4NKGA

Crystal structure of ssph1 lrr domain in complex pkn1 hr1b domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
233
structure length
233
Chain Sequence
EYDAVWSKWERDAPAGESPGRAAVVQEMRDCLNNGNPVLNVGASGLTTLPDRLPPHITTLVIPDNNLTSLPELPEGLRELEVSGNLQLTSLPSLPQGLQKLWAYNNWLASLPTLPPGLGDLAVSNNQLTSLPEMPPALRELRVSGNNLTSLPALPSGLQKLWAYNNRLTSLPEMSPGLQELDVSHNQLTRLPQSLTGLSSAARVYLDGNPLSVRTLQALRDIIGHSGIRIHFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transferase
molecule keywords E3 ubiquitin-protein ligase sspH1
publication title Structure of an SspH1-PKN1 Complex Reveals the Basis for Host Substrate Recognition and Mechanism of Activation for a Bacterial E3 Ubiquitin Ligase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 64
structure length 233
sequence length 233
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4nkgA00
5IJCA 1FS2A 3FXIA 1P8VA 3E2JA 4U08A 2Z82A 4QC0A 4R5DA 2BNHA 4ARRA 4M7EC 2BEXA 3WN4A 4CC4C 1FT8A 1DFJI 1U0ND 1K5DC 4OQTA 4R6GA 2JE0A 2P1OB 4MN8B 5AWCA 3E3ZA 3O53A 1OZNA 1XECA 3BZ5A 4KT1A 4U06A 4B8CD 4Z64C 2OMXA 4I6JB 2RA8A 4V2CA 3UL9A 4RCWA 2CA6A 5AWDA 3G39A 3RJ0A 1O6VA 4WP6A 2Z63A 1O6TA 3W3KA 2UZXA 4R08A 4WYKA 2P1QB 5B0TA 4V2DA 1QYYA 4R09A 3W3MA 3RFEA 4BSRA 2WQXA 1KOHA 3TSRE 1M9SA 4R6AA 1A9NA 3RW6A 2Z62A 4K17A 3WPEA 3KJ4A 3RGZA 4GT6A 4PKIG 3RGXA 2ASSB 1P9AG 4XGOA 5CMNA 4CNCA 5D3IA 4LI1A 4PEQB 4CP6A 5HZLB 3M19A 4AY9X 5AZ5A 2UZYA 4QXEA 1FQVA 4Z61C 5GS0A 2OMTA 3RW7A 4LXRA 3OJAB 2FT3A 2P1PB 4IM6A 1YRGA 1G9UA 1M0ZA 3OJAA 1H6UA 4NKHA 3CIYA 1P8TA 5IJBA 2WQWA 3WPBA 3CVRA 4P91A 4RCAB 1OTNA 2Y5QA 4Z79A 4BV4R 3C6PB 4Z94G 5CMPA 1M10B 4NKGA 3W3JA 4MQWX 1XEUA 2Z7XB 4LI2A 5GS2B 4LSXC 4BSSA 5AWAA 3O6NA 4ECNA 5B0NA 2Z7XA 3UL7A 2XOTA 4P8SA 3M18A 2A0ZA 5B4PA 4R0AA 4ECOA 2OMUA 2V70A 4R6FA 4G8AA 4AW4A 3G3AA 2O6RA 4U7LA 4C2AB 3GOZA 1O6SA 2WQVA 4FDWA 4LSCA 5HDHA 3W3NA 2O6SA 3PMHG 2XWTC 4V2EA 2IFGA 3VQ2A 4UFRA 4M7EA 4XOSA 5IJDA 4CC4A 2R9UA 4EZGA 3G3BA 4J4LA 3G04C 1DS9A 2OMYA 4Q62A 2JQDA 4C2BB 4FCGA 4ARNA 4GLPA 4L3FA 4LXSA 3DZEA 1XKUA 3W3LA 1D0BA 4FS7A 1H6TA 1W8AA 3VQ1A 3WPHA 1M9LA 1XWDC 4Y61B 2JE1A 2V9SA 3ZYJA 1SQ0B 5GQRK 4BSUA 3ZYIA 2Q4GW 2O6QA 3C6NB 3OGMB 3RFSA 3W3GA 2ASTB 3ZYNA 2ID5A 5GMHA 3ULVA 2OMVA 4CILA 1WWLA 3SB4A 4CNMA 3CIGA 1OOKG 1FO1A 4Q3GA 3ULUA 4Z8GA 4RWTC 2Z81A 2Z65A 5LFNA 1LTXA 3WPIA 4TZHA 4HQ1A 3G06A 4L3AA 4LSAA 5IYXC 3WPFA 4R58A 3RFJA 3WPDA 1JL5A 1K5GC 4R5CA 2Z64A 1Z7XW 4H09A 1GWBA 3C6OB 3P72A 4Q3IA 2P1MB 4PQ8A 4FHOA 1OTMA 3WPGA 4J0MA 3UL8A 4QBZA 2ELLA 4PSJA 4KNGA 3E6JA 4XSQA 2OMZA 4FD0A 1PGVA 4R6JA 3OGKB 4PERA 3OGLB 3REZA 1IO0A 2P1NB 5A5CA 1OTOA 2WQUA 2V9TB 3UN9A 3A79B 1XCDA 2Z66A 4YEBB 5FTTB 3RIZA 5GMFA 3ULAA 1OGQA 2OMWA 4KXFB 2WFHA 4R07A 3WPCA 1ZIWA 1A4YA 3JB9j 3E4GA 1KOOA 2RR6A 1DCEA 4FMZA 4U09A 3ZYOA 5GMGA 5AWBA 4LSXA
chains in the Genus database with same CATH superfamily
5IJCA 1FS2A 3FXIA 1P8VA 3E2JA 4U08A 2Z82A 4QC0A 4R5DA 2BNHA 4ARRA 4NZRM 4M7EC 2BEXA 3WN4A 4CC4C 1FT8A 1DFJI 1U0ND 1K5DC 4OQTA 4R6GA 2JE0A 2P1OB 4MN8B 5AWCA 3E3ZA 3O53A 1OZNA 1XECA 3BZ5A 4KT1A 4U06A 4B8CD 4Z64C 2OMXA 4I6JB 2RA8A 4V2CA 3UL9A 4RCWA 2CA6A 5AWDA 3G39A 3RJ0A 1O6VA 4WP6A 2Z63A 1O6TA 3W3KA 2UZXA 4R08A 4WYKA 2P1QB 5B0TA 4V2DA 1QYYA 4R09A 3W3MA 3RFEA 4BSRA 2WQXA 1KOHA 3TSRE 1M9SA 4R6AA 1A9NA 3RW6A 2Z62A 4K17A 3WPEA 3KJ4A 4NZTM 3RGZA 4GT6A 4PKIG 3RGXA 2ASSB 1P9AG 4XGOA 5CMNA 4CNCA 5D3IA 4LI1A 4PEQB 4CP6A 5HZLB 3M19A 4AY9X 5AZ5A 2UZYA 4QXEA 1FQVA 4Z61C 5GS0A 2OMTA 3RW7A 4LXRA 3OJAB 2FT3A 2P1PB 4IM6A 1YRGA 1G9UA 1M0ZA 3OJAA 1H6UA 4NKHA 3CIYA 1P8TA 5IJBA 2WQWA 3WPBA 3CVRA 4P91A 4RCAB 1OTNA 2Y5QA 4Z79A 4BV4R 3C6PB 4Z94G 5CMPA 1M10B 4NKGA 3W3JA 4MQWX 1XEUA 2Z7XB 4LI2A 5GS2B 4LSXC 4BSSA 5AWAA 3O6NA 4ECNA 5B0NA 2Z7XA 3UL7A 2XOTA 4P8SA 3M18A 2A0ZA 5B4PA 4R0AA 4ECOA 2OMUA 2V70A 4R6FA 4G8AA 4AW4A 3G3AA 2O6RA 4U7LA 4C2AB 3GOZA 1O6SA 2WQVA 4FDWA 4LSCA 5HDHA 3W3NA 2O6SA 3PMHG 2XWTC 4V2EA 2IFGA 3VQ2A 4UFRA 4M7EA 4XOSA 5IJDA 4CC4A 2R9UA 4EZGA 3G3BA 4J4LA 3G04C 1DS9A 2OMYA 4Q62A 2JQDA 4C2BB 4FCGA 4ARNA 4GLPA 4L3FA 4LXSA 3DZEA 1XKUA 3W3LA 1D0BA 4FS7A 1H6TA 1W8AA 3VQ1A 3WPHA 1M9LA 1XWDC 4Y61B 2JE1A 2V9SA 3ZYJA 1SQ0B 5GQRK 4BSUA 3ZYIA 2Q4GW 2O6QA 3C6NB 3OGMB 3RFSA 3W3GA 2ASTB 3ZYNA 2ID5A 5GMHA 3ULVA 2OMVA 4CILA 1WWLA 3SB4A 4CNMA 3CIGA 1OOKG 1FO1A 4Q3GA 3ULUA 4Z8GA 4RWTC 2Z81A 2Z65A 5LFNA 1LTXA 3WPIA 4TZHA 4HQ1A 3G06A 4L3AA 4LSAA 5IYXC 3WPFA 4R58A 3RFJA 3WPDA 1JL5A 1K5GC 4R5CA 2Z64A 1Z7XW 4H09A 1GWBA 3C6OB 3P72A 4Q3IA 2P1MB 4PQ8A 4FHOA 1OTMA 3WPGA 4J0MA 3UL8A 4QBZA 2ELLA 4PSJA 4KNGA 3E6JA 4XSQA 2OMZA 4FD0A 1PGVA 4R6JA 3OGKB 4PERA 3OGLB 3REZA 1IO0A 2P1NB 5A5CA 1OTOA 2WQUA 2V9TB 3UN9A 3A79B 1XCDA 2Z66A 4YEBB 5FTTB 3RIZA 5GMFA 3ULAA 1OGQA 2OMWA 4KXFB 2WFHA 4R07A 3WPCA 1ZIWA 1A4YA 3JB9j 3E4GA 1KOOA 2RR6A 1DCEA 4FMZA 4U09A 3ZYOA 5GMGA 5AWBA 4LSXA
chains in the Genus database with same CATH topology
5IJCA 1FS2A 3FXIA 1P8VA 3E2JA 4U08A 2Z82A 4QC0A 4R5DA 2BNHA 4ARRA 4M7EC 2BEXA 3WN4A 4CC4C 1FT8A 1DFJI 1U0ND 1K5DC 4OQTA 4R6GA 2JE0A 2P1OB 4MN8B 5AWCA 3E3ZA 3O53A 1OZNA 1XECA 3BZ5A 4KT1A 4U06A 4B8CD 4Z64C 2OMXA 4I6JB 2RA8A 4V2CA 3UL9A 4RCWA 2CA6A 5AWDA 3G39A 3RJ0A 1O6VA 4WP6A 2Z63A 1O6TA 3W3KA 2UZXA 4R08A 4WYKA 2P1QB 5B0TA 4V2DA 1QYYA 4R09A 3W3MA 3RFEA 4BSRA 2WQXA 1KOHA 3TSRE 1M9SA 4R6AA 1A9NA 3RW6A 2Z62A 4K17A 3WPEA 3KJ4A 3RGZA 4GT6A 4PKIG 3RGXA 2ASSB 1P9AG 4XGOA 5CMNA 4CNCA 5D3IA 4LI1A 4PEQB 4CP6A 5HZLB 3M19A 4AY9X 5AZ5A 2UZYA 4QXEA 1FQVA 4Z61C 5GS0A 2OMTA 3RW7A 4LXRA 3OJAB 2FT3A 2P1PB 4IM6A 1YRGA 1G9UA 1M0ZA 3OJAA 1H6UA 4NKHA 3CIYA 1P8TA 5IJBA 2WQWA 3WPBA 3CVRA 4P91A 4RCAB 1OTNA 2Y5QA 4Z79A 4BV4R 3C6PB 4Z94G 5CMPA 1M10B 4NKGA 3W3JA 4MQWX 1XEUA 2Z7XB 4LI2A 5GS2B 4LSXC 4BSSA 5AWAA 3O6NA 4ECNA 5B0NA 2Z7XA 3UL7A 2XOTA 4P8SA 3M18A 2A0ZA 5B4PA 4R0AA 4ECOA 2OMUA 2V70A 4R6FA 4G8AA 4AW4A 3G3AA 2O6RA 4U7LA 4C2AB 3GOZA 1O6SA 2WQVA 4FDWA 4LSCA 5HDHA 3W3NA 2O6SA 3PMHG 2XWTC 4V2EA 2IFGA 3VQ2A 4UFRA 4M7EA 4XOSA 5IJDA 4CC4A 2R9UA 4EZGA 3G3BA 4J4LA 3G04C 1DS9A 2OMYA 4Q62A 2JQDA 4C2BB 4FCGA 4ARNA 4GLPA 4L3FA 4LXSA 3DZEA 1XKUA 3W3LA 1D0BA 4FS7A 1H6TA 1W8AA 3VQ1A 3WPHA 1M9LA 1XWDC 4Y61B 2JE1A 2V9SA 3ZYJA 1SQ0B 5GQRK 4BSUA 3ZYIA 2Q4GW 2O6QA 3C6NB 3OGMB 3RFSA 3W3GA 2ASTB 3ZYNA 2ID5A 5GMHA 3ULVA 2OMVA 4CILA 1WWLA 3SB4A 4CNMA 3CIGA 1OOKG 1FO1A 4Q3GA 3ULUA 4Z8GA 4RWTC 2Z81A 2Z65A 5LFNA 1LTXA 3WPIA 4TZHA 4HQ1A 3G06A 4L3AA 4LSAA 5IYXC 3WPFA 4R58A 3RFJA 3WPDA 1JL5A 1K5GC 4R5CA 2Z64A 1Z7XW 4H09A 1GWBA 3C6OB 3P72A 4Q3IA 2P1MB 4PQ8A 4FHOA 1OTMA 3WPGA 4J0MA 3UL8A 4QBZA 2ELLA 4PSJA 4KNGA 3E6JA 4XSQA 2OMZA 4FD0A 1PGVA 4R6JA 3OGKB 4PERA 3OGLB 3REZA 1IO0A 2P1NB 5A5CA 1OTOA 2WQUA 2V9TB 3UN9A 3A79B 1XCDA 2Z66A 4YEBB 5FTTB 3RIZA 5GMFA 3ULAA 1OGQA 2OMWA 4KXFB 2WFHA 4R07A 3WPCA 1ZIWA 1A4YA 3JB9j 3E4GA 1KOOA 2RR6A 1DCEA 4FMZA 4U09A 3ZYOA 5GMGA 5AWBA 4LSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IJC A;  1FS2 A;  3FXI A;  1P8V A;  3E2J A;  4U08 A;  2Z82 A;  4QC0 A;  4R5D A;  2BNH A;  4ARR A;  4M7E C;  2BEX A;  3WN4 A;  4CC4 C;  1FT8 A;  1DFJ I;  1U0N D;  1K5D C;  4OQT A;  4R6G A;  2JE0 A;  2P1O B;  4MN8 B;  5AWC A;  3E3Z A;  3O53 A;  1OZN A;  1XEC A;  3BZ5 A;  4KT1 A;  4U06 A;  4B8C D;  4Z64 C;  2OMX A;  4I6J B;  2RA8 A;  4V2C A;  3UL9 A;  4RCW A;  2CA6 A;  5AWD A;  3G39 A;  3RJ0 A;  1O6V A;  4WP6 A;  2Z63 A;  1O6T A;  3W3K A;  2UZX A;  4R08 A;  4WYK A;  2P1Q B;  5B0T A;  4V2D A;  1QYY A;  4R09 A;  3W3M A;  3RFE A;  4BSR A;  2WQX A;  1KOH A;  3TSR E;  1M9S A;  4R6A A;  1A9N A;  3RW6 A;  2Z62 A;  4K17 A;  3WPE A;  3KJ4 A;  3RGZ A;  4GT6 A;  4PKI G;  3RGX A;  2ASS B;  1P9A G;  4XGO A;  5CMN A;  4CNC A;  5D3I A;  4LI1 A;  4PEQ B;  4CP6 A;  5HZL B;  3M19 A;  4AY9 X;  5AZ5 A;  2UZY A;  4QXE A;  1FQV A;  4Z61 C;  5GS0 A;  2OMT A;  3RW7 A;  4LXR A;  3OJA B;  2FT3 A;  2P1P B;  4IM6 A;  1YRG A;  1G9U A;  1M0Z A;  3OJA A;  1H6U A;  4NKH A;  3CIY A;  1P8T A;  5IJB A;  2WQW A;  3WPB A;  3CVR A;  4P91 A;  4RCA B;  1OTN A;  2Y5Q A;  4Z79 A;  4BV4 R;  3C6P B;  4Z94 G;  5CMP A;  1M10 B;  4NKG A;  3W3J A;  4MQW X;  1XEU A;  2Z7X B;  4LI2 A;  5GS2 B;  4LSX C;  4BSS A;  5AWA A;  3O6N A;  4ECN A;  5B0N A;  2Z7X A;  3UL7 A;  2XOT A;  4P8S A;  3M18 A;  2A0Z A;  5B4P A;  4R0A A;  4ECO A;  2OMU A;  2V70 A;  4R6F A;  4G8A A;  4AW4 A;  3G3A A;  2O6R A;  4U7L A;  4C2A B;  3GOZ A;  1O6S A;  2WQV A;  4FDW A;  4LSC A;  5HDH A;  3W3N A;  2O6S A;  3PMH G;  2XWT C;  4V2E A;  2IFG A;  3VQ2 A;  4UFR A;  4M7E A;  4XOS A;  5IJD A;  4CC4 A;  2R9U A;  4EZG A;  3G3B A;  4J4L A;  3G04 C;  1DS9 A;  2OMY A;  4Q62 A;  2JQD A;  4C2B B;  4FCG A;  4ARN A;  4GLP A;  4L3F A;  4LXS A;  3DZE A;  1XKU A;  3W3L A;  1D0B A;  4FS7 A;  1H6T A;  1W8A A;  3VQ1 A;  3WPH A;  1M9L A;  1XWD C;  4Y61 B;  2JE1 A;  2V9S A;  3ZYJ A;  1SQ0 B;  5GQR K;  4BSU A;  3ZYI A;  2Q4G W;  2O6Q A;  3C6N B;  3OGM B;  3RFS A;  3W3G A;  2AST B;  3ZYN A;  2ID5 A;  5GMH A;  3ULV A;  2OMV A;  4CIL A;  1WWL A;  3SB4 A;  4CNM A;  3CIG A;  1OOK G;  1FO1 A;  4Q3G A;  3ULU A;  4Z8G A;  4RWT C;  2Z81 A;  2Z65 A;  5LFN A;  1LTX A;  3WPI A;  4TZH A;  4HQ1 A;  3G06 A;  4L3A A;  4LSA A;  5IYX C;  3WPF A;  4R58 A;  3RFJ A;  3WPD A;  1JL5 A;  1K5G C;  4R5C A;  2Z64 A;  1Z7X W;  4H09 A;  1GWB A;  3C6O B;  3P72 A;  4Q3I A;  2P1M B;  4PQ8 A;  4FHO A;  1OTM A;  3WPG A;  4J0M A;  3UL8 A;  4QBZ A;  2ELL A;  4PSJ A;  4KNG A;  3E6J A;  4XSQ A;  2OMZ A;  4FD0 A;  1PGV A;  4R6J A;  3OGK B;  4PER A;  3OGL B;  3REZ A;  1IO0 A;  2P1N B;  5A5C A;  1OTO A;  2WQU A;  2V9T B;  3UN9 A;  3A79 B;  1XCD A;  2Z66 A;  4YEB B;  5FTT B;  3RIZ A;  5GMF A;  3ULA A;  1OGQ A;  2OMW A;  4KXF B;  2WFH A;  4R07 A;  3WPC A;  1ZIW A;  1A4Y A;  3JB9 j;  3E4G A;  1KOO A;  2RR6 A;  1DCE A;  4FMZ A;  4U09 A;  3ZYO A;  5GMG A;  5AWB A;  4LSX A; 
#chains in the Genus database with same CATH topology
 5IJC A;  1FS2 A;  3FXI A;  1P8V A;  3E2J A;  4U08 A;  2Z82 A;  4QC0 A;  4R5D A;  2BNH A;  4ARR A;  4NZR M;  4M7E C;  2BEX A;  3WN4 A;  4CC4 C;  1FT8 A;  1DFJ I;  1U0N D;  1K5D C;  4OQT A;  4R6G A;  2JE0 A;  2P1O B;  4MN8 B;  5AWC A;  3E3Z A;  3O53 A;  1OZN A;  1XEC A;  3BZ5 A;  4KT1 A;  4U06 A;  4B8C D;  4Z64 C;  2OMX A;  4I6J B;  2RA8 A;  4V2C A;  3UL9 A;  4RCW A;  2CA6 A;  5AWD A;  3G39 A;  3RJ0 A;  1O6V A;  4WP6 A;  2Z63 A;  1O6T A;  3W3K A;  2UZX A;  4R08 A;  4WYK A;  2P1Q B;  5B0T A;  4V2D A;  1QYY A;  4R09 A;  3W3M A;  3RFE A;  4BSR A;  2WQX A;  1KOH A;  3TSR E;  1M9S A;  4R6A A;  1A9N A;  3RW6 A;  2Z62 A;  4K17 A;  3WPE A;  3KJ4 A;  4NZT M;  3RGZ A;  4GT6 A;  4PKI G;  3RGX A;  2ASS B;  1P9A G;  4XGO A;  5CMN A;  4CNC A;  5D3I A;  4LI1 A;  4PEQ B;  4CP6 A;  5HZL B;  3M19 A;  4AY9 X;  5AZ5 A;  2UZY A;  4QXE A;  1FQV A;  4Z61 C;  5GS0 A;  2OMT A;  3RW7 A;  4LXR A;  3OJA B;  2FT3 A;  2P1P B;  4IM6 A;  1YRG A;  1G9U A;  1M0Z A;  3OJA A;  1H6U A;  4NKH A;  3CIY A;  1P8T A;  5IJB A;  2WQW A;  3WPB A;  3CVR A;  4P91 A;  4RCA B;  1OTN A;  2Y5Q A;  4Z79 A;  4BV4 R;  3C6P B;  4Z94 G;  5CMP A;  1M10 B;  4NKG A;  3W3J A;  4MQW X;  1XEU A;  2Z7X B;  4LI2 A;  5GS2 B;  4LSX C;  4BSS A;  5AWA A;  3O6N A;  4ECN A;  5B0N A;  2Z7X A;  3UL7 A;  2XOT A;  4P8S A;  3M18 A;  2A0Z A;  5B4P A;  4R0A A;  4ECO A;  2OMU A;  2V70 A;  4R6F A;  4G8A A;  4AW4 A;  3G3A A;  2O6R A;  4U7L A;  4C2A B;  3GOZ A;  1O6S A;  2WQV A;  4FDW A;  4LSC A;  5HDH A;  3W3N A;  2O6S A;  3PMH G;  2XWT C;  4V2E A;  2IFG A;  3VQ2 A;  4UFR A;  4M7E A;  4XOS A;  5IJD A;  4CC4 A;  2R9U A;  4EZG A;  3G3B A;  4J4L A;  3G04 C;  1DS9 A;  2OMY A;  4Q62 A;  2JQD A;  4C2B B;  4FCG A;  4ARN A;  4GLP A;  4L3F A;  4LXS A;  3DZE A;  1XKU A;  3W3L A;  1D0B A;  4FS7 A;  1H6T A;  1W8A A;  3VQ1 A;  3WPH A;  1M9L A;  1XWD C;  4Y61 B;  2JE1 A;  2V9S A;  3ZYJ A;  1SQ0 B;  5GQR K;  4BSU A;  3ZYI A;  2Q4G W;  2O6Q A;  3C6N B;  3OGM B;  3RFS A;  3W3G A;  2AST B;  3ZYN A;  2ID5 A;  5GMH A;  3ULV A;  2OMV A;  4CIL A;  1WWL A;  3SB4 A;  4CNM A;  3CIG A;  1OOK G;  1FO1 A;  4Q3G A;  3ULU A;  4Z8G A;  4RWT C;  2Z81 A;  2Z65 A;  5LFN A;  1LTX A;  3WPI A;  4TZH A;  4HQ1 A;  3G06 A;  4L3A A;  4LSA A;  5IYX C;  3WPF A;  4R58 A;  3RFJ A;  3WPD A;  1JL5 A;  1K5G C;  4R5C A;  2Z64 A;  1Z7X W;  4H09 A;  1GWB A;  3C6O B;  3P72 A;  4Q3I A;  2P1M B;  4PQ8 A;  4FHO A;  1OTM A;  3WPG A;  4J0M A;  3UL8 A;  4QBZ A;  2ELL A;  4PSJ A;  4KNG A;  3E6J A;  4XSQ A;  2OMZ A;  4FD0 A;  1PGV A;  4R6J A;  3OGK B;  4PER A;  3OGL B;  3REZ A;  1IO0 A;  2P1N B;  5A5C A;  1OTO A;  2WQU A;  2V9T B;  3UN9 A;  3A79 B;  1XCD A;  2Z66 A;  4YEB B;  5FTT B;  3RIZ A;  5GMF A;  3ULA A;  1OGQ A;  2OMW A;  4KXF B;  2WFH A;  4R07 A;  3WPC A;  1ZIW A;  1A4Y A;  3JB9 j;  3E4G A;  1KOO A;  2RR6 A;  1DCE A;  4FMZ A;  4U09 A;  3ZYO A;  5GMG A;  5AWB A;  4LSX A; 
#chains in the Genus database with same CATH homology
 5IJC A;  1FS2 A;  3FXI A;  1P8V A;  3E2J A;  4U08 A;  2Z82 A;  4QC0 A;  4R5D A;  2BNH A;  4ARR A;  4M7E C;  2BEX A;  3WN4 A;  4CC4 C;  1FT8 A;  1DFJ I;  1U0N D;  1K5D C;  4OQT A;  4R6G A;  2JE0 A;  2P1O B;  4MN8 B;  5AWC A;  3E3Z A;  3O53 A;  1OZN A;  1XEC A;  3BZ5 A;  4KT1 A;  4U06 A;  4B8C D;  4Z64 C;  2OMX A;  4I6J B;  2RA8 A;  4V2C A;  3UL9 A;  4RCW A;  2CA6 A;  5AWD A;  3G39 A;  3RJ0 A;  1O6V A;  4WP6 A;  2Z63 A;  1O6T A;  3W3K A;  2UZX A;  4R08 A;  4WYK A;  2P1Q B;  5B0T A;  4V2D A;  1QYY A;  4R09 A;  3W3M A;  3RFE A;  4BSR A;  2WQX A;  1KOH A;  3TSR E;  1M9S A;  4R6A A;  1A9N A;  3RW6 A;  2Z62 A;  4K17 A;  3WPE A;  3KJ4 A;  3RGZ A;  4GT6 A;  4PKI G;  3RGX A;  2ASS B;  1P9A G;  4XGO A;  5CMN A;  4CNC A;  5D3I A;  4LI1 A;  4PEQ B;  4CP6 A;  5HZL B;  3M19 A;  4AY9 X;  5AZ5 A;  2UZY A;  4QXE A;  1FQV A;  4Z61 C;  5GS0 A;  2OMT A;  3RW7 A;  4LXR A;  3OJA B;  2FT3 A;  2P1P B;  4IM6 A;  1YRG A;  1G9U A;  1M0Z A;  3OJA A;  1H6U A;  4NKH A;  3CIY A;  1P8T A;  5IJB A;  2WQW A;  3WPB A;  3CVR A;  4P91 A;  4RCA B;  1OTN A;  2Y5Q A;  4Z79 A;  4BV4 R;  3C6P B;  4Z94 G;  5CMP A;  1M10 B;  4NKG A;  3W3J A;  4MQW X;  1XEU A;  2Z7X B;  4LI2 A;  5GS2 B;  4LSX C;  4BSS A;  5AWA A;  3O6N A;  4ECN A;  5B0N A;  2Z7X A;  3UL7 A;  2XOT A;  4P8S A;  3M18 A;  2A0Z A;  5B4P A;  4R0A A;  4ECO A;  2OMU A;  2V70 A;  4R6F A;  4G8A A;  4AW4 A;  3G3A A;  2O6R A;  4U7L A;  4C2A B;  3GOZ A;  1O6S A;  2WQV A;  4FDW A;  4LSC A;  5HDH A;  3W3N A;  2O6S A;  3PMH G;  2XWT C;  4V2E A;  2IFG A;  3VQ2 A;  4UFR A;  4M7E A;  4XOS A;  5IJD A;  4CC4 A;  2R9U A;  4EZG A;  3G3B A;  4J4L A;  3G04 C;  1DS9 A;  2OMY A;  4Q62 A;  2JQD A;  4C2B B;  4FCG A;  4ARN A;  4GLP A;  4L3F A;  4LXS A;  3DZE A;  1XKU A;  3W3L A;  1D0B A;  4FS7 A;  1H6T A;  1W8A A;  3VQ1 A;  3WPH A;  1M9L A;  1XWD C;  4Y61 B;  2JE1 A;  2V9S A;  3ZYJ A;  1SQ0 B;  5GQR K;  4BSU A;  3ZYI A;  2Q4G W;  2O6Q A;  3C6N B;  3OGM B;  3RFS A;  3W3G A;  2AST B;  3ZYN A;  2ID5 A;  5GMH A;  3ULV A;  2OMV A;  4CIL A;  1WWL A;  3SB4 A;  4CNM A;  3CIG A;  1OOK G;  1FO1 A;  4Q3G A;  3ULU A;  4Z8G A;  4RWT C;  2Z81 A;  2Z65 A;  5LFN A;  1LTX A;  3WPI A;  4TZH A;  4HQ1 A;  3G06 A;  4L3A A;  4LSA A;  5IYX C;  3WPF A;  4R58 A;  3RFJ A;  3WPD A;  1JL5 A;  1K5G C;  4R5C A;  2Z64 A;  1Z7X W;  4H09 A;  1GWB A;  3C6O B;  3P72 A;  4Q3I A;  2P1M B;  4PQ8 A;  4FHO A;  1OTM A;  3WPG A;  4J0M A;  3UL8 A;  4QBZ A;  2ELL A;  4PSJ A;  4KNG A;  3E6J A;  4XSQ A;  2OMZ A;  4FD0 A;  1PGV A;  4R6J A;  3OGK B;  4PER A;  3OGL B;  3REZ A;  1IO0 A;  2P1N B;  5A5C A;  1OTO A;  2WQU A;  2V9T B;  3UN9 A;  3A79 B;  1XCD A;  2Z66 A;  4YEB B;  5FTT B;  3RIZ A;  5GMF A;  3ULA A;  1OGQ A;  2OMW A;  4KXF B;  2WFH A;  4R07 A;  3WPC A;  1ZIW A;  1A4Y A;  3JB9 j;  3E4G A;  1KOO A;  2RR6 A;  1DCE A;  4FMZ A;  4U09 A;  3ZYO A;  5GMG A;  5AWB A;  4LSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...