3G39A

Structure of a lamprey variable lymphocyte receptor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
165
Chain Sequence
ACPQCSCSGTTVDCSGKSLASVPTGIPTTTQVLYLYDNQITKLEPGVFDRLTQLTRLDLDNNQLTVLPAGVFDKLTQLTQLSLNDNQLKSIPRGAFDNLKSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Variable lymphocyte receptor VLRB.2D
publication title Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen.
pubmed doi rcsb
source organism Petromyzon marinus
total genus 43
structure length 165
sequence length 167
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF11921 DUF3439 Domain of unknown function (DUF3439)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3g39A00
2OMYA 4IM6A 4ECOA 3CVRA 3O6NA 5AWDA 3RGXA 2V9SA 3ZYOA 1K5GC 2R9UA 4LI2A 4FHOA 4CP6A 3UN9A 4KNGA 2OMZA 3M18A 3RW7A 4LXRA 3UL7A 3WPEA 2ASTB 3W3KA 2FT3A 1H6UA 4P8SA 2O6SA 2P1OB 4FD0A 3G3BA 3WPCA 3OJAB 4ARRA 2Z82A 4Z61C 3W3LA 4R6FA 2IFGA 3RFSA 4BV4R 2P1QB 1M10B 2WQXA 2JE1A 4K17A 4R09A 3WN4A 1LTXA 3WPBA 5IJCA 1DS9A 1M0ZA 4KXFB 2P1MB 1P9AG 2Z7XB 4Y61B 4Z94G 3KJ4A 1FQVA 4R5DA 3TSRE 4WYKA 2OMVA 1Z7XW 3OGLB 3VQ2A 3C6PB 4GT6A 3REZA 4WP6A 3RIZA 4XSQA 4ECNA 4NKGA 3UL9A 4J4LA 3WPIA 4FCGA 4Q3IA 3ULUA 3RFJA 2Z65A 4U7LA 1OGQA 4AW4A 4LSXA 4Z64C 4R0AA 5AZ5A 5CMPA 4FMZA 3ZYJA 3RW6A 3WPFA 2BEXA 2OMUA 4U06A 3RJ0A 4Q3GA 2Y5QA 4MN8B 1FT8A 1O6SA 1M9LA 1D0BA 1XECA 4R6JA 1P8TA 1QYYA 3G39A 3VQ1A 2CA6A 2WQVA 3GOZA 3PMHG 3BZ5A 5CMNA 5B4PA 3WPDA 1DCEA 2V70A 3G3AA 5IYXC 2XWTC 4C2AB 1W8AA 3W3MA 5A5CA 4B8CD 3M19A 1OZNA 4FS7A 2O6RA 4L3FA 2V9TB 4V2EA 1O6VA 3E4GA 3RGZA 4LI1A 3CIYA 1O6TA 4YEBB 2ELLA 1FS2A 1U0ND 4R58A 4LXSA 2UZYA 5AWCA 4QXEA 4HQ1A 1H6TA 5B0TA 4R6GA 2RR6A 3WPHA 3C6NB 4I6JB 1G9UA 1WWLA 3C6OB 5GS0A 1A4YA 1XWDC 1M9SA 1PGVA 3W3JA 2Z7XA 4XOSA 4KT1A 3WPGA 4R08A 3JB9j 1JL5A 1P8VA 3RFEA 2A0ZA 4M7EC 4R6AA 4J0MA 3G04C 5IJDA 2Z66A 2ID5A 4QBZA 4FDWA 2XOTA 5FTTB 2JE0A 1OTNA 4PQ8A 3P72A 4MQWX 3ULAA 2Z63A 1ZIWA 3W3GA 4L3AA 4CILA 1SQ0B 1A9NA 4BSRA 5HZLB 3E3ZA 3E2JA 3E6JA 3ZYNA 2UZXA 4R5CA 4V2DA 5AWAA 4H09A 4CNMA 3A79B 4OQTA 1DFJI 3CIGA 1IO0A 4CNCA 4BSUA 2OMWA 1FO1A 4P91A 5GS2B 2WQUA 4LSCA 4V2CA 4UFRA 1XKUA 2OMTA 4RCWA 4ARNA 4QC0A 1OTOA 3O53A 1KOHA 3UL8A 2Z62A 4NKHA 4RWTC 4C2BB 2BNHA 4CC4A 2Q4GW 5D3IA 1KOOA 2JQDA 4Q62A 4CC4C 4LSAA 3G06A 3OJAA 3ZYIA 4Z79A 3OGMB 1XEUA 4RCAB 2P1NB 5B0NA 4Z8GA 1GWBA 1YRGA 5GMFA 2OMXA 5IJBA 1OOKG 4M7EA 3FXIA 4U08A 4XGOA 3ULVA 4PSJA 1K5DC 3OGKB 4AY9X 2WQWA 4TZHA 4GLPA 4R07A 1XCDA 3W3NA 2RA8A 5GQRK 4EZGA 5LFNA 5GMGA 4PEQB 4G8AA 4U09A 3SB4A 4LSXC 2O6QA 2P1PB 5GMHA 1OTMA 5AWBA 5HDHA 4BSSA 4PKIG 2Z81A 2ASSB 2WFHA 2Z64A 3DZEA 4PERA
chains in the Genus database with same CATH superfamily
2OMYA 4IM6A 4ECOA 3CVRA 3O6NA 5AWDA 3RGXA 2V9SA 3ZYOA 1K5GC 2R9UA 4LI2A 4FHOA 4CP6A 3UN9A 4KNGA 2OMZA 3M18A 3RW7A 4LXRA 3UL7A 3WPEA 2ASTB 3W3KA 2FT3A 1H6UA 4P8SA 2O6SA 2P1OB 4FD0A 3G3BA 3WPCA 3OJAB 4ARRA 2Z82A 4Z61C 3W3LA 4R6FA 2IFGA 3RFSA 4BV4R 2P1QB 1M10B 2WQXA 2JE1A 4K17A 4R09A 3WN4A 1LTXA 3WPBA 5IJCA 1DS9A 1M0ZA 4KXFB 2P1MB 1P9AG 2Z7XB 4Y61B 4Z94G 3KJ4A 1FQVA 4R5DA 3TSRE 4WYKA 2OMVA 1Z7XW 3OGLB 3VQ2A 3C6PB 4GT6A 3REZA 4WP6A 3RIZA 4XSQA 4ECNA 4NKGA 3UL9A 4J4LA 3WPIA 4FCGA 4Q3IA 3ULUA 3RFJA 2Z65A 4U7LA 1OGQA 4AW4A 4LSXA 4Z64C 4R0AA 5AZ5A 5CMPA 4FMZA 3ZYJA 3RW6A 3WPFA 2BEXA 2OMUA 4U06A 3RJ0A 4Q3GA 2Y5QA 4MN8B 1FT8A 1O6SA 1M9LA 1D0BA 1XECA 4R6JA 1P8TA 1QYYA 3G39A 3VQ1A 2CA6A 2WQVA 3GOZA 3PMHG 3BZ5A 5CMNA 5B4PA 3WPDA 1DCEA 2V70A 3G3AA 5IYXC 2XWTC 4C2AB 1W8AA 3W3MA 5A5CA 4B8CD 3M19A 1OZNA 4FS7A 2O6RA 4L3FA 2V9TB 4V2EA 1O6VA 3E4GA 3RGZA 4LI1A 3CIYA 1O6TA 4YEBB 2ELLA 1FS2A 1U0ND 4R58A 4LXSA 2UZYA 5AWCA 4QXEA 4HQ1A 1H6TA 5B0TA 4R6GA 2RR6A 3WPHA 3C6NB 4I6JB 1G9UA 1WWLA 3C6OB 5GS0A 1A4YA 1XWDC 1M9SA 1PGVA 3W3JA 2Z7XA 4XOSA 4KT1A 3WPGA 4R08A 3JB9j 1JL5A 4NZTM 1P8VA 3RFEA 2A0ZA 4M7EC 4R6AA 4J0MA 3G04C 5IJDA 2Z66A 2ID5A 4QBZA 4FDWA 2XOTA 5FTTB 2JE0A 1OTNA 4PQ8A 3P72A 4MQWX 3ULAA 2Z63A 1ZIWA 3W3GA 4L3AA 4CILA 1SQ0B 1A9NA 4BSRA 5HZLB 3E3ZA 3E2JA 3E6JA 3ZYNA 2UZXA 4R5CA 4V2DA 5AWAA 4H09A 4CNMA 3A79B 4OQTA 1DFJI 3CIGA 1IO0A 4CNCA 4BSUA 2OMWA 1FO1A 4P91A 5GS2B 2WQUA 4LSCA 4V2CA 4UFRA 1XKUA 2OMTA 4RCWA 4ARNA 4QC0A 1OTOA 3O53A 1KOHA 3UL8A 4NZRM 2Z62A 4NKHA 4RWTC 4C2BB 2BNHA 4CC4A 2Q4GW 5D3IA 1KOOA 2JQDA 4Q62A 4CC4C 4LSAA 3G06A 3OJAA 3ZYIA 4Z79A 3OGMB 1XEUA 4RCAB 2P1NB 5B0NA 4Z8GA 1GWBA 1YRGA 5GMFA 2OMXA 5IJBA 1OOKG 4M7EA 3FXIA 4U08A 4XGOA 3ULVA 4PSJA 1K5DC 3OGKB 4AY9X 2WQWA 4TZHA 4GLPA 4R07A 1XCDA 3W3NA 2RA8A 5GQRK 4EZGA 5LFNA 5GMGA 4PEQB 4G8AA 4U09A 3SB4A 4LSXC 2O6QA 2P1PB 5GMHA 1OTMA 5AWBA 5HDHA 4BSSA 4PKIG 2Z81A 2ASSB 2WFHA 2Z64A 3DZEA 4PERA
chains in the Genus database with same CATH topology
2OMYA 4IM6A 4ECOA 3CVRA 3O6NA 5AWDA 3RGXA 2V9SA 3ZYOA 1K5GC 2R9UA 4LI2A 4FHOA 4CP6A 3UN9A 4KNGA 2OMZA 3M18A 3RW7A 4LXRA 3UL7A 3WPEA 2ASTB 3W3KA 2FT3A 1H6UA 4P8SA 2O6SA 2P1OB 4FD0A 3G3BA 3WPCA 3OJAB 4ARRA 2Z82A 4Z61C 3W3LA 4R6FA 2IFGA 3RFSA 4BV4R 2P1QB 1M10B 2WQXA 2JE1A 4K17A 4R09A 3WN4A 1LTXA 3WPBA 5IJCA 1DS9A 1M0ZA 4KXFB 2P1MB 1P9AG 2Z7XB 4Y61B 4Z94G 3KJ4A 1FQVA 4R5DA 3TSRE 4WYKA 2OMVA 1Z7XW 3OGLB 3VQ2A 3C6PB 4GT6A 3REZA 4WP6A 3RIZA 4XSQA 4ECNA 4NKGA 3UL9A 4J4LA 3WPIA 4FCGA 4Q3IA 3ULUA 3RFJA 2Z65A 4U7LA 1OGQA 4AW4A 4LSXA 4Z64C 4R0AA 5AZ5A 5CMPA 4FMZA 3ZYJA 3RW6A 3WPFA 2BEXA 2OMUA 4U06A 3RJ0A 4Q3GA 2Y5QA 4MN8B 1FT8A 1O6SA 1M9LA 1D0BA 1XECA 4R6JA 1P8TA 1QYYA 3G39A 3VQ1A 2CA6A 2WQVA 3GOZA 3PMHG 3BZ5A 5CMNA 5B4PA 3WPDA 1DCEA 2V70A 3G3AA 5IYXC 2XWTC 4C2AB 1W8AA 3W3MA 5A5CA 4B8CD 3M19A 1OZNA 4FS7A 2O6RA 4L3FA 2V9TB 4V2EA 1O6VA 3E4GA 3RGZA 4LI1A 3CIYA 1O6TA 4YEBB 2ELLA 1FS2A 1U0ND 4R58A 4LXSA 2UZYA 5AWCA 4QXEA 4HQ1A 1H6TA 5B0TA 4R6GA 2RR6A 3WPHA 3C6NB 4I6JB 1G9UA 1WWLA 3C6OB 5GS0A 1A4YA 1XWDC 1M9SA 1PGVA 3W3JA 2Z7XA 4XOSA 4KT1A 3WPGA 4R08A 3JB9j 1JL5A 1P8VA 3RFEA 2A0ZA 4M7EC 4R6AA 4J0MA 3G04C 5IJDA 2Z66A 2ID5A 4QBZA 4FDWA 2XOTA 5FTTB 2JE0A 1OTNA 4PQ8A 3P72A 4MQWX 3ULAA 2Z63A 1ZIWA 3W3GA 4L3AA 4CILA 1SQ0B 1A9NA 4BSRA 5HZLB 3E3ZA 3E2JA 3E6JA 3ZYNA 2UZXA 4R5CA 4V2DA 5AWAA 4H09A 4CNMA 3A79B 4OQTA 1DFJI 3CIGA 1IO0A 4CNCA 4BSUA 2OMWA 1FO1A 4P91A 5GS2B 2WQUA 4LSCA 4V2CA 4UFRA 1XKUA 2OMTA 4RCWA 4ARNA 4QC0A 1OTOA 3O53A 1KOHA 3UL8A 2Z62A 4NKHA 4RWTC 4C2BB 2BNHA 4CC4A 2Q4GW 5D3IA 1KOOA 2JQDA 4Q62A 4CC4C 4LSAA 3G06A 3OJAA 3ZYIA 4Z79A 3OGMB 1XEUA 4RCAB 2P1NB 5B0NA 4Z8GA 1GWBA 1YRGA 5GMFA 2OMXA 5IJBA 1OOKG 4M7EA 3FXIA 4U08A 4XGOA 3ULVA 4PSJA 1K5DC 3OGKB 4AY9X 2WQWA 4TZHA 4GLPA 4R07A 1XCDA 3W3NA 2RA8A 5GQRK 4EZGA 5LFNA 5GMGA 4PEQB 4G8AA 4U09A 3SB4A 4LSXC 2O6QA 2P1PB 5GMHA 1OTMA 5AWBA 5HDHA 4BSSA 4PKIG 2Z81A 2ASSB 2WFHA 2Z64A 3DZEA 4PERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMY A;  4IM6 A;  4ECO A;  3CVR A;  3O6N A;  5AWD A;  3RGX A;  2V9S A;  3ZYO A;  1K5G C;  2R9U A;  4LI2 A;  4FHO A;  4CP6 A;  3UN9 A;  4KNG A;  2OMZ A;  3M18 A;  3RW7 A;  4LXR A;  3UL7 A;  3WPE A;  2AST B;  3W3K A;  2FT3 A;  1H6U A;  4P8S A;  2O6S A;  2P1O B;  4FD0 A;  3G3B A;  3WPC A;  3OJA B;  4ARR A;  2Z82 A;  4Z61 C;  3W3L A;  4R6F A;  2IFG A;  3RFS A;  4BV4 R;  2P1Q B;  1M10 B;  2WQX A;  2JE1 A;  4K17 A;  4R09 A;  3WN4 A;  1LTX A;  3WPB A;  5IJC A;  1DS9 A;  1M0Z A;  4KXF B;  2P1M B;  1P9A G;  2Z7X B;  4Y61 B;  4Z94 G;  3KJ4 A;  1FQV A;  4R5D A;  3TSR E;  4WYK A;  2OMV A;  1Z7X W;  3OGL B;  3VQ2 A;  3C6P B;  4GT6 A;  3REZ A;  4WP6 A;  3RIZ A;  4XSQ A;  4ECN A;  4NKG A;  3UL9 A;  4J4L A;  3WPI A;  4FCG A;  4Q3I A;  3ULU A;  3RFJ A;  2Z65 A;  4U7L A;  1OGQ A;  4AW4 A;  4LSX A;  4Z64 C;  4R0A A;  5AZ5 A;  5CMP A;  4FMZ A;  3ZYJ A;  3RW6 A;  3WPF A;  2BEX A;  2OMU A;  4U06 A;  3RJ0 A;  4Q3G A;  2Y5Q A;  4MN8 B;  1FT8 A;  1O6S A;  1M9L A;  1D0B A;  1XEC A;  4R6J A;  1P8T A;  1QYY A;  3G39 A;  3VQ1 A;  2CA6 A;  2WQV A;  3GOZ A;  3PMH G;  3BZ5 A;  5CMN A;  5B4P A;  3WPD A;  1DCE A;  2V70 A;  3G3A A;  5IYX C;  2XWT C;  4C2A B;  1W8A A;  3W3M A;  5A5C A;  4B8C D;  3M19 A;  1OZN A;  4FS7 A;  2O6R A;  4L3F A;  2V9T B;  4V2E A;  1O6V A;  3E4G A;  3RGZ A;  4LI1 A;  3CIY A;  1O6T A;  4YEB B;  2ELL A;  1FS2 A;  1U0N D;  4R58 A;  4LXS A;  2UZY A;  5AWC A;  4QXE A;  4HQ1 A;  1H6T A;  5B0T A;  4R6G A;  2RR6 A;  3WPH A;  3C6N B;  4I6J B;  1G9U A;  1WWL A;  3C6O B;  5GS0 A;  1A4Y A;  1XWD C;  1M9S A;  1PGV A;  3W3J A;  2Z7X A;  4XOS A;  4KT1 A;  3WPG A;  4R08 A;  3JB9 j;  1JL5 A;  1P8V A;  3RFE A;  2A0Z A;  4M7E C;  4R6A A;  4J0M A;  3G04 C;  5IJD A;  2Z66 A;  2ID5 A;  4QBZ A;  4FDW A;  2XOT A;  5FTT B;  2JE0 A;  1OTN A;  4PQ8 A;  3P72 A;  4MQW X;  3ULA A;  2Z63 A;  1ZIW A;  3W3G A;  4L3A A;  4CIL A;  1SQ0 B;  1A9N A;  4BSR A;  5HZL B;  3E3Z A;  3E2J A;  3E6J A;  3ZYN A;  2UZX A;  4R5C A;  4V2D A;  5AWA A;  4H09 A;  4CNM A;  3A79 B;  4OQT A;  1DFJ I;  3CIG A;  1IO0 A;  4CNC A;  4BSU A;  2OMW A;  1FO1 A;  4P91 A;  5GS2 B;  2WQU A;  4LSC A;  4V2C A;  4UFR A;  1XKU A;  2OMT A;  4RCW A;  4ARN A;  4QC0 A;  1OTO A;  3O53 A;  1KOH A;  3UL8 A;  2Z62 A;  4NKH A;  4RWT C;  4C2B B;  2BNH A;  4CC4 A;  2Q4G W;  5D3I A;  1KOO A;  2JQD A;  4Q62 A;  4CC4 C;  4LSA A;  3G06 A;  3OJA A;  3ZYI A;  4Z79 A;  3OGM B;  1XEU A;  4RCA B;  2P1N B;  5B0N A;  4Z8G A;  1GWB A;  1YRG A;  5GMF A;  2OMX A;  5IJB A;  1OOK G;  4M7E A;  3FXI A;  4U08 A;  4XGO A;  3ULV A;  4PSJ A;  1K5D C;  3OGK B;  4AY9 X;  2WQW A;  4TZH A;  4GLP A;  4R07 A;  1XCD A;  3W3N A;  2RA8 A;  5GQR K;  4EZG A;  5LFN A;  5GMG A;  4PEQ B;  4G8A A;  4U09 A;  3SB4 A;  4LSX C;  2O6Q A;  2P1P B;  5GMH A;  1OTM A;  5AWB A;  5HDH A;  4BSS A;  4PKI G;  2Z81 A;  2ASS B;  2WFH A;  2Z64 A;  3DZE A;  4PER A; 
#chains in the Genus database with same CATH topology
 2OMY A;  4IM6 A;  4ECO A;  3CVR A;  3O6N A;  5AWD A;  3RGX A;  2V9S A;  3ZYO A;  1K5G C;  2R9U A;  4LI2 A;  4FHO A;  4CP6 A;  3UN9 A;  4KNG A;  2OMZ A;  3M18 A;  3RW7 A;  4LXR A;  3UL7 A;  3WPE A;  2AST B;  3W3K A;  2FT3 A;  1H6U A;  4P8S A;  2O6S A;  2P1O B;  4FD0 A;  3G3B A;  3WPC A;  3OJA B;  4ARR A;  2Z82 A;  4Z61 C;  3W3L A;  4R6F A;  2IFG A;  3RFS A;  4BV4 R;  2P1Q B;  1M10 B;  2WQX A;  2JE1 A;  4K17 A;  4R09 A;  3WN4 A;  1LTX A;  3WPB A;  5IJC A;  1DS9 A;  1M0Z A;  4KXF B;  2P1M B;  1P9A G;  2Z7X B;  4Y61 B;  4Z94 G;  3KJ4 A;  1FQV A;  4R5D A;  3TSR E;  4WYK A;  2OMV A;  1Z7X W;  3OGL B;  3VQ2 A;  3C6P B;  4GT6 A;  3REZ A;  4WP6 A;  3RIZ A;  4XSQ A;  4ECN A;  4NKG A;  3UL9 A;  4J4L A;  3WPI A;  4FCG A;  4Q3I A;  3ULU A;  3RFJ A;  2Z65 A;  4U7L A;  1OGQ A;  4AW4 A;  4LSX A;  4Z64 C;  4R0A A;  5AZ5 A;  5CMP A;  4FMZ A;  3ZYJ A;  3RW6 A;  3WPF A;  2BEX A;  2OMU A;  4U06 A;  3RJ0 A;  4Q3G A;  2Y5Q A;  4MN8 B;  1FT8 A;  1O6S A;  1M9L A;  1D0B A;  1XEC A;  4R6J A;  1P8T A;  1QYY A;  3G39 A;  3VQ1 A;  2CA6 A;  2WQV A;  3GOZ A;  3PMH G;  3BZ5 A;  5CMN A;  5B4P A;  3WPD A;  1DCE A;  2V70 A;  3G3A A;  5IYX C;  2XWT C;  4C2A B;  1W8A A;  3W3M A;  5A5C A;  4B8C D;  3M19 A;  1OZN A;  4FS7 A;  2O6R A;  4L3F A;  2V9T B;  4V2E A;  1O6V A;  3E4G A;  3RGZ A;  4LI1 A;  3CIY A;  1O6T A;  4YEB B;  2ELL A;  1FS2 A;  1U0N D;  4R58 A;  4LXS A;  2UZY A;  5AWC A;  4QXE A;  4HQ1 A;  1H6T A;  5B0T A;  4R6G A;  2RR6 A;  3WPH A;  3C6N B;  4I6J B;  1G9U A;  1WWL A;  3C6O B;  5GS0 A;  1A4Y A;  1XWD C;  1M9S A;  1PGV A;  3W3J A;  2Z7X A;  4XOS A;  4KT1 A;  3WPG A;  4R08 A;  3JB9 j;  1JL5 A;  4NZT M;  1P8V A;  3RFE A;  2A0Z A;  4M7E C;  4R6A A;  4J0M A;  3G04 C;  5IJD A;  2Z66 A;  2ID5 A;  4QBZ A;  4FDW A;  2XOT A;  5FTT B;  2JE0 A;  1OTN A;  4PQ8 A;  3P72 A;  4MQW X;  3ULA A;  2Z63 A;  1ZIW A;  3W3G A;  4L3A A;  4CIL A;  1SQ0 B;  1A9N A;  4BSR A;  5HZL B;  3E3Z A;  3E2J A;  3E6J A;  3ZYN A;  2UZX A;  4R5C A;  4V2D A;  5AWA A;  4H09 A;  4CNM A;  3A79 B;  4OQT A;  1DFJ I;  3CIG A;  1IO0 A;  4CNC A;  4BSU A;  2OMW A;  1FO1 A;  4P91 A;  5GS2 B;  2WQU A;  4LSC A;  4V2C A;  4UFR A;  1XKU A;  2OMT A;  4RCW A;  4ARN A;  4QC0 A;  1OTO A;  3O53 A;  1KOH A;  3UL8 A;  4NZR M;  2Z62 A;  4NKH A;  4RWT C;  4C2B B;  2BNH A;  4CC4 A;  2Q4G W;  5D3I A;  1KOO A;  2JQD A;  4Q62 A;  4CC4 C;  4LSA A;  3G06 A;  3OJA A;  3ZYI A;  4Z79 A;  3OGM B;  1XEU A;  4RCA B;  2P1N B;  5B0N A;  4Z8G A;  1GWB A;  1YRG A;  5GMF A;  2OMX A;  5IJB A;  1OOK G;  4M7E A;  3FXI A;  4U08 A;  4XGO A;  3ULV A;  4PSJ A;  1K5D C;  3OGK B;  4AY9 X;  2WQW A;  4TZH A;  4GLP A;  4R07 A;  1XCD A;  3W3N A;  2RA8 A;  5GQR K;  4EZG A;  5LFN A;  5GMG A;  4PEQ B;  4G8A A;  4U09 A;  3SB4 A;  4LSX C;  2O6Q A;  2P1P B;  5GMH A;  1OTM A;  5AWB A;  5HDH A;  4BSS A;  4PKI G;  2Z81 A;  2ASS B;  2WFH A;  2Z64 A;  3DZE A;  4PER A; 
#chains in the Genus database with same CATH homology
 2OMY A;  4IM6 A;  4ECO A;  3CVR A;  3O6N A;  5AWD A;  3RGX A;  2V9S A;  3ZYO A;  1K5G C;  2R9U A;  4LI2 A;  4FHO A;  4CP6 A;  3UN9 A;  4KNG A;  2OMZ A;  3M18 A;  3RW7 A;  4LXR A;  3UL7 A;  3WPE A;  2AST B;  3W3K A;  2FT3 A;  1H6U A;  4P8S A;  2O6S A;  2P1O B;  4FD0 A;  3G3B A;  3WPC A;  3OJA B;  4ARR A;  2Z82 A;  4Z61 C;  3W3L A;  4R6F A;  2IFG A;  3RFS A;  4BV4 R;  2P1Q B;  1M10 B;  2WQX A;  2JE1 A;  4K17 A;  4R09 A;  3WN4 A;  1LTX A;  3WPB A;  5IJC A;  1DS9 A;  1M0Z A;  4KXF B;  2P1M B;  1P9A G;  2Z7X B;  4Y61 B;  4Z94 G;  3KJ4 A;  1FQV A;  4R5D A;  3TSR E;  4WYK A;  2OMV A;  1Z7X W;  3OGL B;  3VQ2 A;  3C6P B;  4GT6 A;  3REZ A;  4WP6 A;  3RIZ A;  4XSQ A;  4ECN A;  4NKG A;  3UL9 A;  4J4L A;  3WPI A;  4FCG A;  4Q3I A;  3ULU A;  3RFJ A;  2Z65 A;  4U7L A;  1OGQ A;  4AW4 A;  4LSX A;  4Z64 C;  4R0A A;  5AZ5 A;  5CMP A;  4FMZ A;  3ZYJ A;  3RW6 A;  3WPF A;  2BEX A;  2OMU A;  4U06 A;  3RJ0 A;  4Q3G A;  2Y5Q A;  4MN8 B;  1FT8 A;  1O6S A;  1M9L A;  1D0B A;  1XEC A;  4R6J A;  1P8T A;  1QYY A;  3G39 A;  3VQ1 A;  2CA6 A;  2WQV A;  3GOZ A;  3PMH G;  3BZ5 A;  5CMN A;  5B4P A;  3WPD A;  1DCE A;  2V70 A;  3G3A A;  5IYX C;  2XWT C;  4C2A B;  1W8A A;  3W3M A;  5A5C A;  4B8C D;  3M19 A;  1OZN A;  4FS7 A;  2O6R A;  4L3F A;  2V9T B;  4V2E A;  1O6V A;  3E4G A;  3RGZ A;  4LI1 A;  3CIY A;  1O6T A;  4YEB B;  2ELL A;  1FS2 A;  1U0N D;  4R58 A;  4LXS A;  2UZY A;  5AWC A;  4QXE A;  4HQ1 A;  1H6T A;  5B0T A;  4R6G A;  2RR6 A;  3WPH A;  3C6N B;  4I6J B;  1G9U A;  1WWL A;  3C6O B;  5GS0 A;  1A4Y A;  1XWD C;  1M9S A;  1PGV A;  3W3J A;  2Z7X A;  4XOS A;  4KT1 A;  3WPG A;  4R08 A;  3JB9 j;  1JL5 A;  1P8V A;  3RFE A;  2A0Z A;  4M7E C;  4R6A A;  4J0M A;  3G04 C;  5IJD A;  2Z66 A;  2ID5 A;  4QBZ A;  4FDW A;  2XOT A;  5FTT B;  2JE0 A;  1OTN A;  4PQ8 A;  3P72 A;  4MQW X;  3ULA A;  2Z63 A;  1ZIW A;  3W3G A;  4L3A A;  4CIL A;  1SQ0 B;  1A9N A;  4BSR A;  5HZL B;  3E3Z A;  3E2J A;  3E6J A;  3ZYN A;  2UZX A;  4R5C A;  4V2D A;  5AWA A;  4H09 A;  4CNM A;  3A79 B;  4OQT A;  1DFJ I;  3CIG A;  1IO0 A;  4CNC A;  4BSU A;  2OMW A;  1FO1 A;  4P91 A;  5GS2 B;  2WQU A;  4LSC A;  4V2C A;  4UFR A;  1XKU A;  2OMT A;  4RCW A;  4ARN A;  4QC0 A;  1OTO A;  3O53 A;  1KOH A;  3UL8 A;  2Z62 A;  4NKH A;  4RWT C;  4C2B B;  2BNH A;  4CC4 A;  2Q4G W;  5D3I A;  1KOO A;  2JQD A;  4Q62 A;  4CC4 C;  4LSA A;  3G06 A;  3OJA A;  3ZYI A;  4Z79 A;  3OGM B;  1XEU A;  4RCA B;  2P1N B;  5B0N A;  4Z8G A;  1GWB A;  1YRG A;  5GMF A;  2OMX A;  5IJB A;  1OOK G;  4M7E A;  3FXI A;  4U08 A;  4XGO A;  3ULV A;  4PSJ A;  1K5D C;  3OGK B;  4AY9 X;  2WQW A;  4TZH A;  4GLP A;  4R07 A;  1XCD A;  3W3N A;  2RA8 A;  5GQR K;  4EZG A;  5LFN A;  5GMG A;  4PEQ B;  4G8A A;  4U09 A;  3SB4 A;  4LSX C;  2O6Q A;  2P1P B;  5GMH A;  1OTM A;  5AWB A;  5HDH A;  4BSS A;  4PKI G;  2Z81 A;  2ASS B;  2WFH A;  2Z64 A;  3DZE A;  4PER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...