3RFJA

Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
268
Chain Sequence
TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLYLYHNQLQSLPKGVFDKLTNLTRLDLDNNQLQSLPEGVFDKLTQLKQLSLNDNQLKSVPDGVFDRLTSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Internalin B, repeat modules, Variable lymphocyte receptor
publication title Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 84
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfjA00
4R58A 3WPDA 2OMXA 3JB9j 3E3ZA 4R5CA 3OGLB 2BNHA 1K5GC 1O6SA 4FHOA 4U06A 4WP6A 4L3FA 2Z66A 4CC4A 4R6FA 3W3MA 5B0NA 1OTMA 4KNGA 1M0ZA 1XCDA 3ZYIA 5AWCA 4Q62A 2A0ZA 2Q4GW 5GMFA 4B8CD 5A5CA 3O6NA 1H6TA 4YEBB 2V70A 5IJCA 1JL5A 4RCAB 4KT1A 3W3LA 2Z7XA 1G9UA 5D3IA 4NKGA 3FXIA 2Y5QA 2IFGA 4ARNA 4AW4A 4I6JB 3ULAA 4M7EA 3WPBA 1FO1A 3RGXA 3OGMB 2Z81A 4ECNA 3E6JA 3ULVA 3PMHG 4Z64C 2OMVA 5GMHA 1ZIWA 3KJ4A 3OJAA 1Z7XW 2ASTB 5GS2B 3A79B 3OGKB 4RCWA 4FDWA 4P8SA 1OTNA 3WN4A 3WPHA 4UFRA 4ARRA 4WYKA 1OGQA 3BZ5A 1A4YA 1FQVA 3GOZA 2OMZA 1XECA 4CILA 1M10B 4MQWX 3UN9A 4U08A 2JE0A 2O6QA 5IJDA 2Z63A 4CNMA 5HDHA 4GT6A 4XOSA 4LXSA 3RFEA 2WQUA 1SQ0B 4Q3GA 4R5DA 1D0BA 3VQ1A 4LI2A 3G06A 5AWBA 2JQDA 5HZLB 5AWAA 1P8TA 2Z64A 2RR6A 4CP6A 1H6UA 5LFNA 4Z8GA 2XOTA 1P8VA 4TZHA 1PGVA 3WPCA 2O6RA 4J4LA 5FTTB 2WFHA 1W8AA 4FCGA 2V9TB 4Y61B 3RJ0A 5GQRK 3W3NA 4U7LA 4J0MA 3DZEA 1XKUA 2ID5A 3TSRE 1KOHA 1OZNA 4IM6A 4OQTA 4AY9X 3ZYNA 5GS0A 4LSXA 2CA6A 4Z94G 2R9UA 4LXRA 3SB4A 3RGZA 4ECOA 4PERA 4V2DA 3O53A 4XGOA 1P9AG 3CVRA 4FD0A 4LSCA 1OOKG 4K17A 3W3KA 3REZA 3ZYOA 4FMZA 1FT8A 1M9LA 4XSQA 1WWLA 3RW7A 3M19A 4P91A 3G39A 4LSXC 4R0AA 2Z65A 3WPFA 4NKHA 1XWDC 2RA8A 2P1MB 4FS7A 3RFSA 2XWTC 1YRGA 4R09A 2P1QB 4Z61C 5CMPA 4RWTC 3C6PB 3W3GA 4KXFB 5CMNA 4R08A 4EZGA 2V9SA 4C2BB 3ULUA 2OMUA 3RIZA 5B4PA 1A9NA 4CNCA 2OMYA 1FS2A 2OMTA 3UL8A 4GLPA 5IJBA 2Z7XB 3RW6A 1GWBA 1K5DC 3UL9A 3W3JA 2P1PB 3UL7A 3CIYA 2P1NB 2BEXA 4U09A 5GMGA 5IYXC 1U0ND 5AZ5A 4Q3IA 3G3BA 4HQ1A 4PSJA 4BSSA 1OTOA 3OJAB 3VQ2A 3G04C 3G3AA 3RFJA 1IO0A 1DCEA 2Z82A 4V2CA 1DFJI 2Z62A 3ZYJA 2WQWA 4R6GA 3E4GA 2ASSB 2O6SA 3WPIA 4CC4C 2WQVA 4MN8B 4G8AA 2UZXA 4BSRA 4H09A 1LTXA 1QYYA 5AWDA 1O6TA 4Z79A 1O6VA 4C2AB 2UZYA 4QBZA 2FT3A 1XEUA 4LSAA 2P1OB 4R07A 3WPEA 1M9SA 4QC0A 4BV4R 1KOOA 4L3AA 4PKIG 3WPGA 2WQXA 3P72A 4R6AA 1DS9A 2JE1A 2ELLA 3E2JA 4R6JA 4QXEA 2OMWA 4PEQB 4BSUA 3M18A 4M7EC 3C6OB 5B0TA 4PQ8A 3CIGA 4LI1A 3C6NB 4V2EA
chains in the Genus database with same CATH superfamily
4R58A 4NZTM 3WPDA 2OMXA 3JB9j 3E3ZA 4R5CA 3OGLB 2BNHA 1K5GC 1O6SA 4FHOA 4U06A 4WP6A 4L3FA 2Z66A 4CC4A 4R6FA 3W3MA 5B0NA 1OTMA 4KNGA 1M0ZA 1XCDA 3ZYIA 5AWCA 4Q62A 2A0ZA 2Q4GW 5GMFA 4B8CD 5A5CA 3O6NA 1H6TA 4YEBB 2V70A 5IJCA 1JL5A 4RCAB 4KT1A 3W3LA 2Z7XA 1G9UA 5D3IA 4NKGA 3FXIA 2Y5QA 2IFGA 4ARNA 4AW4A 4I6JB 3ULAA 4M7EA 3WPBA 1FO1A 3RGXA 3OGMB 2Z81A 4ECNA 3E6JA 3ULVA 3PMHG 4Z64C 2OMVA 5GMHA 1ZIWA 3KJ4A 3OJAA 1Z7XW 2ASTB 5GS2B 3A79B 3OGKB 4RCWA 4FDWA 4P8SA 1OTNA 3WN4A 3WPHA 4UFRA 4ARRA 4WYKA 1OGQA 3BZ5A 1A4YA 1FQVA 3GOZA 2OMZA 1XECA 4CILA 1M10B 4MQWX 3UN9A 4U08A 2JE0A 2O6QA 5IJDA 2Z63A 4CNMA 5HDHA 4GT6A 4XOSA 4LXSA 3RFEA 2WQUA 1SQ0B 4Q3GA 4R5DA 1D0BA 3VQ1A 4LI2A 3G06A 5AWBA 2JQDA 5HZLB 5AWAA 1P8TA 2Z64A 2RR6A 4CP6A 1H6UA 5LFNA 4Z8GA 2XOTA 1P8VA 4TZHA 1PGVA 3WPCA 2O6RA 4J4LA 5FTTB 2WFHA 1W8AA 4FCGA 2V9TB 4Y61B 3RJ0A 5GQRK 3W3NA 4U7LA 4J0MA 3DZEA 1XKUA 2ID5A 3TSRE 1KOHA 1OZNA 4IM6A 4OQTA 4AY9X 3ZYNA 5GS0A 4LSXA 4NZRM 2CA6A 4Z94G 2R9UA 4LXRA 3SB4A 3RGZA 4ECOA 4PERA 4V2DA 3O53A 4XGOA 1P9AG 3CVRA 4FD0A 4LSCA 1OOKG 4K17A 3W3KA 3REZA 3ZYOA 4FMZA 1FT8A 1M9LA 4XSQA 1WWLA 3RW7A 3M19A 4P91A 3G39A 4LSXC 4R0AA 2Z65A 3WPFA 4NKHA 1XWDC 2RA8A 2P1MB 4FS7A 3RFSA 2XWTC 1YRGA 4R09A 2P1QB 4Z61C 5CMPA 4RWTC 3C6PB 3W3GA 4KXFB 5CMNA 4R08A 4EZGA 2V9SA 4C2BB 3ULUA 2OMUA 3RIZA 5B4PA 1A9NA 4CNCA 2OMYA 1FS2A 2OMTA 3UL8A 4GLPA 5IJBA 2Z7XB 3RW6A 1GWBA 1K5DC 3UL9A 3W3JA 2P1PB 3UL7A 3CIYA 2P1NB 2BEXA 4U09A 5GMGA 5IYXC 1U0ND 5AZ5A 4Q3IA 3G3BA 4HQ1A 4PSJA 4BSSA 1OTOA 3OJAB 3VQ2A 3G04C 3G3AA 3RFJA 1IO0A 1DCEA 2Z82A 4V2CA 1DFJI 2Z62A 3ZYJA 2WQWA 4R6GA 3E4GA 2ASSB 2O6SA 3WPIA 4CC4C 2WQVA 4MN8B 4G8AA 2UZXA 4BSRA 4H09A 1LTXA 1QYYA 5AWDA 1O6TA 4Z79A 1O6VA 4C2AB 2UZYA 4QBZA 2FT3A 1XEUA 4LSAA 2P1OB 4R07A 3WPEA 1M9SA 4QC0A 4BV4R 1KOOA 4L3AA 4PKIG 3WPGA 2WQXA 3P72A 4R6AA 1DS9A 2JE1A 2ELLA 3E2JA 4R6JA 4QXEA 2OMWA 4PEQB 4BSUA 3M18A 4M7EC 3C6OB 5B0TA 4PQ8A 3CIGA 4LI1A 3C6NB 4V2EA
chains in the Genus database with same CATH topology
4R58A 3WPDA 2OMXA 3JB9j 3E3ZA 4R5CA 3OGLB 2BNHA 1K5GC 1O6SA 4FHOA 4U06A 4WP6A 4L3FA 2Z66A 4CC4A 4R6FA 3W3MA 5B0NA 1OTMA 4KNGA 1M0ZA 1XCDA 3ZYIA 5AWCA 4Q62A 2A0ZA 2Q4GW 5GMFA 4B8CD 5A5CA 3O6NA 1H6TA 4YEBB 2V70A 5IJCA 1JL5A 4RCAB 4KT1A 3W3LA 2Z7XA 1G9UA 5D3IA 4NKGA 3FXIA 2Y5QA 2IFGA 4ARNA 4AW4A 4I6JB 3ULAA 4M7EA 3WPBA 1FO1A 3RGXA 3OGMB 2Z81A 4ECNA 3E6JA 3ULVA 3PMHG 4Z64C 2OMVA 5GMHA 1ZIWA 3KJ4A 3OJAA 1Z7XW 2ASTB 5GS2B 3A79B 3OGKB 4RCWA 4FDWA 4P8SA 1OTNA 3WN4A 3WPHA 4UFRA 4ARRA 4WYKA 1OGQA 3BZ5A 1A4YA 1FQVA 3GOZA 2OMZA 1XECA 4CILA 1M10B 4MQWX 3UN9A 4U08A 2JE0A 2O6QA 5IJDA 2Z63A 4CNMA 5HDHA 4GT6A 4XOSA 4LXSA 3RFEA 2WQUA 1SQ0B 4Q3GA 4R5DA 1D0BA 3VQ1A 4LI2A 3G06A 5AWBA 2JQDA 5HZLB 5AWAA 1P8TA 2Z64A 2RR6A 4CP6A 1H6UA 5LFNA 4Z8GA 2XOTA 1P8VA 4TZHA 1PGVA 3WPCA 2O6RA 4J4LA 5FTTB 2WFHA 1W8AA 4FCGA 2V9TB 4Y61B 3RJ0A 5GQRK 3W3NA 4U7LA 4J0MA 3DZEA 1XKUA 2ID5A 3TSRE 1KOHA 1OZNA 4IM6A 4OQTA 4AY9X 3ZYNA 5GS0A 4LSXA 2CA6A 4Z94G 2R9UA 4LXRA 3SB4A 3RGZA 4ECOA 4PERA 4V2DA 3O53A 4XGOA 1P9AG 3CVRA 4FD0A 4LSCA 1OOKG 4K17A 3W3KA 3REZA 3ZYOA 4FMZA 1FT8A 1M9LA 4XSQA 1WWLA 3RW7A 3M19A 4P91A 3G39A 4LSXC 4R0AA 2Z65A 3WPFA 4NKHA 1XWDC 2RA8A 2P1MB 4FS7A 3RFSA 2XWTC 1YRGA 4R09A 2P1QB 4Z61C 5CMPA 4RWTC 3C6PB 3W3GA 4KXFB 5CMNA 4R08A 4EZGA 2V9SA 4C2BB 3ULUA 2OMUA 3RIZA 5B4PA 1A9NA 4CNCA 2OMYA 1FS2A 2OMTA 3UL8A 4GLPA 5IJBA 2Z7XB 3RW6A 1GWBA 1K5DC 3UL9A 3W3JA 2P1PB 3UL7A 3CIYA 2P1NB 2BEXA 4U09A 5GMGA 5IYXC 1U0ND 5AZ5A 4Q3IA 3G3BA 4HQ1A 4PSJA 4BSSA 1OTOA 3OJAB 3VQ2A 3G04C 3G3AA 3RFJA 1IO0A 1DCEA 2Z82A 4V2CA 1DFJI 2Z62A 3ZYJA 2WQWA 4R6GA 3E4GA 2ASSB 2O6SA 3WPIA 4CC4C 2WQVA 4MN8B 4G8AA 2UZXA 4BSRA 4H09A 1LTXA 1QYYA 5AWDA 1O6TA 4Z79A 1O6VA 4C2AB 2UZYA 4QBZA 2FT3A 1XEUA 4LSAA 2P1OB 4R07A 3WPEA 1M9SA 4QC0A 4BV4R 1KOOA 4L3AA 4PKIG 3WPGA 2WQXA 3P72A 4R6AA 1DS9A 2JE1A 2ELLA 3E2JA 4R6JA 4QXEA 2OMWA 4PEQB 4BSUA 3M18A 4M7EC 3C6OB 5B0TA 4PQ8A 3CIGA 4LI1A 3C6NB 4V2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R58 A;  3WPD A;  2OMX A;  3JB9 j;  3E3Z A;  4R5C A;  3OGL B;  2BNH A;  1K5G C;  1O6S A;  4FHO A;  4U06 A;  4WP6 A;  4L3F A;  2Z66 A;  4CC4 A;  4R6F A;  3W3M A;  5B0N A;  1OTM A;  4KNG A;  1M0Z A;  1XCD A;  3ZYI A;  5AWC A;  4Q62 A;  2A0Z A;  2Q4G W;  5GMF A;  4B8C D;  5A5C A;  3O6N A;  1H6T A;  4YEB B;  2V70 A;  5IJC A;  1JL5 A;  4RCA B;  4KT1 A;  3W3L A;  2Z7X A;  1G9U A;  5D3I A;  4NKG A;  3FXI A;  2Y5Q A;  2IFG A;  4ARN A;  4AW4 A;  4I6J B;  3ULA A;  4M7E A;  3WPB A;  1FO1 A;  3RGX A;  3OGM B;  2Z81 A;  4ECN A;  3E6J A;  3ULV A;  3PMH G;  4Z64 C;  2OMV A;  5GMH A;  1ZIW A;  3KJ4 A;  3OJA A;  1Z7X W;  2AST B;  5GS2 B;  3A79 B;  3OGK B;  4RCW A;  4FDW A;  4P8S A;  1OTN A;  3WN4 A;  3WPH A;  4UFR A;  4ARR A;  4WYK A;  1OGQ A;  3BZ5 A;  1A4Y A;  1FQV A;  3GOZ A;  2OMZ A;  1XEC A;  4CIL A;  1M10 B;  4MQW X;  3UN9 A;  4U08 A;  2JE0 A;  2O6Q A;  5IJD A;  2Z63 A;  4CNM A;  5HDH A;  4GT6 A;  4XOS A;  4LXS A;  3RFE A;  2WQU A;  1SQ0 B;  4Q3G A;  4R5D A;  1D0B A;  3VQ1 A;  4LI2 A;  3G06 A;  5AWB A;  2JQD A;  5HZL B;  5AWA A;  1P8T A;  2Z64 A;  2RR6 A;  4CP6 A;  1H6U A;  5LFN A;  4Z8G A;  2XOT A;  1P8V A;  4TZH A;  1PGV A;  3WPC A;  2O6R A;  4J4L A;  5FTT B;  2WFH A;  1W8A A;  4FCG A;  2V9T B;  4Y61 B;  3RJ0 A;  5GQR K;  3W3N A;  4U7L A;  4J0M A;  3DZE A;  1XKU A;  2ID5 A;  3TSR E;  1KOH A;  1OZN A;  4IM6 A;  4OQT A;  4AY9 X;  3ZYN A;  5GS0 A;  4LSX A;  2CA6 A;  4Z94 G;  2R9U A;  4LXR A;  3SB4 A;  3RGZ A;  4ECO A;  4PER A;  4V2D A;  3O53 A;  4XGO A;  1P9A G;  3CVR A;  4FD0 A;  4LSC A;  1OOK G;  4K17 A;  3W3K A;  3REZ A;  3ZYO A;  4FMZ A;  1FT8 A;  1M9L A;  4XSQ A;  1WWL A;  3RW7 A;  3M19 A;  4P91 A;  3G39 A;  4LSX C;  4R0A A;  2Z65 A;  3WPF A;  4NKH A;  1XWD C;  2RA8 A;  2P1M B;  4FS7 A;  3RFS A;  2XWT C;  1YRG A;  4R09 A;  2P1Q B;  4Z61 C;  5CMP A;  4RWT C;  3C6P B;  3W3G A;  4KXF B;  5CMN A;  4R08 A;  4EZG A;  2V9S A;  4C2B B;  3ULU A;  2OMU A;  3RIZ A;  5B4P A;  1A9N A;  4CNC A;  2OMY A;  1FS2 A;  2OMT A;  3UL8 A;  4GLP A;  5IJB A;  2Z7X B;  3RW6 A;  1GWB A;  1K5D C;  3UL9 A;  3W3J A;  2P1P B;  3UL7 A;  3CIY A;  2P1N B;  2BEX A;  4U09 A;  5GMG A;  5IYX C;  1U0N D;  5AZ5 A;  4Q3I A;  3G3B A;  4HQ1 A;  4PSJ A;  4BSS A;  1OTO A;  3OJA B;  3VQ2 A;  3G04 C;  3G3A A;  3RFJ A;  1IO0 A;  1DCE A;  2Z82 A;  4V2C A;  1DFJ I;  2Z62 A;  3ZYJ A;  2WQW A;  4R6G A;  3E4G A;  2ASS B;  2O6S A;  3WPI A;  4CC4 C;  2WQV A;  4MN8 B;  4G8A A;  2UZX A;  4BSR A;  4H09 A;  1LTX A;  1QYY A;  5AWD A;  1O6T A;  4Z79 A;  1O6V A;  4C2A B;  2UZY A;  4QBZ A;  2FT3 A;  1XEU A;  4LSA A;  2P1O B;  4R07 A;  3WPE A;  1M9S A;  4QC0 A;  4BV4 R;  1KOO A;  4L3A A;  4PKI G;  3WPG A;  2WQX A;  3P72 A;  4R6A A;  1DS9 A;  2JE1 A;  2ELL A;  3E2J A;  4R6J A;  4QXE A;  2OMW A;  4PEQ B;  4BSU A;  3M18 A;  4M7E C;  3C6O B;  5B0T A;  4PQ8 A;  3CIG A;  4LI1 A;  3C6N B;  4V2E A; 
#chains in the Genus database with same CATH topology
 4R58 A;  4NZT M;  3WPD A;  2OMX A;  3JB9 j;  3E3Z A;  4R5C A;  3OGL B;  2BNH A;  1K5G C;  1O6S A;  4FHO A;  4U06 A;  4WP6 A;  4L3F A;  2Z66 A;  4CC4 A;  4R6F A;  3W3M A;  5B0N A;  1OTM A;  4KNG A;  1M0Z A;  1XCD A;  3ZYI A;  5AWC A;  4Q62 A;  2A0Z A;  2Q4G W;  5GMF A;  4B8C D;  5A5C A;  3O6N A;  1H6T A;  4YEB B;  2V70 A;  5IJC A;  1JL5 A;  4RCA B;  4KT1 A;  3W3L A;  2Z7X A;  1G9U A;  5D3I A;  4NKG A;  3FXI A;  2Y5Q A;  2IFG A;  4ARN A;  4AW4 A;  4I6J B;  3ULA A;  4M7E A;  3WPB A;  1FO1 A;  3RGX A;  3OGM B;  2Z81 A;  4ECN A;  3E6J A;  3ULV A;  3PMH G;  4Z64 C;  2OMV A;  5GMH A;  1ZIW A;  3KJ4 A;  3OJA A;  1Z7X W;  2AST B;  5GS2 B;  3A79 B;  3OGK B;  4RCW A;  4FDW A;  4P8S A;  1OTN A;  3WN4 A;  3WPH A;  4UFR A;  4ARR A;  4WYK A;  1OGQ A;  3BZ5 A;  1A4Y A;  1FQV A;  3GOZ A;  2OMZ A;  1XEC A;  4CIL A;  1M10 B;  4MQW X;  3UN9 A;  4U08 A;  2JE0 A;  2O6Q A;  5IJD A;  2Z63 A;  4CNM A;  5HDH A;  4GT6 A;  4XOS A;  4LXS A;  3RFE A;  2WQU A;  1SQ0 B;  4Q3G A;  4R5D A;  1D0B A;  3VQ1 A;  4LI2 A;  3G06 A;  5AWB A;  2JQD A;  5HZL B;  5AWA A;  1P8T A;  2Z64 A;  2RR6 A;  4CP6 A;  1H6U A;  5LFN A;  4Z8G A;  2XOT A;  1P8V A;  4TZH A;  1PGV A;  3WPC A;  2O6R A;  4J4L A;  5FTT B;  2WFH A;  1W8A A;  4FCG A;  2V9T B;  4Y61 B;  3RJ0 A;  5GQR K;  3W3N A;  4U7L A;  4J0M A;  3DZE A;  1XKU A;  2ID5 A;  3TSR E;  1KOH A;  1OZN A;  4IM6 A;  4OQT A;  4AY9 X;  3ZYN A;  5GS0 A;  4LSX A;  4NZR M;  2CA6 A;  4Z94 G;  2R9U A;  4LXR A;  3SB4 A;  3RGZ A;  4ECO A;  4PER A;  4V2D A;  3O53 A;  4XGO A;  1P9A G;  3CVR A;  4FD0 A;  4LSC A;  1OOK G;  4K17 A;  3W3K A;  3REZ A;  3ZYO A;  4FMZ A;  1FT8 A;  1M9L A;  4XSQ A;  1WWL A;  3RW7 A;  3M19 A;  4P91 A;  3G39 A;  4LSX C;  4R0A A;  2Z65 A;  3WPF A;  4NKH A;  1XWD C;  2RA8 A;  2P1M B;  4FS7 A;  3RFS A;  2XWT C;  1YRG A;  4R09 A;  2P1Q B;  4Z61 C;  5CMP A;  4RWT C;  3C6P B;  3W3G A;  4KXF B;  5CMN A;  4R08 A;  4EZG A;  2V9S A;  4C2B B;  3ULU A;  2OMU A;  3RIZ A;  5B4P A;  1A9N A;  4CNC A;  2OMY A;  1FS2 A;  2OMT A;  3UL8 A;  4GLP A;  5IJB A;  2Z7X B;  3RW6 A;  1GWB A;  1K5D C;  3UL9 A;  3W3J A;  2P1P B;  3UL7 A;  3CIY A;  2P1N B;  2BEX A;  4U09 A;  5GMG A;  5IYX C;  1U0N D;  5AZ5 A;  4Q3I A;  3G3B A;  4HQ1 A;  4PSJ A;  4BSS A;  1OTO A;  3OJA B;  3VQ2 A;  3G04 C;  3G3A A;  3RFJ A;  1IO0 A;  1DCE A;  2Z82 A;  4V2C A;  1DFJ I;  2Z62 A;  3ZYJ A;  2WQW A;  4R6G A;  3E4G A;  2ASS B;  2O6S A;  3WPI A;  4CC4 C;  2WQV A;  4MN8 B;  4G8A A;  2UZX A;  4BSR A;  4H09 A;  1LTX A;  1QYY A;  5AWD A;  1O6T A;  4Z79 A;  1O6V A;  4C2A B;  2UZY A;  4QBZ A;  2FT3 A;  1XEU A;  4LSA A;  2P1O B;  4R07 A;  3WPE A;  1M9S A;  4QC0 A;  4BV4 R;  1KOO A;  4L3A A;  4PKI G;  3WPG A;  2WQX A;  3P72 A;  4R6A A;  1DS9 A;  2JE1 A;  2ELL A;  3E2J A;  4R6J A;  4QXE A;  2OMW A;  4PEQ B;  4BSU A;  3M18 A;  4M7E C;  3C6O B;  5B0T A;  4PQ8 A;  3CIG A;  4LI1 A;  3C6N B;  4V2E A; 
#chains in the Genus database with same CATH homology
 4R58 A;  3WPD A;  2OMX A;  3JB9 j;  3E3Z A;  4R5C A;  3OGL B;  2BNH A;  1K5G C;  1O6S A;  4FHO A;  4U06 A;  4WP6 A;  4L3F A;  2Z66 A;  4CC4 A;  4R6F A;  3W3M A;  5B0N A;  1OTM A;  4KNG A;  1M0Z A;  1XCD A;  3ZYI A;  5AWC A;  4Q62 A;  2A0Z A;  2Q4G W;  5GMF A;  4B8C D;  5A5C A;  3O6N A;  1H6T A;  4YEB B;  2V70 A;  5IJC A;  1JL5 A;  4RCA B;  4KT1 A;  3W3L A;  2Z7X A;  1G9U A;  5D3I A;  4NKG A;  3FXI A;  2Y5Q A;  2IFG A;  4ARN A;  4AW4 A;  4I6J B;  3ULA A;  4M7E A;  3WPB A;  1FO1 A;  3RGX A;  3OGM B;  2Z81 A;  4ECN A;  3E6J A;  3ULV A;  3PMH G;  4Z64 C;  2OMV A;  5GMH A;  1ZIW A;  3KJ4 A;  3OJA A;  1Z7X W;  2AST B;  5GS2 B;  3A79 B;  3OGK B;  4RCW A;  4FDW A;  4P8S A;  1OTN A;  3WN4 A;  3WPH A;  4UFR A;  4ARR A;  4WYK A;  1OGQ A;  3BZ5 A;  1A4Y A;  1FQV A;  3GOZ A;  2OMZ A;  1XEC A;  4CIL A;  1M10 B;  4MQW X;  3UN9 A;  4U08 A;  2JE0 A;  2O6Q A;  5IJD A;  2Z63 A;  4CNM A;  5HDH A;  4GT6 A;  4XOS A;  4LXS A;  3RFE A;  2WQU A;  1SQ0 B;  4Q3G A;  4R5D A;  1D0B A;  3VQ1 A;  4LI2 A;  3G06 A;  5AWB A;  2JQD A;  5HZL B;  5AWA A;  1P8T A;  2Z64 A;  2RR6 A;  4CP6 A;  1H6U A;  5LFN A;  4Z8G A;  2XOT A;  1P8V A;  4TZH A;  1PGV A;  3WPC A;  2O6R A;  4J4L A;  5FTT B;  2WFH A;  1W8A A;  4FCG A;  2V9T B;  4Y61 B;  3RJ0 A;  5GQR K;  3W3N A;  4U7L A;  4J0M A;  3DZE A;  1XKU A;  2ID5 A;  3TSR E;  1KOH A;  1OZN A;  4IM6 A;  4OQT A;  4AY9 X;  3ZYN A;  5GS0 A;  4LSX A;  2CA6 A;  4Z94 G;  2R9U A;  4LXR A;  3SB4 A;  3RGZ A;  4ECO A;  4PER A;  4V2D A;  3O53 A;  4XGO A;  1P9A G;  3CVR A;  4FD0 A;  4LSC A;  1OOK G;  4K17 A;  3W3K A;  3REZ A;  3ZYO A;  4FMZ A;  1FT8 A;  1M9L A;  4XSQ A;  1WWL A;  3RW7 A;  3M19 A;  4P91 A;  3G39 A;  4LSX C;  4R0A A;  2Z65 A;  3WPF A;  4NKH A;  1XWD C;  2RA8 A;  2P1M B;  4FS7 A;  3RFS A;  2XWT C;  1YRG A;  4R09 A;  2P1Q B;  4Z61 C;  5CMP A;  4RWT C;  3C6P B;  3W3G A;  4KXF B;  5CMN A;  4R08 A;  4EZG A;  2V9S A;  4C2B B;  3ULU A;  2OMU A;  3RIZ A;  5B4P A;  1A9N A;  4CNC A;  2OMY A;  1FS2 A;  2OMT A;  3UL8 A;  4GLP A;  5IJB A;  2Z7X B;  3RW6 A;  1GWB A;  1K5D C;  3UL9 A;  3W3J A;  2P1P B;  3UL7 A;  3CIY A;  2P1N B;  2BEX A;  4U09 A;  5GMG A;  5IYX C;  1U0N D;  5AZ5 A;  4Q3I A;  3G3B A;  4HQ1 A;  4PSJ A;  4BSS A;  1OTO A;  3OJA B;  3VQ2 A;  3G04 C;  3G3A A;  3RFJ A;  1IO0 A;  1DCE A;  2Z82 A;  4V2C A;  1DFJ I;  2Z62 A;  3ZYJ A;  2WQW A;  4R6G A;  3E4G A;  2ASS B;  2O6S A;  3WPI A;  4CC4 C;  2WQV A;  4MN8 B;  4G8A A;  2UZX A;  4BSR A;  4H09 A;  1LTX A;  1QYY A;  5AWD A;  1O6T A;  4Z79 A;  1O6V A;  4C2A B;  2UZY A;  4QBZ A;  2FT3 A;  1XEU A;  4LSA A;  2P1O B;  4R07 A;  3WPE A;  1M9S A;  4QC0 A;  4BV4 R;  1KOO A;  4L3A A;  4PKI G;  3WPG A;  2WQX A;  3P72 A;  4R6A A;  1DS9 A;  2JE1 A;  2ELL A;  3E2J A;  4R6J A;  4QXE A;  2OMW A;  4PEQ B;  4BSU A;  3M18 A;  4M7E C;  3C6O B;  5B0T A;  4PQ8 A;  3CIG A;  4LI1 A;  3C6N B;  4V2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...