4NKGA

Crystal structure of ssph1 lrr domain in complex pkn1 hr1b domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
233
structure length
233
Chain Sequence
EYDAVWSKWERDAPAGESPGRAAVVQEMRDCLNNGNPVLNVGASGLTTLPDRLPPHITTLVIPDNNLTSLPELPEGLRELEVSGNLQLTSLPSLPQGLQKLWAYNNWLASLPTLPPGLGDLAVSNNQLTSLPEMPPALRELRVSGNNLTSLPALPSGLQKLWAYNNRLTSLPEMSPGLQELDVSHNQLTRLPQSLTGLSSAARVYLDGNPLSVRTLQALRDIIGHSGIRIHFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase sspH1
publication title Structure of an SspH1-PKN1 Complex Reveals the Basis for Host Substrate Recognition and Mechanism of Activation for a Bacterial E3 Ubiquitin Ligase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Ligase/transferase
total genus 64
structure length 233
sequence length 233
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4nkgA00
1D0BA 2O6RA 1KOOA 5IJCA 3G06A 4GT6A 4PSJA 3E6JA 3FXIA 4Z61C 4Q3IA 4U7LA 2Z65A 4PQ8A 1KOHA 4K17A 4BV4R 2UZXA 3OGLB 5GQRK 2P1PB 1DCEA 1M0ZA 1XECA 2BNHA 4QXEA 1M9LA 3ZYOA 3PMHG 4Q62A 3RGXA 1JL5A 3ULUA 2V9SA 1A4YA 3E2JA 4FDWA 5IYXC 3VQ1A 2O6QA 2Z82A 4R6JA 2IFGA 4R08A 2Z62A 2V70A 4J4LA 1OTMA 2WFHA 4KXFB 1OTOA 1QYYA 3O6NA 1YRGA 3WPIA 2JE1A 4R6GA 3G39A 4R0AA 2O6SA 2WQUA 4AY9X 2OMYA 3RJ0A 4P91A 3ZYJA 2OMWA 3ZYIA 1K5GC 3WPBA 1PGVA 5AWCA 3W3KA 1M10B 4Z8GA 3GOZA 4LXSA 4U08A 5IJDA 4KNGA 4IM6A 1H6TA 4OQTA 3W3MA 2OMZA 4MN8B 4LSAA 4J0MA 1GWBA 4QBZA 3CVRA 4GLPA 1LTXA 2R9UA 4FCGA 4LI2A 4I6JB 3O53A 2ELLA 2UZYA 5GS0A 5B0TA 4ARRA 2RR6A 3WPHA 3RFJA 2XOTA 5CMNA 4L3FA 3WPCA 2V9TB 2WQWA 3C6OB 5HZLB 2A0ZA 4XSQA 1FQVA 3WPDA 2Y5QA 3W3JA 2OMTA 5FTTB 5AZ5A 5D3IA 4R5CA 2WQXA 4Q3GA 1P8TA 4WP6A 4NKHA 2RA8A 4CC4C 2ID5A 2OMXA 2OMVA 3WPGA 4HQ1A 3RFSA 4R07A 4WYKA 1P9AG 1W8AA 4PEQB 1XKUA 1SQ0B 4V2CA 2ASSB 3UL8A 4LXRA 4M7EC 5A5CA 4Y61B 3W3GA 3E4GA 2Z81A 3OGKB 5GMGA 3G3BA 2Q4GW 3SB4A 2JE0A 4Z79A 4B8CD 3REZA 1XCDA 4XOSA 4FMZA 4C2BB 3WN4A 1P8VA 3G04C 4R58A 4XGOA 3RW7A 5HDHA 3W3NA 4FD0A 4EZGA 1G9UA 4CC4A 3E3ZA 3A79B 3WPFA 4UFRA 4Z94G 2P1NB 1XEUA 3UL7A 2BEXA 4CP6A 1FT8A 1IO0A 4BSSA 4L3AA 4U06A 4AW4A 4H09A 4KT1A 4V2EA 4CNMA 1WWLA 4M7EA 4U09A 5GMHA 4LSXA 4MQWX 4ECNA 4RCAB 2Z63A 3ZYNA 3CIGA 4Z64C 2OMUA 1OZNA 3C6NB 1XWDC 1A9NA 3RIZA 4BSUA 4PKIG 3M19A 5GMFA 1OOKG 4NKGA 2WQVA 2XWTC 5B4PA 3RW6A 2JQDA 4R5DA 4RCWA 4ECOA 5GS2B 4CILA 3ULVA 4ARNA 1DS9A 4R6FA 5LFNA 1K5DC 4R6AA 2Z7XA 3C6PB 4LI1A 5AWAA 3BZ5A 4PERA 1Z7XW 4LSCA 2Z7XB 3W3LA 1O6TA 3TSRE 1U0ND 4R09A 4LSXC 3KJ4A 3JB9j 1O6VA 1M9SA 3WPEA 3ULAA 4V2DA 3RFEA 4FHOA 3VQ2A 1FS2A 5B0NA 1OGQA 2FT3A 1DFJI 5AWDA 3UL9A 4G8AA 3UN9A 3P72A 4FS7A 3G3AA 4BSRA 2CA6A 1O6SA 1OTNA 3OJAA 5AWBA 4CNCA 3DZEA 2Z64A 3OJAB 2ASTB 5IJBA 1ZIWA 2P1MB 4P8SA 1FO1A 4YEBB 4C2AB 2P1OB 2Z66A 4RWTC 1H6UA 5CMPA 4TZHA 3RGZA 3CIYA 2P1QB 3OGMB 4QC0A 3M18A
chains in the Genus database with same CATH superfamily
1D0BA 2O6RA 1KOOA 5IJCA 3G06A 4GT6A 4PSJA 3E6JA 3FXIA 4Z61C 4Q3IA 4U7LA 2Z65A 4PQ8A 1KOHA 4K17A 4BV4R 2UZXA 3OGLB 5GQRK 2P1PB 1DCEA 1M0ZA 1XECA 2BNHA 4QXEA 1M9LA 3ZYOA 3PMHG 4Q62A 3RGXA 1JL5A 3ULUA 2V9SA 1A4YA 3E2JA 4FDWA 5IYXC 3VQ1A 2O6QA 2Z82A 4R6JA 2IFGA 4NZTM 4R08A 2Z62A 2V70A 4J4LA 1OTMA 2WFHA 4KXFB 1OTOA 1QYYA 3O6NA 1YRGA 3WPIA 2JE1A 4R6GA 3G39A 4R0AA 2O6SA 2WQUA 4AY9X 2OMYA 3RJ0A 4P91A 3ZYJA 2OMWA 3ZYIA 1K5GC 4NZRM 3WPBA 1PGVA 5AWCA 3W3KA 1M10B 4Z8GA 3GOZA 4LXSA 4U08A 5IJDA 4KNGA 4IM6A 1H6TA 4OQTA 3W3MA 2OMZA 4MN8B 4LSAA 4J0MA 1GWBA 4QBZA 3CVRA 4GLPA 1LTXA 2R9UA 4FCGA 4LI2A 4I6JB 3O53A 2ELLA 2UZYA 5GS0A 5B0TA 4ARRA 2RR6A 3WPHA 3RFJA 2XOTA 5CMNA 4L3FA 3WPCA 2V9TB 2WQWA 3C6OB 5HZLB 2A0ZA 4XSQA 1FQVA 3WPDA 2Y5QA 3W3JA 2OMTA 5FTTB 5AZ5A 5D3IA 4R5CA 2WQXA 4Q3GA 1P8TA 4WP6A 4NKHA 2RA8A 4CC4C 2ID5A 2OMXA 2OMVA 3WPGA 4HQ1A 3RFSA 4R07A 4WYKA 1P9AG 1W8AA 4PEQB 1XKUA 1SQ0B 4V2CA 2ASSB 3UL8A 4LXRA 4M7EC 5A5CA 4Y61B 3W3GA 3E4GA 2Z81A 3OGKB 5GMGA 3G3BA 2Q4GW 3SB4A 2JE0A 4Z79A 4B8CD 3REZA 1XCDA 4XOSA 4FMZA 4C2BB 3WN4A 1P8VA 3G04C 4R58A 4XGOA 3RW7A 5HDHA 3W3NA 4FD0A 4EZGA 1G9UA 4CC4A 3E3ZA 3A79B 3WPFA 4UFRA 4Z94G 2P1NB 1XEUA 3UL7A 2BEXA 4CP6A 1FT8A 1IO0A 4BSSA 4L3AA 4U06A 4AW4A 4H09A 4KT1A 4V2EA 4CNMA 1WWLA 4M7EA 4U09A 5GMHA 4LSXA 4MQWX 4ECNA 4RCAB 2Z63A 3ZYNA 3CIGA 4Z64C 2OMUA 1OZNA 3C6NB 1XWDC 1A9NA 3RIZA 4BSUA 4PKIG 3M19A 5GMFA 1OOKG 4NKGA 2WQVA 2XWTC 5B4PA 3RW6A 2JQDA 4R5DA 4RCWA 4ECOA 5GS2B 4CILA 3ULVA 4ARNA 1DS9A 4R6FA 5LFNA 1K5DC 4R6AA 2Z7XA 3C6PB 4LI1A 5AWAA 3BZ5A 4PERA 1Z7XW 4LSCA 2Z7XB 3W3LA 1O6TA 3TSRE 1U0ND 4R09A 4LSXC 3KJ4A 3JB9j 1O6VA 1M9SA 3WPEA 3ULAA 4V2DA 3RFEA 4FHOA 3VQ2A 1FS2A 5B0NA 1OGQA 2FT3A 1DFJI 5AWDA 3UL9A 4G8AA 3UN9A 3P72A 4FS7A 3G3AA 4BSRA 2CA6A 1O6SA 1OTNA 3OJAA 5AWBA 4CNCA 3DZEA 2Z64A 3OJAB 2ASTB 5IJBA 1ZIWA 2P1MB 4P8SA 1FO1A 4YEBB 4C2AB 2P1OB 2Z66A 4RWTC 1H6UA 5CMPA 4TZHA 3RGZA 3CIYA 2P1QB 3OGMB 4QC0A 3M18A
chains in the Genus database with same CATH topology
1D0BA 2O6RA 1KOOA 5IJCA 3G06A 4GT6A 4PSJA 3E6JA 3FXIA 4Z61C 4Q3IA 4U7LA 2Z65A 4PQ8A 1KOHA 4K17A 4BV4R 2UZXA 3OGLB 5GQRK 2P1PB 1DCEA 1M0ZA 1XECA 2BNHA 4QXEA 1M9LA 3ZYOA 3PMHG 4Q62A 3RGXA 1JL5A 3ULUA 2V9SA 1A4YA 3E2JA 4FDWA 5IYXC 3VQ1A 2O6QA 2Z82A 4R6JA 2IFGA 4R08A 2Z62A 2V70A 4J4LA 1OTMA 2WFHA 4KXFB 1OTOA 1QYYA 3O6NA 1YRGA 3WPIA 2JE1A 4R6GA 3G39A 4R0AA 2O6SA 2WQUA 4AY9X 2OMYA 3RJ0A 4P91A 3ZYJA 2OMWA 3ZYIA 1K5GC 3WPBA 1PGVA 5AWCA 3W3KA 1M10B 4Z8GA 3GOZA 4LXSA 4U08A 5IJDA 4KNGA 4IM6A 1H6TA 4OQTA 3W3MA 2OMZA 4MN8B 4LSAA 4J0MA 1GWBA 4QBZA 3CVRA 4GLPA 1LTXA 2R9UA 4FCGA 4LI2A 4I6JB 3O53A 2ELLA 2UZYA 5GS0A 5B0TA 4ARRA 2RR6A 3WPHA 3RFJA 2XOTA 5CMNA 4L3FA 3WPCA 2V9TB 2WQWA 3C6OB 5HZLB 2A0ZA 4XSQA 1FQVA 3WPDA 2Y5QA 3W3JA 2OMTA 5FTTB 5AZ5A 5D3IA 4R5CA 2WQXA 4Q3GA 1P8TA 4WP6A 4NKHA 2RA8A 4CC4C 2ID5A 2OMXA 2OMVA 3WPGA 4HQ1A 3RFSA 4R07A 4WYKA 1P9AG 1W8AA 4PEQB 1XKUA 1SQ0B 4V2CA 2ASSB 3UL8A 4LXRA 4M7EC 5A5CA 4Y61B 3W3GA 3E4GA 2Z81A 3OGKB 5GMGA 3G3BA 2Q4GW 3SB4A 2JE0A 4Z79A 4B8CD 3REZA 1XCDA 4XOSA 4FMZA 4C2BB 3WN4A 1P8VA 3G04C 4R58A 4XGOA 3RW7A 5HDHA 3W3NA 4FD0A 4EZGA 1G9UA 4CC4A 3E3ZA 3A79B 3WPFA 4UFRA 4Z94G 2P1NB 1XEUA 3UL7A 2BEXA 4CP6A 1FT8A 1IO0A 4BSSA 4L3AA 4U06A 4AW4A 4H09A 4KT1A 4V2EA 4CNMA 1WWLA 4M7EA 4U09A 5GMHA 4LSXA 4MQWX 4ECNA 4RCAB 2Z63A 3ZYNA 3CIGA 4Z64C 2OMUA 1OZNA 3C6NB 1XWDC 1A9NA 3RIZA 4BSUA 4PKIG 3M19A 5GMFA 1OOKG 4NKGA 2WQVA 2XWTC 5B4PA 3RW6A 2JQDA 4R5DA 4RCWA 4ECOA 5GS2B 4CILA 3ULVA 4ARNA 1DS9A 4R6FA 5LFNA 1K5DC 4R6AA 2Z7XA 3C6PB 4LI1A 5AWAA 3BZ5A 4PERA 1Z7XW 4LSCA 2Z7XB 3W3LA 1O6TA 3TSRE 1U0ND 4R09A 4LSXC 3KJ4A 3JB9j 1O6VA 1M9SA 3WPEA 3ULAA 4V2DA 3RFEA 4FHOA 3VQ2A 1FS2A 5B0NA 1OGQA 2FT3A 1DFJI 5AWDA 3UL9A 4G8AA 3UN9A 3P72A 4FS7A 3G3AA 4BSRA 2CA6A 1O6SA 1OTNA 3OJAA 5AWBA 4CNCA 3DZEA 2Z64A 3OJAB 2ASTB 5IJBA 1ZIWA 2P1MB 4P8SA 1FO1A 4YEBB 4C2AB 2P1OB 2Z66A 4RWTC 1H6UA 5CMPA 4TZHA 3RGZA 3CIYA 2P1QB 3OGMB 4QC0A 3M18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D0B A;  2O6R A;  1KOO A;  5IJC A;  3G06 A;  4GT6 A;  4PSJ A;  3E6J A;  3FXI A;  4Z61 C;  4Q3I A;  4U7L A;  2Z65 A;  4PQ8 A;  1KOH A;  4K17 A;  4BV4 R;  2UZX A;  3OGL B;  5GQR K;  2P1P B;  1DCE A;  1M0Z A;  1XEC A;  2BNH A;  4QXE A;  1M9L A;  3ZYO A;  3PMH G;  4Q62 A;  3RGX A;  1JL5 A;  3ULU A;  2V9S A;  1A4Y A;  3E2J A;  4FDW A;  5IYX C;  3VQ1 A;  2O6Q A;  2Z82 A;  4R6J A;  2IFG A;  4R08 A;  2Z62 A;  2V70 A;  4J4L A;  1OTM A;  2WFH A;  4KXF B;  1OTO A;  1QYY A;  3O6N A;  1YRG A;  3WPI A;  2JE1 A;  4R6G A;  3G39 A;  4R0A A;  2O6S A;  2WQU A;  4AY9 X;  2OMY A;  3RJ0 A;  4P91 A;  3ZYJ A;  2OMW A;  3ZYI A;  1K5G C;  3WPB A;  1PGV A;  5AWC A;  3W3K A;  1M10 B;  4Z8G A;  3GOZ A;  4LXS A;  4U08 A;  5IJD A;  4KNG A;  4IM6 A;  1H6T A;  4OQT A;  3W3M A;  2OMZ A;  4MN8 B;  4LSA A;  4J0M A;  1GWB A;  4QBZ A;  3CVR A;  4GLP A;  1LTX A;  2R9U A;  4FCG A;  4LI2 A;  4I6J B;  3O53 A;  2ELL A;  2UZY A;  5GS0 A;  5B0T A;  4ARR A;  2RR6 A;  3WPH A;  3RFJ A;  2XOT A;  5CMN A;  4L3F A;  3WPC A;  2V9T B;  2WQW A;  3C6O B;  5HZL B;  2A0Z A;  4XSQ A;  1FQV A;  3WPD A;  2Y5Q A;  3W3J A;  2OMT A;  5FTT B;  5AZ5 A;  5D3I A;  4R5C A;  2WQX A;  4Q3G A;  1P8T A;  4WP6 A;  4NKH A;  2RA8 A;  4CC4 C;  2ID5 A;  2OMX A;  2OMV A;  3WPG A;  4HQ1 A;  3RFS A;  4R07 A;  4WYK A;  1P9A G;  1W8A A;  4PEQ B;  1XKU A;  1SQ0 B;  4V2C A;  2ASS B;  3UL8 A;  4LXR A;  4M7E C;  5A5C A;  4Y61 B;  3W3G A;  3E4G A;  2Z81 A;  3OGK B;  5GMG A;  3G3B A;  2Q4G W;  3SB4 A;  2JE0 A;  4Z79 A;  4B8C D;  3REZ A;  1XCD A;  4XOS A;  4FMZ A;  4C2B B;  3WN4 A;  1P8V A;  3G04 C;  4R58 A;  4XGO A;  3RW7 A;  5HDH A;  3W3N A;  4FD0 A;  4EZG A;  1G9U A;  4CC4 A;  3E3Z A;  3A79 B;  3WPF A;  4UFR A;  4Z94 G;  2P1N B;  1XEU A;  3UL7 A;  2BEX A;  4CP6 A;  1FT8 A;  1IO0 A;  4BSS A;  4L3A A;  4U06 A;  4AW4 A;  4H09 A;  4KT1 A;  4V2E A;  4CNM A;  1WWL A;  4M7E A;  4U09 A;  5GMH A;  4LSX A;  4MQW X;  4ECN A;  4RCA B;  2Z63 A;  3ZYN A;  3CIG A;  4Z64 C;  2OMU A;  1OZN A;  3C6N B;  1XWD C;  1A9N A;  3RIZ A;  4BSU A;  4PKI G;  3M19 A;  5GMF A;  1OOK G;  4NKG A;  2WQV A;  2XWT C;  5B4P A;  3RW6 A;  2JQD A;  4R5D A;  4RCW A;  4ECO A;  5GS2 B;  4CIL A;  3ULV A;  4ARN A;  1DS9 A;  4R6F A;  5LFN A;  1K5D C;  4R6A A;  2Z7X A;  3C6P B;  4LI1 A;  5AWA A;  3BZ5 A;  4PER A;  1Z7X W;  4LSC A;  2Z7X B;  3W3L A;  1O6T A;  3TSR E;  1U0N D;  4R09 A;  4LSX C;  3KJ4 A;  3JB9 j;  1O6V A;  1M9S A;  3WPE A;  3ULA A;  4V2D A;  3RFE A;  4FHO A;  3VQ2 A;  1FS2 A;  5B0N A;  1OGQ A;  2FT3 A;  1DFJ I;  5AWD A;  3UL9 A;  4G8A A;  3UN9 A;  3P72 A;  4FS7 A;  3G3A A;  4BSR A;  2CA6 A;  1O6S A;  1OTN A;  3OJA A;  5AWB A;  4CNC A;  3DZE A;  2Z64 A;  3OJA B;  2AST B;  5IJB A;  1ZIW A;  2P1M B;  4P8S A;  1FO1 A;  4YEB B;  4C2A B;  2P1O B;  2Z66 A;  4RWT C;  1H6U A;  5CMP A;  4TZH A;  3RGZ A;  3CIY A;  2P1Q B;  3OGM B;  4QC0 A;  3M18 A; 
#chains in the Genus database with same CATH topology
 1D0B A;  2O6R A;  1KOO A;  5IJC A;  3G06 A;  4GT6 A;  4PSJ A;  3E6J A;  3FXI A;  4Z61 C;  4Q3I A;  4U7L A;  2Z65 A;  4PQ8 A;  1KOH A;  4K17 A;  4BV4 R;  2UZX A;  3OGL B;  5GQR K;  2P1P B;  1DCE A;  1M0Z A;  1XEC A;  2BNH A;  4QXE A;  1M9L A;  3ZYO A;  3PMH G;  4Q62 A;  3RGX A;  1JL5 A;  3ULU A;  2V9S A;  1A4Y A;  3E2J A;  4FDW A;  5IYX C;  3VQ1 A;  2O6Q A;  2Z82 A;  4R6J A;  2IFG A;  4NZT M;  4R08 A;  2Z62 A;  2V70 A;  4J4L A;  1OTM A;  2WFH A;  4KXF B;  1OTO A;  1QYY A;  3O6N A;  1YRG A;  3WPI A;  2JE1 A;  4R6G A;  3G39 A;  4R0A A;  2O6S A;  2WQU A;  4AY9 X;  2OMY A;  3RJ0 A;  4P91 A;  3ZYJ A;  2OMW A;  3ZYI A;  1K5G C;  4NZR M;  3WPB A;  1PGV A;  5AWC A;  3W3K A;  1M10 B;  4Z8G A;  3GOZ A;  4LXS A;  4U08 A;  5IJD A;  4KNG A;  4IM6 A;  1H6T A;  4OQT A;  3W3M A;  2OMZ A;  4MN8 B;  4LSA A;  4J0M A;  1GWB A;  4QBZ A;  3CVR A;  4GLP A;  1LTX A;  2R9U A;  4FCG A;  4LI2 A;  4I6J B;  3O53 A;  2ELL A;  2UZY A;  5GS0 A;  5B0T A;  4ARR A;  2RR6 A;  3WPH A;  3RFJ A;  2XOT A;  5CMN A;  4L3F A;  3WPC A;  2V9T B;  2WQW A;  3C6O B;  5HZL B;  2A0Z A;  4XSQ A;  1FQV A;  3WPD A;  2Y5Q A;  3W3J A;  2OMT A;  5FTT B;  5AZ5 A;  5D3I A;  4R5C A;  2WQX A;  4Q3G A;  1P8T A;  4WP6 A;  4NKH A;  2RA8 A;  4CC4 C;  2ID5 A;  2OMX A;  2OMV A;  3WPG A;  4HQ1 A;  3RFS A;  4R07 A;  4WYK A;  1P9A G;  1W8A A;  4PEQ B;  1XKU A;  1SQ0 B;  4V2C A;  2ASS B;  3UL8 A;  4LXR A;  4M7E C;  5A5C A;  4Y61 B;  3W3G A;  3E4G A;  2Z81 A;  3OGK B;  5GMG A;  3G3B A;  2Q4G W;  3SB4 A;  2JE0 A;  4Z79 A;  4B8C D;  3REZ A;  1XCD A;  4XOS A;  4FMZ A;  4C2B B;  3WN4 A;  1P8V A;  3G04 C;  4R58 A;  4XGO A;  3RW7 A;  5HDH A;  3W3N A;  4FD0 A;  4EZG A;  1G9U A;  4CC4 A;  3E3Z A;  3A79 B;  3WPF A;  4UFR A;  4Z94 G;  2P1N B;  1XEU A;  3UL7 A;  2BEX A;  4CP6 A;  1FT8 A;  1IO0 A;  4BSS A;  4L3A A;  4U06 A;  4AW4 A;  4H09 A;  4KT1 A;  4V2E A;  4CNM A;  1WWL A;  4M7E A;  4U09 A;  5GMH A;  4LSX A;  4MQW X;  4ECN A;  4RCA B;  2Z63 A;  3ZYN A;  3CIG A;  4Z64 C;  2OMU A;  1OZN A;  3C6N B;  1XWD C;  1A9N A;  3RIZ A;  4BSU A;  4PKI G;  3M19 A;  5GMF A;  1OOK G;  4NKG A;  2WQV A;  2XWT C;  5B4P A;  3RW6 A;  2JQD A;  4R5D A;  4RCW A;  4ECO A;  5GS2 B;  4CIL A;  3ULV A;  4ARN A;  1DS9 A;  4R6F A;  5LFN A;  1K5D C;  4R6A A;  2Z7X A;  3C6P B;  4LI1 A;  5AWA A;  3BZ5 A;  4PER A;  1Z7X W;  4LSC A;  2Z7X B;  3W3L A;  1O6T A;  3TSR E;  1U0N D;  4R09 A;  4LSX C;  3KJ4 A;  3JB9 j;  1O6V A;  1M9S A;  3WPE A;  3ULA A;  4V2D A;  3RFE A;  4FHO A;  3VQ2 A;  1FS2 A;  5B0N A;  1OGQ A;  2FT3 A;  1DFJ I;  5AWD A;  3UL9 A;  4G8A A;  3UN9 A;  3P72 A;  4FS7 A;  3G3A A;  4BSR A;  2CA6 A;  1O6S A;  1OTN A;  3OJA A;  5AWB A;  4CNC A;  3DZE A;  2Z64 A;  3OJA B;  2AST B;  5IJB A;  1ZIW A;  2P1M B;  4P8S A;  1FO1 A;  4YEB B;  4C2A B;  2P1O B;  2Z66 A;  4RWT C;  1H6U A;  5CMP A;  4TZH A;  3RGZ A;  3CIY A;  2P1Q B;  3OGM B;  4QC0 A;  3M18 A; 
#chains in the Genus database with same CATH homology
 1D0B A;  2O6R A;  1KOO A;  5IJC A;  3G06 A;  4GT6 A;  4PSJ A;  3E6J A;  3FXI A;  4Z61 C;  4Q3I A;  4U7L A;  2Z65 A;  4PQ8 A;  1KOH A;  4K17 A;  4BV4 R;  2UZX A;  3OGL B;  5GQR K;  2P1P B;  1DCE A;  1M0Z A;  1XEC A;  2BNH A;  4QXE A;  1M9L A;  3ZYO A;  3PMH G;  4Q62 A;  3RGX A;  1JL5 A;  3ULU A;  2V9S A;  1A4Y A;  3E2J A;  4FDW A;  5IYX C;  3VQ1 A;  2O6Q A;  2Z82 A;  4R6J A;  2IFG A;  4R08 A;  2Z62 A;  2V70 A;  4J4L A;  1OTM A;  2WFH A;  4KXF B;  1OTO A;  1QYY A;  3O6N A;  1YRG A;  3WPI A;  2JE1 A;  4R6G A;  3G39 A;  4R0A A;  2O6S A;  2WQU A;  4AY9 X;  2OMY A;  3RJ0 A;  4P91 A;  3ZYJ A;  2OMW A;  3ZYI A;  1K5G C;  3WPB A;  1PGV A;  5AWC A;  3W3K A;  1M10 B;  4Z8G A;  3GOZ A;  4LXS A;  4U08 A;  5IJD A;  4KNG A;  4IM6 A;  1H6T A;  4OQT A;  3W3M A;  2OMZ A;  4MN8 B;  4LSA A;  4J0M A;  1GWB A;  4QBZ A;  3CVR A;  4GLP A;  1LTX A;  2R9U A;  4FCG A;  4LI2 A;  4I6J B;  3O53 A;  2ELL A;  2UZY A;  5GS0 A;  5B0T A;  4ARR A;  2RR6 A;  3WPH A;  3RFJ A;  2XOT A;  5CMN A;  4L3F A;  3WPC A;  2V9T B;  2WQW A;  3C6O B;  5HZL B;  2A0Z A;  4XSQ A;  1FQV A;  3WPD A;  2Y5Q A;  3W3J A;  2OMT A;  5FTT B;  5AZ5 A;  5D3I A;  4R5C A;  2WQX A;  4Q3G A;  1P8T A;  4WP6 A;  4NKH A;  2RA8 A;  4CC4 C;  2ID5 A;  2OMX A;  2OMV A;  3WPG A;  4HQ1 A;  3RFS A;  4R07 A;  4WYK A;  1P9A G;  1W8A A;  4PEQ B;  1XKU A;  1SQ0 B;  4V2C A;  2ASS B;  3UL8 A;  4LXR A;  4M7E C;  5A5C A;  4Y61 B;  3W3G A;  3E4G A;  2Z81 A;  3OGK B;  5GMG A;  3G3B A;  2Q4G W;  3SB4 A;  2JE0 A;  4Z79 A;  4B8C D;  3REZ A;  1XCD A;  4XOS A;  4FMZ A;  4C2B B;  3WN4 A;  1P8V A;  3G04 C;  4R58 A;  4XGO A;  3RW7 A;  5HDH A;  3W3N A;  4FD0 A;  4EZG A;  1G9U A;  4CC4 A;  3E3Z A;  3A79 B;  3WPF A;  4UFR A;  4Z94 G;  2P1N B;  1XEU A;  3UL7 A;  2BEX A;  4CP6 A;  1FT8 A;  1IO0 A;  4BSS A;  4L3A A;  4U06 A;  4AW4 A;  4H09 A;  4KT1 A;  4V2E A;  4CNM A;  1WWL A;  4M7E A;  4U09 A;  5GMH A;  4LSX A;  4MQW X;  4ECN A;  4RCA B;  2Z63 A;  3ZYN A;  3CIG A;  4Z64 C;  2OMU A;  1OZN A;  3C6N B;  1XWD C;  1A9N A;  3RIZ A;  4BSU A;  4PKI G;  3M19 A;  5GMF A;  1OOK G;  4NKG A;  2WQV A;  2XWT C;  5B4P A;  3RW6 A;  2JQD A;  4R5D A;  4RCW A;  4ECO A;  5GS2 B;  4CIL A;  3ULV A;  4ARN A;  1DS9 A;  4R6F A;  5LFN A;  1K5D C;  4R6A A;  2Z7X A;  3C6P B;  4LI1 A;  5AWA A;  3BZ5 A;  4PER A;  1Z7X W;  4LSC A;  2Z7X B;  3W3L A;  1O6T A;  3TSR E;  1U0N D;  4R09 A;  4LSX C;  3KJ4 A;  3JB9 j;  1O6V A;  1M9S A;  3WPE A;  3ULA A;  4V2D A;  3RFE A;  4FHO A;  3VQ2 A;  1FS2 A;  5B0N A;  1OGQ A;  2FT3 A;  1DFJ I;  5AWD A;  3UL9 A;  4G8A A;  3UN9 A;  3P72 A;  4FS7 A;  3G3A A;  4BSR A;  2CA6 A;  1O6S A;  1OTN A;  3OJA A;  5AWB A;  4CNC A;  3DZE A;  2Z64 A;  3OJA B;  2AST B;  5IJB A;  1ZIW A;  2P1M B;  4P8S A;  1FO1 A;  4YEB B;  4C2A B;  2P1O B;  2Z66 A;  4RWT C;  1H6U A;  5CMP A;  4TZH A;  3RGZ A;  3CIY A;  2P1Q B;  3OGM B;  4QC0 A;  3M18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...