  3C6N B;  1PGV A;  2UZY A;  5IJC A;  4NKG A;  4BSS A;  2P1P B;  1H6U A;  4WP6 A;  4R07 A;  1DCE A;  4KXF B;  3UL7 A;  1U0N D;  3SB4 A;  4BSU A;  1DS9 A;  2FT3 A;  5AZ5 A;  4J4L A;  2BNH A;  4MN8 B;  4RCW A;  4PKI G;  4U09 A;  4AY9 X;  4Z79 A;  3VQ2 A;  4UFR A;  4BSR A;  4K17 A;  3RW7 A;  5GMG A;  2OMV A;  4FCG A;  5CMN A;  4M7E C;  4R5D A;  2O6S A;  4CNC A;  4C2B B;  4R0A A;  5AWA A;  2Z7X A;  4V2E A;  4TZH A;  3W3G A;  3OJA A;  4QC0 A;  4RCA B;  4U06 A;  4KNG A;  4ECN A;  3WPF A;  1KOO A;  4LSC A;  4B8C D;  4FHO A;  3ZYJ A;  1G9U A;  5B0T A;  2JQD A;  5GS2 B;  2CA6 A;  1OOK G;  1M9L A;  4P8S A;  2RA8 A;  4EZG A;  3RW6 A;  2XWT C;  4CC4 C;  2P1M B;  3WPD A;  4LI1 A;  2JE1 A;  3W3N A;  4V2C A;  3W3M A;  4Z94 G;  2WQV A;  4YEB B;  2P1Q B;  3ZYI A;  2Q4G W;  4PQ8 A;  4V2D A;  3OJA B;  4M7E A;  5GQR K;  1ZIW A;  5AWD A;  3GOZ A;  1K5D C;  3RJ0 A;  2V70 A;  5FTT B;  2BEX A;  4OQT A;  2Z81 A;  4BV4 R;  3RFS A;  4U7L A;  4NKH A;  4I6J B;  1P8V A;  4Q3G A;  4LSX C;  4R6J A;  2OMT A;  4RWT C;  1JL5 A;  5LFN A;  4G8A A;  1K5G C;  3UN9 A;  1O6T A;  3RFE A;  1OZN A;  2OMU A;  1FO1 A;  4AW4 A;  4CC4 A;  3UL9 A;  3BZ5 A;  3ZYN A;  3C6O B;  3VQ1 A;  1O6V A;  3E6J A;  1Z7X W;  4CIL A;  3JB9 j;  2ASS B;  3O53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...