4WP6A

Structure of the mex67 lrr domain from chaetomium thermophilum
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
164
structure length
151
Chain Sequence
TKQKLTSCLARRYNAEQKLLDLSALGTDLAEKSFKALMHLVSNEYKDPEQKNEAIQAVSLARNDILDVGQVYSLAVTLPRLRRLDLSGNNLENLSKISKWQQEFRFLEELHLTGNPVTTLPNYATEIKKWFPSLQILDGQQIRTPQEAAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transport protein
molecule keywords mRNA export protein
total genus 61
structure length 151
sequence length 164
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4wp6A00
4FDWA 4PQ8A 4L3FA 4M7EA 5IJCA 1M0ZA 1XWDC 1QYYA 1DFJI 1PGVA 3C6NB 3RFEA 4PSJA 2P1PB 4BSSA 4BV4R 1FQVA 4RCAB 3W3NA 3WPIA 5A5CA 4LI1A 3ZYIA 4R6GA 3ULUA 2ASTB 4FCGA 3ZYJA 4Z94G 4KNGA 2RA8A 4WYKA 2OMVA 2CA6A 4Y61B 2Z7XB 1P8VA 4U09A 4LSXA 3OJAA 2RR6A 2WQVA 5FTTB 3DZEA 2Z7XA 2Q4GW 4V2DA 5IJDA 3W3JA 2XWTC 3O6NA 3P72A 3G3AA 4RCWA 2V9SA 3A79B 4TZHA 4CNCA 3UL7A 4ARNA 1XEUA 3CIGA 5CMPA 5IYXC 4ARRA 3M18A 1O6VA 5AZ5A 4XSQA 3RGXA 3RJ0A 4R09A 1U0ND 5B0TA 3WPFA 3RFJA 5AWDA 3W3LA 2ID5A 3ZYOA 5AWAA 4NKHA 5AWBA 4QBZA 2OMZA 1P9AG 4K17A 1O6SA 4XOSA 4U7LA 2FT3A 1P8TA 1SQ0B 2Z66A 4LI2A 4WP6A 1GWBA 3TSRE 4C2AB 4R08A 1YRGA 3W3MA 3G06A 2XOTA 3OGKB 4Z64C 4XGOA 1JL5A 1A9NA 4FD0A 3UL8A 5CMNA 4ECOA 4LXSA 4R6AA 3RIZA 2UZYA 3SB4A 4CC4A 4RWTC 2Z64A 4HQ1A 2Z81A 1G9UA 1K5DC 2V70A 4Z79A 2JQDA 1FO1A 3G39A 1OTMA 4NKGA 4FS7A 1M10B 4PKIG 4U08A 4BSRA 3WPDA 3BZ5A 4C2BB 3VQ1A 3W3GA 5LFNA 4P8SA 4FHOA 3RW6A 2P1MB 4KT1A 2WFHA 5D3IA 4J0MA 3G3BA 3WPCA 2O6QA 2ASSB 3OGLB 4ECNA 2WQWA 5HZLB 4OQTA 3C6PB 2OMYA 3GOZA 3M19A 2Z82A 3OGMB 4I6JB 4MQWX 5GQRK 3RW7A 4QC0A 1H6TA 4R6FA 1OTNA 2OMTA 2BEXA 1W8AA 4J4LA 1FT8A 4Q3GA 3KJ4A 4R5CA 3WPEA 1DS9A 1OOKG 1O6TA 4R6JA 4GLPA 3ZYNA 4G8AA 4GT6A 4P91A 2OMWA 3UN9A 3G04C 3E4GA 5HDHA 4AY9X 1K5GC 5B0NA 3VQ2A 4BSUA 2P1QB 4L3AA 4PEQB 3ULVA 3JB9j 3WPBA 5GMFA 2P1OB 4UFRA 2ELLA 4CC4C 3E3ZA 1DCEA 1OGQA 2WQUA 2IFGA 1KOHA 4LSCA 4Z61C 3REZA 1D0BA 1M9SA 1WWLA 4KXFB 4LSXC 4R07A 3C6OB 3W3KA 3CIYA 4V2EA 1XKUA 5GS0A 1LTXA 4IM6A 4M7EC 3O53A 4LSAA 4YEBB 2A0ZA 2Z63A 2V9TB 4MN8B 2UZXA 4CP6A 2P1NB 1ZIWA 4V2CA 3FXIA 5AWCA 3WPHA 2JE1A 4H09A 4AW4A 1M9LA 1XECA 3WN4A 4QXEA 3CVRA 2WQXA 4PERA 3WPGA 5IJBA 4CILA 1OZNA 4Q62A 2O6RA 4B8CD 2OMXA 1A4YA 2R9UA 4R5DA 3E2JA 4R0AA 5GS2B 4Z8GA 1H6UA 1KOOA 2Z65A 1OTOA 2JE0A 1IO0A 3OJAB 4R58A 5B4PA 3RFSA 2OMUA 3PMHG 4FMZA 3ULAA 3UL9A 4CNMA 4Q3IA 1FS2A 4U06A 5GMGA 4LXRA 2O6SA 5GMHA 3RGZA 4EZGA 2Z62A 1XCDA 1Z7XW 2BNHA 2Y5QA 3E6JA
chains in the Genus database with same CATH superfamily
4FDWA 4PQ8A 4L3FA 4M7EA 5IJCA 1M0ZA 1XWDC 1QYYA 1DFJI 1PGVA 3C6NB 3RFEA 4PSJA 2P1PB 4BSSA 4BV4R 1FQVA 4NZRM 4RCAB 3W3NA 3WPIA 5A5CA 4LI1A 3ZYIA 4R6GA 3ULUA 2ASTB 4FCGA 3ZYJA 4Z94G 4KNGA 2RA8A 4WYKA 2OMVA 2CA6A 4Y61B 2Z7XB 1P8VA 4U09A 4LSXA 3OJAA 2RR6A 2WQVA 5FTTB 3DZEA 2Z7XA 2Q4GW 4V2DA 5IJDA 3W3JA 2XWTC 3O6NA 3P72A 3G3AA 4RCWA 2V9SA 3A79B 4TZHA 4CNCA 3UL7A 4ARNA 1XEUA 3CIGA 5CMPA 5IYXC 4ARRA 3M18A 1O6VA 5AZ5A 4XSQA 3RGXA 3RJ0A 4R09A 1U0ND 5B0TA 3WPFA 3RFJA 5AWDA 3W3LA 2ID5A 3ZYOA 4NZTM 4NKHA 5AWAA 5AWBA 4QBZA 2OMZA 1P9AG 4K17A 1O6SA 4XOSA 4U7LA 2FT3A 1P8TA 1SQ0B 2Z66A 4LI2A 4WP6A 1GWBA 3TSRE 4C2AB 4R08A 1YRGA 3W3MA 3G06A 2XOTA 3OGKB 4Z64C 4XGOA 1JL5A 1A9NA 4FD0A 3UL8A 5CMNA 4ECOA 4LXSA 4R6AA 3RIZA 2UZYA 3SB4A 4CC4A 4RWTC 2Z64A 4HQ1A 2Z81A 1G9UA 1K5DC 2V70A 4Z79A 2JQDA 1FO1A 3G39A 1OTMA 4NKGA 4FS7A 1M10B 4PKIG 4U08A 4BSRA 3WPDA 3BZ5A 4C2BB 3VQ1A 3W3GA 5LFNA 4P8SA 4FHOA 3RW6A 2P1MB 4KT1A 2WFHA 5D3IA 4J0MA 3G3BA 3WPCA 2O6QA 2ASSB 3OGLB 4ECNA 2WQWA 5HZLB 4OQTA 3C6PB 2OMYA 3GOZA 3M19A 2Z82A 3OGMB 4I6JB 4MQWX 5GQRK 3RW7A 4QC0A 1H6TA 4R6FA 1OTNA 2OMTA 2BEXA 1W8AA 4J4LA 1FT8A 4Q3GA 3KJ4A 4R5CA 3WPEA 1DS9A 1OOKG 1O6TA 4R6JA 4GLPA 3ZYNA 4G8AA 4GT6A 4P91A 2OMWA 3UN9A 3G04C 3E4GA 5HDHA 4AY9X 1K5GC 5B0NA 3VQ2A 4BSUA 2P1QB 4L3AA 4PEQB 3ULVA 3JB9j 3WPBA 5GMFA 2P1OB 4UFRA 2ELLA 4CC4C 3E3ZA 1DCEA 1OGQA 2WQUA 2IFGA 1KOHA 4LSCA 4Z61C 3REZA 1D0BA 1M9SA 1WWLA 4KXFB 4LSXC 4R07A 3C6OB 3W3KA 3CIYA 4V2EA 1XKUA 5GS0A 1LTXA 4IM6A 4M7EC 3O53A 4LSAA 4YEBB 2A0ZA 2Z63A 2V9TB 4MN8B 2UZXA 4CP6A 2P1NB 1ZIWA 4V2CA 3FXIA 5AWCA 3WPHA 2JE1A 4H09A 4AW4A 1M9LA 1XECA 3WN4A 4QXEA 3CVRA 2WQXA 4PERA 3WPGA 5IJBA 4CILA 1OZNA 4Q62A 2O6RA 4B8CD 2OMXA 1A4YA 2R9UA 4R5DA 3E2JA 4R0AA 5GS2B 4Z8GA 1H6UA 1KOOA 2Z65A 1OTOA 2JE0A 1IO0A 3OJAB 4R58A 5B4PA 3RFSA 2OMUA 3PMHG 4FMZA 3ULAA 3UL9A 4CNMA 4Q3IA 1FS2A 4U06A 5GMGA 4LXRA 2O6SA 5GMHA 3RGZA 4EZGA 2Z62A 1XCDA 1Z7XW 2BNHA 2Y5QA 3E6JA
chains in the Genus database with same CATH topology
4FDWA 4PQ8A 4L3FA 4M7EA 5IJCA 1M0ZA 1XWDC 1QYYA 1DFJI 1PGVA 3C6NB 3RFEA 4PSJA 2P1PB 4BSSA 4BV4R 1FQVA 4RCAB 3W3NA 3WPIA 5A5CA 4LI1A 3ZYIA 4R6GA 3ULUA 2ASTB 4FCGA 3ZYJA 4Z94G 4KNGA 2RA8A 4WYKA 2OMVA 2CA6A 4Y61B 2Z7XB 1P8VA 4U09A 4LSXA 3OJAA 2RR6A 2WQVA 5FTTB 3DZEA 2Z7XA 2Q4GW 4V2DA 5IJDA 3W3JA 2XWTC 3O6NA 3P72A 3G3AA 4RCWA 2V9SA 3A79B 4TZHA 4CNCA 3UL7A 4ARNA 1XEUA 3CIGA 5CMPA 5IYXC 4ARRA 3M18A 1O6VA 5AZ5A 4XSQA 3RGXA 3RJ0A 4R09A 1U0ND 5B0TA 3WPFA 3RFJA 5AWDA 3W3LA 2ID5A 3ZYOA 5AWAA 4NKHA 5AWBA 4QBZA 2OMZA 1P9AG 4K17A 1O6SA 4XOSA 4U7LA 2FT3A 1P8TA 1SQ0B 2Z66A 4LI2A 4WP6A 1GWBA 3TSRE 4C2AB 4R08A 1YRGA 3W3MA 3G06A 2XOTA 3OGKB 4Z64C 4XGOA 1JL5A 1A9NA 4FD0A 3UL8A 5CMNA 4ECOA 4LXSA 4R6AA 3RIZA 2UZYA 3SB4A 4CC4A 4RWTC 2Z64A 4HQ1A 2Z81A 1G9UA 1K5DC 2V70A 4Z79A 2JQDA 1FO1A 3G39A 1OTMA 4NKGA 4FS7A 1M10B 4PKIG 4U08A 4BSRA 3WPDA 3BZ5A 4C2BB 3VQ1A 3W3GA 5LFNA 4P8SA 4FHOA 3RW6A 2P1MB 4KT1A 2WFHA 5D3IA 4J0MA 3G3BA 3WPCA 2O6QA 2ASSB 3OGLB 4ECNA 2WQWA 5HZLB 4OQTA 3C6PB 2OMYA 3GOZA 3M19A 2Z82A 3OGMB 4I6JB 4MQWX 5GQRK 3RW7A 4QC0A 1H6TA 4R6FA 1OTNA 2OMTA 2BEXA 1W8AA 4J4LA 1FT8A 4Q3GA 3KJ4A 4R5CA 3WPEA 1DS9A 1OOKG 1O6TA 4R6JA 4GLPA 3ZYNA 4G8AA 4GT6A 4P91A 2OMWA 3UN9A 3G04C 3E4GA 5HDHA 4AY9X 1K5GC 5B0NA 3VQ2A 4BSUA 2P1QB 4L3AA 4PEQB 3ULVA 3JB9j 3WPBA 5GMFA 2P1OB 4UFRA 2ELLA 4CC4C 3E3ZA 1DCEA 1OGQA 2WQUA 2IFGA 1KOHA 4LSCA 4Z61C 3REZA 1D0BA 1M9SA 1WWLA 4KXFB 4LSXC 4R07A 3C6OB 3W3KA 3CIYA 4V2EA 1XKUA 5GS0A 1LTXA 4IM6A 4M7EC 3O53A 4LSAA 4YEBB 2A0ZA 2Z63A 2V9TB 4MN8B 2UZXA 4CP6A 2P1NB 1ZIWA 4V2CA 3FXIA 5AWCA 3WPHA 2JE1A 4H09A 4AW4A 1M9LA 1XECA 3WN4A 4QXEA 3CVRA 2WQXA 4PERA 3WPGA 5IJBA 4CILA 1OZNA 4Q62A 2O6RA 4B8CD 2OMXA 1A4YA 2R9UA 4R5DA 3E2JA 4R0AA 5GS2B 4Z8GA 1H6UA 1KOOA 2Z65A 1OTOA 2JE0A 1IO0A 3OJAB 4R58A 5B4PA 3RFSA 2OMUA 3PMHG 4FMZA 3ULAA 3UL9A 4CNMA 4Q3IA 1FS2A 4U06A 5GMGA 4LXRA 2O6SA 5GMHA 3RGZA 4EZGA 2Z62A 1XCDA 1Z7XW 2BNHA 2Y5QA 3E6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FDW A;  4PQ8 A;  4L3F A;  4M7E A;  5IJC A;  1M0Z A;  1XWD C;  1QYY A;  1DFJ I;  1PGV A;  3C6N B;  3RFE A;  4PSJ A;  2P1P B;  4BSS A;  4BV4 R;  1FQV A;  4RCA B;  3W3N A;  3WPI A;  5A5C A;  4LI1 A;  3ZYI A;  4R6G A;  3ULU A;  2AST B;  4FCG A;  3ZYJ A;  4Z94 G;  4KNG A;  2RA8 A;  4WYK A;  2OMV A;  2CA6 A;  4Y61 B;  2Z7X B;  1P8V A;  4U09 A;  4LSX A;  3OJA A;  2RR6 A;  2WQV A;  5FTT B;  3DZE A;  2Z7X A;  2Q4G W;  4V2D A;  5IJD A;  3W3J A;  2XWT C;  3O6N A;  3P72 A;  3G3A A;  4RCW A;  2V9S A;  3A79 B;  4TZH A;  4CNC A;  3UL7 A;  4ARN A;  1XEU A;  3CIG A;  5CMP A;  5IYX C;  4ARR A;  3M18 A;  1O6V A;  5AZ5 A;  4XSQ A;  3RGX A;  3RJ0 A;  4R09 A;  1U0N D;  5B0T A;  3WPF A;  3RFJ A;  5AWD A;  3W3L A;  2ID5 A;  3ZYO A;  5AWA A;  4NKH A;  5AWB A;  4QBZ A;  2OMZ A;  1P9A G;  4K17 A;  1O6S A;  4XOS A;  4U7L A;  2FT3 A;  1P8T A;  1SQ0 B;  2Z66 A;  4LI2 A;  4WP6 A;  1GWB A;  3TSR E;  4C2A B;  4R08 A;  1YRG A;  3W3M A;  3G06 A;  2XOT A;  3OGK B;  4Z64 C;  4XGO A;  1JL5 A;  1A9N A;  4FD0 A;  3UL8 A;  5CMN A;  4ECO A;  4LXS A;  4R6A A;  3RIZ A;  2UZY A;  3SB4 A;  4CC4 A;  4RWT C;  2Z64 A;  4HQ1 A;  2Z81 A;  1G9U A;  1K5D C;  2V70 A;  4Z79 A;  2JQD A;  1FO1 A;  3G39 A;  1OTM A;  4NKG A;  4FS7 A;  1M10 B;  4PKI G;  4U08 A;  4BSR A;  3WPD A;  3BZ5 A;  4C2B B;  3VQ1 A;  3W3G A;  5LFN A;  4P8S A;  4FHO A;  3RW6 A;  2P1M B;  4KT1 A;  2WFH A;  5D3I A;  4J0M A;  3G3B A;  3WPC A;  2O6Q A;  2ASS B;  3OGL B;  4ECN A;  2WQW A;  5HZL B;  4OQT A;  3C6P B;  2OMY A;  3GOZ A;  3M19 A;  2Z82 A;  3OGM B;  4I6J B;  4MQW X;  5GQR K;  3RW7 A;  4QC0 A;  1H6T A;  4R6F A;  1OTN A;  2OMT A;  2BEX A;  1W8A A;  4J4L A;  1FT8 A;  4Q3G A;  3KJ4 A;  4R5C A;  3WPE A;  1DS9 A;  1OOK G;  1O6T A;  4R6J A;  4GLP A;  3ZYN A;  4G8A A;  4GT6 A;  4P91 A;  2OMW A;  3UN9 A;  3G04 C;  3E4G A;  5HDH A;  4AY9 X;  1K5G C;  5B0N A;  3VQ2 A;  4BSU A;  2P1Q B;  4L3A A;  4PEQ B;  3ULV A;  3JB9 j;  3WPB A;  5GMF A;  2P1O B;  4UFR A;  2ELL A;  4CC4 C;  3E3Z A;  1DCE A;  1OGQ A;  2WQU A;  2IFG A;  1KOH A;  4LSC A;  4Z61 C;  3REZ A;  1D0B A;  1M9S A;  1WWL A;  4KXF B;  4LSX C;  4R07 A;  3C6O B;  3W3K A;  3CIY A;  4V2E A;  1XKU A;  5GS0 A;  1LTX A;  4IM6 A;  4M7E C;  3O53 A;  4LSA A;  4YEB B;  2A0Z A;  2Z63 A;  2V9T B;  4MN8 B;  2UZX A;  4CP6 A;  2P1N B;  1ZIW A;  4V2C A;  3FXI A;  5AWC A;  3WPH A;  2JE1 A;  4H09 A;  4AW4 A;  1M9L A;  1XEC A;  3WN4 A;  4QXE A;  3CVR A;  2WQX A;  4PER A;  3WPG A;  5IJB A;  4CIL A;  1OZN A;  4Q62 A;  2O6R A;  4B8C D;  2OMX A;  1A4Y A;  2R9U A;  4R5D A;  3E2J A;  4R0A A;  5GS2 B;  4Z8G A;  1H6U A;  1KOO A;  2Z65 A;  1OTO A;  2JE0 A;  1IO0 A;  3OJA B;  4R58 A;  5B4P A;  3RFS A;  2OMU A;  3PMH G;  4FMZ A;  3ULA A;  3UL9 A;  4CNM A;  4Q3I A;  1FS2 A;  4U06 A;  5GMG A;  4LXR A;  2O6S A;  5GMH A;  3RGZ A;  4EZG A;  2Z62 A;  1XCD A;  1Z7X W;  2BNH A;  2Y5Q A;  3E6J A; 
#chains in the Genus database with same CATH topology
 4FDW A;  4PQ8 A;  4L3F A;  4M7E A;  5IJC A;  1M0Z A;  1XWD C;  1QYY A;  1DFJ I;  1PGV A;  3C6N B;  3RFE A;  4PSJ A;  2P1P B;  4BSS A;  4BV4 R;  1FQV A;  4NZR M;  4RCA B;  3W3N A;  3WPI A;  5A5C A;  4LI1 A;  3ZYI A;  4R6G A;  3ULU A;  2AST B;  4FCG A;  3ZYJ A;  4Z94 G;  4KNG A;  2RA8 A;  4WYK A;  2OMV A;  2CA6 A;  4Y61 B;  2Z7X B;  1P8V A;  4U09 A;  4LSX A;  3OJA A;  2RR6 A;  2WQV A;  5FTT B;  3DZE A;  2Z7X A;  2Q4G W;  4V2D A;  5IJD A;  3W3J A;  2XWT C;  3O6N A;  3P72 A;  3G3A A;  4RCW A;  2V9S A;  3A79 B;  4TZH A;  4CNC A;  3UL7 A;  4ARN A;  1XEU A;  3CIG A;  5CMP A;  5IYX C;  4ARR A;  3M18 A;  1O6V A;  5AZ5 A;  4XSQ A;  3RGX A;  3RJ0 A;  4R09 A;  1U0N D;  5B0T A;  3WPF A;  3RFJ A;  5AWD A;  3W3L A;  2ID5 A;  3ZYO A;  4NZT M;  4NKH A;  5AWA A;  5AWB A;  4QBZ A;  2OMZ A;  1P9A G;  4K17 A;  1O6S A;  4XOS A;  4U7L A;  2FT3 A;  1P8T A;  1SQ0 B;  2Z66 A;  4LI2 A;  4WP6 A;  1GWB A;  3TSR E;  4C2A B;  4R08 A;  1YRG A;  3W3M A;  3G06 A;  2XOT A;  3OGK B;  4Z64 C;  4XGO A;  1JL5 A;  1A9N A;  4FD0 A;  3UL8 A;  5CMN A;  4ECO A;  4LXS A;  4R6A A;  3RIZ A;  2UZY A;  3SB4 A;  4CC4 A;  4RWT C;  2Z64 A;  4HQ1 A;  2Z81 A;  1G9U A;  1K5D C;  2V70 A;  4Z79 A;  2JQD A;  1FO1 A;  3G39 A;  1OTM A;  4NKG A;  4FS7 A;  1M10 B;  4PKI G;  4U08 A;  4BSR A;  3WPD A;  3BZ5 A;  4C2B B;  3VQ1 A;  3W3G A;  5LFN A;  4P8S A;  4FHO A;  3RW6 A;  2P1M B;  4KT1 A;  2WFH A;  5D3I A;  4J0M A;  3G3B A;  3WPC A;  2O6Q A;  2ASS B;  3OGL B;  4ECN A;  2WQW A;  5HZL B;  4OQT A;  3C6P B;  2OMY A;  3GOZ A;  3M19 A;  2Z82 A;  3OGM B;  4I6J B;  4MQW X;  5GQR K;  3RW7 A;  4QC0 A;  1H6T A;  4R6F A;  1OTN A;  2OMT A;  2BEX A;  1W8A A;  4J4L A;  1FT8 A;  4Q3G A;  3KJ4 A;  4R5C A;  3WPE A;  1DS9 A;  1OOK G;  1O6T A;  4R6J A;  4GLP A;  3ZYN A;  4G8A A;  4GT6 A;  4P91 A;  2OMW A;  3UN9 A;  3G04 C;  3E4G A;  5HDH A;  4AY9 X;  1K5G C;  5B0N A;  3VQ2 A;  4BSU A;  2P1Q B;  4L3A A;  4PEQ B;  3ULV A;  3JB9 j;  3WPB A;  5GMF A;  2P1O B;  4UFR A;  2ELL A;  4CC4 C;  3E3Z A;  1DCE A;  1OGQ A;  2WQU A;  2IFG A;  1KOH A;  4LSC A;  4Z61 C;  3REZ A;  1D0B A;  1M9S A;  1WWL A;  4KXF B;  4LSX C;  4R07 A;  3C6O B;  3W3K A;  3CIY A;  4V2E A;  1XKU A;  5GS0 A;  1LTX A;  4IM6 A;  4M7E C;  3O53 A;  4LSA A;  4YEB B;  2A0Z A;  2Z63 A;  2V9T B;  4MN8 B;  2UZX A;  4CP6 A;  2P1N B;  1ZIW A;  4V2C A;  3FXI A;  5AWC A;  3WPH A;  2JE1 A;  4H09 A;  4AW4 A;  1M9L A;  1XEC A;  3WN4 A;  4QXE A;  3CVR A;  2WQX A;  4PER A;  3WPG A;  5IJB A;  4CIL A;  1OZN A;  4Q62 A;  2O6R A;  4B8C D;  2OMX A;  1A4Y A;  2R9U A;  4R5D A;  3E2J A;  4R0A A;  5GS2 B;  4Z8G A;  1H6U A;  1KOO A;  2Z65 A;  1OTO A;  2JE0 A;  1IO0 A;  3OJA B;  4R58 A;  5B4P A;  3RFS A;  2OMU A;  3PMH G;  4FMZ A;  3ULA A;  3UL9 A;  4CNM A;  4Q3I A;  1FS2 A;  4U06 A;  5GMG A;  4LXR A;  2O6S A;  5GMH A;  3RGZ A;  4EZG A;  2Z62 A;  1XCD A;  1Z7X W;  2BNH A;  2Y5Q A;  3E6J A; 
#chains in the Genus database with same CATH homology
 4FDW A;  4PQ8 A;  4L3F A;  4M7E A;  5IJC A;  1M0Z A;  1XWD C;  1QYY A;  1DFJ I;  1PGV A;  3C6N B;  3RFE A;  4PSJ A;  2P1P B;  4BSS A;  4BV4 R;  1FQV A;  4RCA B;  3W3N A;  3WPI A;  5A5C A;  4LI1 A;  3ZYI A;  4R6G A;  3ULU A;  2AST B;  4FCG A;  3ZYJ A;  4Z94 G;  4KNG A;  2RA8 A;  4WYK A;  2OMV A;  2CA6 A;  4Y61 B;  2Z7X B;  1P8V A;  4U09 A;  4LSX A;  3OJA A;  2RR6 A;  2WQV A;  5FTT B;  3DZE A;  2Z7X A;  2Q4G W;  4V2D A;  5IJD A;  3W3J A;  2XWT C;  3O6N A;  3P72 A;  3G3A A;  4RCW A;  2V9S A;  3A79 B;  4TZH A;  4CNC A;  3UL7 A;  4ARN A;  1XEU A;  3CIG A;  5CMP A;  5IYX C;  4ARR A;  3M18 A;  1O6V A;  5AZ5 A;  4XSQ A;  3RGX A;  3RJ0 A;  4R09 A;  1U0N D;  5B0T A;  3WPF A;  3RFJ A;  5AWD A;  3W3L A;  2ID5 A;  3ZYO A;  5AWA A;  4NKH A;  5AWB A;  4QBZ A;  2OMZ A;  1P9A G;  4K17 A;  1O6S A;  4XOS A;  4U7L A;  2FT3 A;  1P8T A;  1SQ0 B;  2Z66 A;  4LI2 A;  4WP6 A;  1GWB A;  3TSR E;  4C2A B;  4R08 A;  1YRG A;  3W3M A;  3G06 A;  2XOT A;  3OGK B;  4Z64 C;  4XGO A;  1JL5 A;  1A9N A;  4FD0 A;  3UL8 A;  5CMN A;  4ECO A;  4LXS A;  4R6A A;  3RIZ A;  2UZY A;  3SB4 A;  4CC4 A;  4RWT C;  2Z64 A;  4HQ1 A;  2Z81 A;  1G9U A;  1K5D C;  2V70 A;  4Z79 A;  2JQD A;  1FO1 A;  3G39 A;  1OTM A;  4NKG A;  4FS7 A;  1M10 B;  4PKI G;  4U08 A;  4BSR A;  3WPD A;  3BZ5 A;  4C2B B;  3VQ1 A;  3W3G A;  5LFN A;  4P8S A;  4FHO A;  3RW6 A;  2P1M B;  4KT1 A;  2WFH A;  5D3I A;  4J0M A;  3G3B A;  3WPC A;  2O6Q A;  2ASS B;  3OGL B;  4ECN A;  2WQW A;  5HZL B;  4OQT A;  3C6P B;  2OMY A;  3GOZ A;  3M19 A;  2Z82 A;  3OGM B;  4I6J B;  4MQW X;  5GQR K;  3RW7 A;  4QC0 A;  1H6T A;  4R6F A;  1OTN A;  2OMT A;  2BEX A;  1W8A A;  4J4L A;  1FT8 A;  4Q3G A;  3KJ4 A;  4R5C A;  3WPE A;  1DS9 A;  1OOK G;  1O6T A;  4R6J A;  4GLP A;  3ZYN A;  4G8A A;  4GT6 A;  4P91 A;  2OMW A;  3UN9 A;  3G04 C;  3E4G A;  5HDH A;  4AY9 X;  1K5G C;  5B0N A;  3VQ2 A;  4BSU A;  2P1Q B;  4L3A A;  4PEQ B;  3ULV A;  3JB9 j;  3WPB A;  5GMF A;  2P1O B;  4UFR A;  2ELL A;  4CC4 C;  3E3Z A;  1DCE A;  1OGQ A;  2WQU A;  2IFG A;  1KOH A;  4LSC A;  4Z61 C;  3REZ A;  1D0B A;  1M9S A;  1WWL A;  4KXF B;  4LSX C;  4R07 A;  3C6O B;  3W3K A;  3CIY A;  4V2E A;  1XKU A;  5GS0 A;  1LTX A;  4IM6 A;  4M7E C;  3O53 A;  4LSA A;  4YEB B;  2A0Z A;  2Z63 A;  2V9T B;  4MN8 B;  2UZX A;  4CP6 A;  2P1N B;  1ZIW A;  4V2C A;  3FXI A;  5AWC A;  3WPH A;  2JE1 A;  4H09 A;  4AW4 A;  1M9L A;  1XEC A;  3WN4 A;  4QXE A;  3CVR A;  2WQX A;  4PER A;  3WPG A;  5IJB A;  4CIL A;  1OZN A;  4Q62 A;  2O6R A;  4B8C D;  2OMX A;  1A4Y A;  2R9U A;  4R5D A;  3E2J A;  4R0A A;  5GS2 B;  4Z8G A;  1H6U A;  1KOO A;  2Z65 A;  1OTO A;  2JE0 A;  1IO0 A;  3OJA B;  4R58 A;  5B4P A;  3RFS A;  2OMU A;  3PMH G;  4FMZ A;  3ULA A;  3UL9 A;  4CNM A;  4Q3I A;  1FS2 A;  4U06 A;  5GMG A;  4LXR A;  2O6S A;  5GMH A;  3RGZ A;  4EZG A;  2Z62 A;  1XCD A;  1Z7X W;  2BNH A;  2Y5Q A;  3E6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...