3RFJA

Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
268
Chain Sequence
TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLYLYHNQLQSLPKGVFDKLTNLTRLDLDNNQLQSLPEGVFDKLTQLKQLSLNDNQLKSVPDGVFDRLTSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin B, repeat modules, Variable lymphocyte receptor
publication title Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
total genus 84
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfjA00
3OJAB 4MQWX 4U06A 4V2EA 2OMVA 4R07A 3G39A 4GT6A 2OMUA 1KOHA 4GLPA 3WPGA 5A5CA 4M7EC 4OQTA 4R6FA 3TSRE 3ZYIA 4B8CD 1ZIWA 3ZYJA 3JB9j 1K5DC 4WP6A 4EZGA 4P8SA 3C6NB 1XCDA 2O6SA 2Z7XA 4L3AA 5HDHA 5GMGA 2A0ZA 2OMYA 3OGKB 1GWBA 4CC4C 4LI2A 1FS2A 1P8TA 2JE0A 1W8AA 3RW7A 4R09A 3E6JA 3ULAA 1M10B 4PERA 5IJCA 2P1QB 2WQUA 3G3AA 2O6RA 4I6JB 2Z7XB 1O6SA 2ID5A 3E2JA 1M0ZA 5IJDA 1OGQA 2OMWA 4K17A 3RFSA 3GOZA 3ULUA 1D0BA 3REZA 3OGLB 4KT1A 5D3IA 2O6QA 3WN4A 4RCAB 3DZEA 4LSXA 3WPFA 1FO1A 2FT3A 3KJ4A 5CMPA 4R58A 1QYYA 2JE1A 3WPIA 4R6GA 5AWBA 3W3GA 4G8AA 2Z63A 4Y61B 2ASTB 4L3FA 4Q3GA 2CA6A 4QC0A 2Z62A 5AZ5A 4BV4R 4R6JA 3M18A 2WQWA 5GS0A 5GS2B 4MN8B 1XWDC 3E3ZA 2P1PB 4FHOA 3W3KA 2OMTA 2IFGA 3O53A 3WPDA 4U08A 4BSSA 1O6TA 4Z79A 3G04C 3WPBA 3C6PB 1H6TA 3CIYA 2P1MB 3FXIA 4PSJA 1XKUA 4XSQA 5CMNA 2Z82A 5AWAA 3BZ5A 2WFHA 3UL8A 5IYXC 3E4GA 2XOTA 3VQ1A 4YEBB 2Z81A 1A9NA 1M9LA 3CIGA 5AWCA 3RJ0A 3WPEA 3WPCA 2Z65A 3UN9A 1JL5A 5B4PA 4BSRA 4AY9X 4KXFB 4TZHA 4Z61C 5AWDA 1YRGA 3M19A 4HQ1A 4M7EA 4P91A 4U7LA 3UL9A 2RA8A 3RGZA 3G06A 4CNCA 1OTNA 1IO0A 3UL7A 3RFEA 4CC4A 3OGMB 4QBZA 4QXEA 1A4YA 4V2CA 1FT8A 5GMFA 1O6VA 2OMXA 5B0TA 4H09A 3W3LA 3RW6A 4BSUA 4C2AB 1G9UA 4R0AA 3ZYOA 2WQVA 1OTMA 1DFJI 3CVRA 5GQRK 4CILA 1U0ND 4Q3IA 4J0MA 3OJAA 2BNHA 4FMZA 1Z7XW 5FTTB 4LSAA 4FDWA 5IJBA 1DS9A 4CP6A 4NKGA 2UZXA 4IM6A 4PKIG 1K5GC 1OTOA 4R6AA 4J4LA 1H6UA 3ZYNA 4XOSA 4LI1A 4C2BB 1FQVA 2OMZA 1XEUA 3A79B 4R08A 5GMHA 1OZNA 2Y5QA 2R9UA 3SB4A 1PGVA 3RFJA 4FD0A 4ECNA 3G3BA 2P1OB 4Z64C 4PQ8A 1P9AG 4ARRA 2Q4GW 4LSXC 4UFRA 4Z94G 1DCEA 3RIZA 4R5CA 3W3MA 2XWTC 3P72A 1P8VA 1KOOA 2Z64A 4RWTC 3W3JA 4V2DA 4AW4A 4KNGA 4LXSA 4Q62A 4CNMA 3W3NA 4XGOA 3WPHA 2ASSB 4ECOA 4NKHA 1OOKG 2BEXA 2JQDA 3ULVA 2V70A 5LFNA 4Z8GA 1M9SA 1LTXA 4LSCA 4R5DA 5B0NA 4FS7A 4FCGA 2P1NB 2ELLA 4PEQB 4U09A 1SQ0B 2V9TB 3PMHG 4WYKA 3O6NA 3RGXA 4RCWA 3C6OB 4ARNA 2RR6A 3VQ2A 2WQXA 4LXRA 2UZYA 2V9SA 5HZLB 1XECA 1WWLA 2Z66A
chains in the Genus database with same CATH superfamily
3OJAB 4MQWX 4U06A 4V2EA 2OMVA 4R07A 3G39A 4GT6A 2OMUA 1KOHA 4GLPA 3WPGA 5A5CA 4M7EC 4OQTA 4R6FA 3TSRE 3ZYIA 4B8CD 1ZIWA 3ZYJA 3JB9j 1K5DC 4WP6A 4EZGA 4P8SA 3C6NB 1XCDA 2O6SA 2Z7XA 4L3AA 5HDHA 5GMGA 2A0ZA 2OMYA 3OGKB 1GWBA 4CC4C 4LI2A 1FS2A 1P8TA 2JE0A 1W8AA 3RW7A 4R09A 3E6JA 3ULAA 1M10B 4PERA 5IJCA 2P1QB 2WQUA 3G3AA 2O6RA 4I6JB 2Z7XB 1O6SA 2ID5A 3E2JA 1M0ZA 5IJDA 1OGQA 2OMWA 4K17A 3RFSA 3GOZA 3ULUA 1D0BA 3REZA 3OGLB 4KT1A 5D3IA 2O6QA 3WN4A 4RCAB 3DZEA 4LSXA 3WPFA 1FO1A 2FT3A 3KJ4A 5CMPA 4R58A 1QYYA 2JE1A 3WPIA 4R6GA 5AWBA 3W3GA 4G8AA 2Z63A 4Y61B 2ASTB 4L3FA 4Q3GA 2CA6A 4QC0A 2Z62A 5AZ5A 4BV4R 4R6JA 3M18A 2WQWA 5GS0A 5GS2B 4MN8B 1XWDC 3E3ZA 2P1PB 4FHOA 3W3KA 2OMTA 2IFGA 3O53A 3WPDA 4U08A 4BSSA 1O6TA 4Z79A 3G04C 3WPBA 3C6PB 1H6TA 3CIYA 2P1MB 3FXIA 4PSJA 1XKUA 4XSQA 5CMNA 2Z82A 5AWAA 3BZ5A 2WFHA 3UL8A 5IYXC 3E4GA 2XOTA 3VQ1A 4YEBB 2Z81A 1A9NA 1M9LA 3CIGA 5AWCA 3RJ0A 3WPEA 3WPCA 2Z65A 3UN9A 1JL5A 5B4PA 4BSRA 4AY9X 4KXFB 4TZHA 4Z61C 5AWDA 1YRGA 3M19A 4HQ1A 4M7EA 4P91A 4U7LA 3UL9A 2RA8A 3RGZA 3G06A 4NZTM 4CNCA 1OTNA 4NZRM 1IO0A 3UL7A 3RFEA 4CC4A 3OGMB 4QBZA 4QXEA 1A4YA 4V2CA 1FT8A 5GMFA 1O6VA 2OMXA 5B0TA 4H09A 3W3LA 3RW6A 4BSUA 4C2AB 1G9UA 4R0AA 3ZYOA 2WQVA 1OTMA 1DFJI 3CVRA 5GQRK 4CILA 1U0ND 4Q3IA 4J0MA 3OJAA 2BNHA 4FMZA 1Z7XW 5FTTB 4LSAA 4FDWA 5IJBA 1DS9A 4CP6A 4NKGA 2UZXA 4IM6A 4PKIG 1K5GC 1OTOA 4R6AA 4J4LA 1H6UA 3ZYNA 4XOSA 4LI1A 4C2BB 1FQVA 2OMZA 1XEUA 3A79B 4R08A 5GMHA 1OZNA 2Y5QA 2R9UA 3SB4A 1PGVA 3RFJA 4FD0A 4ECNA 3G3BA 2P1OB 4Z64C 4PQ8A 1P9AG 4ARRA 2Q4GW 4LSXC 4UFRA 4Z94G 1DCEA 3RIZA 4R5CA 3W3MA 2XWTC 3P72A 1P8VA 1KOOA 2Z64A 4RWTC 3W3JA 4V2DA 4AW4A 4KNGA 4LXSA 4Q62A 4CNMA 3W3NA 4XGOA 3WPHA 2ASSB 4ECOA 4NKHA 1OOKG 2BEXA 2JQDA 3ULVA 2V70A 5LFNA 4Z8GA 1M9SA 1LTXA 4LSCA 4R5DA 5B0NA 4FS7A 4FCGA 2P1NB 2ELLA 4PEQB 4U09A 1SQ0B 2V9TB 3PMHG 4WYKA 3O6NA 3RGXA 4RCWA 3C6OB 4ARNA 2RR6A 3VQ2A 2WQXA 4LXRA 2UZYA 2V9SA 5HZLB 1XECA 1WWLA 2Z66A
chains in the Genus database with same CATH topology
3OJAB 4MQWX 4U06A 4V2EA 2OMVA 4R07A 3G39A 4GT6A 2OMUA 1KOHA 4GLPA 3WPGA 5A5CA 4M7EC 4OQTA 4R6FA 3TSRE 3ZYIA 4B8CD 1ZIWA 3ZYJA 3JB9j 1K5DC 4WP6A 4EZGA 4P8SA 3C6NB 1XCDA 2O6SA 2Z7XA 4L3AA 5HDHA 5GMGA 2A0ZA 2OMYA 3OGKB 1GWBA 4CC4C 4LI2A 1FS2A 1P8TA 2JE0A 1W8AA 3RW7A 4R09A 3E6JA 3ULAA 1M10B 4PERA 5IJCA 2P1QB 2WQUA 3G3AA 2O6RA 4I6JB 2Z7XB 1O6SA 2ID5A 3E2JA 1M0ZA 5IJDA 1OGQA 2OMWA 4K17A 3RFSA 3GOZA 3ULUA 1D0BA 3REZA 3OGLB 4KT1A 5D3IA 2O6QA 3WN4A 4RCAB 3DZEA 4LSXA 3WPFA 1FO1A 2FT3A 3KJ4A 5CMPA 4R58A 1QYYA 2JE1A 3WPIA 4R6GA 5AWBA 3W3GA 4G8AA 2Z63A 4Y61B 2ASTB 4L3FA 4Q3GA 2CA6A 4QC0A 2Z62A 5AZ5A 4BV4R 4R6JA 3M18A 2WQWA 5GS0A 5GS2B 4MN8B 1XWDC 3E3ZA 2P1PB 4FHOA 3W3KA 2OMTA 2IFGA 3O53A 3WPDA 4U08A 4BSSA 1O6TA 4Z79A 3G04C 3WPBA 3C6PB 1H6TA 3CIYA 2P1MB 3FXIA 4PSJA 1XKUA 4XSQA 5CMNA 2Z82A 5AWAA 3BZ5A 2WFHA 3UL8A 5IYXC 3E4GA 2XOTA 3VQ1A 4YEBB 2Z81A 1A9NA 1M9LA 3CIGA 5AWCA 3RJ0A 3WPEA 3WPCA 2Z65A 3UN9A 1JL5A 5B4PA 4BSRA 4AY9X 4KXFB 4TZHA 4Z61C 5AWDA 1YRGA 3M19A 4HQ1A 4M7EA 4P91A 4U7LA 3UL9A 2RA8A 3RGZA 3G06A 4CNCA 1OTNA 1IO0A 3UL7A 3RFEA 4CC4A 3OGMB 4QBZA 4QXEA 1A4YA 4V2CA 1FT8A 5GMFA 1O6VA 2OMXA 5B0TA 4H09A 3W3LA 3RW6A 4BSUA 4C2AB 1G9UA 4R0AA 3ZYOA 2WQVA 1OTMA 1DFJI 3CVRA 5GQRK 4CILA 1U0ND 4Q3IA 4J0MA 3OJAA 2BNHA 4FMZA 1Z7XW 5FTTB 4LSAA 4FDWA 5IJBA 1DS9A 4CP6A 4NKGA 2UZXA 4IM6A 4PKIG 1K5GC 1OTOA 4R6AA 4J4LA 1H6UA 3ZYNA 4XOSA 4LI1A 4C2BB 1FQVA 2OMZA 1XEUA 3A79B 4R08A 5GMHA 1OZNA 2Y5QA 2R9UA 3SB4A 1PGVA 3RFJA 4FD0A 4ECNA 3G3BA 2P1OB 4Z64C 4PQ8A 1P9AG 4ARRA 2Q4GW 4LSXC 4UFRA 4Z94G 1DCEA 3RIZA 4R5CA 3W3MA 2XWTC 3P72A 1P8VA 1KOOA 2Z64A 4RWTC 3W3JA 4V2DA 4AW4A 4KNGA 4LXSA 4Q62A 4CNMA 3W3NA 4XGOA 3WPHA 2ASSB 4ECOA 4NKHA 1OOKG 2BEXA 2JQDA 3ULVA 2V70A 5LFNA 4Z8GA 1M9SA 1LTXA 4LSCA 4R5DA 5B0NA 4FS7A 4FCGA 2P1NB 2ELLA 4PEQB 4U09A 1SQ0B 2V9TB 3PMHG 4WYKA 3O6NA 3RGXA 4RCWA 3C6OB 4ARNA 2RR6A 3VQ2A 2WQXA 4LXRA 2UZYA 2V9SA 5HZLB 1XECA 1WWLA 2Z66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJA B;  4MQW X;  4U06 A;  4V2E A;  2OMV A;  4R07 A;  3G39 A;  4GT6 A;  2OMU A;  1KOH A;  4GLP A;  3WPG A;  5A5C A;  4M7E C;  4OQT A;  4R6F A;  3TSR E;  3ZYI A;  4B8C D;  1ZIW A;  3ZYJ A;  3JB9 j;  1K5D C;  4WP6 A;  4EZG A;  4P8S A;  3C6N B;  1XCD A;  2O6S A;  2Z7X A;  4L3A A;  5HDH A;  5GMG A;  2A0Z A;  2OMY A;  3OGK B;  1GWB A;  4CC4 C;  4LI2 A;  1FS2 A;  1P8T A;  2JE0 A;  1W8A A;  3RW7 A;  4R09 A;  3E6J A;  3ULA A;  1M10 B;  4PER A;  5IJC A;  2P1Q B;  2WQU A;  3G3A A;  2O6R A;  4I6J B;  2Z7X B;  1O6S A;  2ID5 A;  3E2J A;  1M0Z A;  5IJD A;  1OGQ A;  2OMW A;  4K17 A;  3RFS A;  3GOZ A;  3ULU A;  1D0B A;  3REZ A;  3OGL B;  4KT1 A;  5D3I A;  2O6Q A;  3WN4 A;  4RCA B;  3DZE A;  4LSX A;  3WPF A;  1FO1 A;  2FT3 A;  3KJ4 A;  5CMP A;  4R58 A;  1QYY A;  2JE1 A;  3WPI A;  4R6G A;  5AWB A;  3W3G A;  4G8A A;  2Z63 A;  4Y61 B;  2AST B;  4L3F A;  4Q3G A;  2CA6 A;  4QC0 A;  2Z62 A;  5AZ5 A;  4BV4 R;  4R6J A;  3M18 A;  2WQW A;  5GS0 A;  5GS2 B;  4MN8 B;  1XWD C;  3E3Z A;  2P1P B;  4FHO A;  3W3K A;  2OMT A;  2IFG A;  3O53 A;  3WPD A;  4U08 A;  4BSS A;  1O6T A;  4Z79 A;  3G04 C;  3WPB A;  3C6P B;  1H6T A;  3CIY A;  2P1M B;  3FXI A;  4PSJ A;  1XKU A;  4XSQ A;  5CMN A;  2Z82 A;  5AWA A;  3BZ5 A;  2WFH A;  3UL8 A;  5IYX C;  3E4G A;  2XOT A;  3VQ1 A;  4YEB B;  2Z81 A;  1A9N A;  1M9L A;  3CIG A;  5AWC A;  3RJ0 A;  3WPE A;  3WPC A;  2Z65 A;  3UN9 A;  1JL5 A;  5B4P A;  4BSR A;  4AY9 X;  4KXF B;  4TZH A;  4Z61 C;  5AWD A;  1YRG A;  3M19 A;  4HQ1 A;  4M7E A;  4P91 A;  4U7L A;  3UL9 A;  2RA8 A;  3RGZ A;  3G06 A;  4CNC A;  1OTN A;  1IO0 A;  3UL7 A;  3RFE A;  4CC4 A;  3OGM B;  4QBZ A;  4QXE A;  1A4Y A;  4V2C A;  1FT8 A;  5GMF A;  1O6V A;  2OMX A;  5B0T A;  4H09 A;  3W3L A;  3RW6 A;  4BSU A;  4C2A B;  1G9U A;  4R0A A;  3ZYO A;  2WQV A;  1OTM A;  1DFJ I;  3CVR A;  5GQR K;  4CIL A;  1U0N D;  4Q3I A;  4J0M A;  3OJA A;  2BNH A;  4FMZ A;  1Z7X W;  5FTT B;  4LSA A;  4FDW A;  5IJB A;  1DS9 A;  4CP6 A;  4NKG A;  2UZX A;  4IM6 A;  4PKI G;  1K5G C;  1OTO A;  4R6A A;  4J4L A;  1H6U A;  3ZYN A;  4XOS A;  4LI1 A;  4C2B B;  1FQV A;  2OMZ A;  1XEU A;  3A79 B;  4R08 A;  5GMH A;  1OZN A;  2Y5Q A;  2R9U A;  3SB4 A;  1PGV A;  3RFJ A;  4FD0 A;  4ECN A;  3G3B A;  2P1O B;  4Z64 C;  4PQ8 A;  1P9A G;  4ARR A;  2Q4G W;  4LSX C;  4UFR A;  4Z94 G;  1DCE A;  3RIZ A;  4R5C A;  3W3M A;  2XWT C;  3P72 A;  1P8V A;  1KOO A;  2Z64 A;  4RWT C;  3W3J A;  4V2D A;  4AW4 A;  4KNG A;  4LXS A;  4Q62 A;  4CNM A;  3W3N A;  4XGO A;  3WPH A;  2ASS B;  4ECO A;  4NKH A;  1OOK G;  2BEX A;  2JQD A;  3ULV A;  2V70 A;  5LFN A;  4Z8G A;  1M9S A;  1LTX A;  4LSC A;  4R5D A;  5B0N A;  4FS7 A;  4FCG A;  2P1N B;  2ELL A;  4PEQ B;  4U09 A;  1SQ0 B;  2V9T B;  3PMH G;  4WYK A;  3O6N A;  3RGX A;  4RCW A;  3C6O B;  4ARN A;  2RR6 A;  3VQ2 A;  2WQX A;  4LXR A;  2UZY A;  2V9S A;  5HZL B;  1XEC A;  1WWL A;  2Z66 A; 
#chains in the Genus database with same CATH topology
 3OJA B;  4MQW X;  4U06 A;  4V2E A;  2OMV A;  4R07 A;  3G39 A;  4GT6 A;  2OMU A;  1KOH A;  4GLP A;  3WPG A;  5A5C A;  4M7E C;  4OQT A;  4R6F A;  3TSR E;  3ZYI A;  4B8C D;  1ZIW A;  3ZYJ A;  3JB9 j;  1K5D C;  4WP6 A;  4EZG A;  4P8S A;  3C6N B;  1XCD A;  2O6S A;  2Z7X A;  4L3A A;  5HDH A;  5GMG A;  2A0Z A;  2OMY A;  3OGK B;  1GWB A;  4CC4 C;  4LI2 A;  1FS2 A;  1P8T A;  2JE0 A;  1W8A A;  3RW7 A;  4R09 A;  3E6J A;  3ULA A;  1M10 B;  4PER A;  5IJC A;  2P1Q B;  2WQU A;  3G3A A;  2O6R A;  4I6J B;  2Z7X B;  1O6S A;  2ID5 A;  3E2J A;  1M0Z A;  5IJD A;  1OGQ A;  2OMW A;  4K17 A;  3RFS A;  3GOZ A;  3ULU A;  1D0B A;  3REZ A;  3OGL B;  4KT1 A;  5D3I A;  2O6Q A;  3WN4 A;  4RCA B;  3DZE A;  4LSX A;  3WPF A;  1FO1 A;  2FT3 A;  3KJ4 A;  5CMP A;  4R58 A;  1QYY A;  2JE1 A;  3WPI A;  4R6G A;  5AWB A;  3W3G A;  4G8A A;  2Z63 A;  4Y61 B;  2AST B;  4L3F A;  4Q3G A;  2CA6 A;  4QC0 A;  2Z62 A;  5AZ5 A;  4BV4 R;  4R6J A;  3M18 A;  2WQW A;  5GS0 A;  5GS2 B;  4MN8 B;  1XWD C;  3E3Z A;  2P1P B;  4FHO A;  3W3K A;  2OMT A;  2IFG A;  3O53 A;  3WPD A;  4U08 A;  4BSS A;  1O6T A;  4Z79 A;  3G04 C;  3WPB A;  3C6P B;  1H6T A;  3CIY A;  2P1M B;  3FXI A;  4PSJ A;  1XKU A;  4XSQ A;  5CMN A;  2Z82 A;  5AWA A;  3BZ5 A;  2WFH A;  3UL8 A;  5IYX C;  3E4G A;  2XOT A;  3VQ1 A;  4YEB B;  2Z81 A;  1A9N A;  1M9L A;  3CIG A;  5AWC A;  3RJ0 A;  3WPE A;  3WPC A;  2Z65 A;  3UN9 A;  1JL5 A;  5B4P A;  4BSR A;  4AY9 X;  4KXF B;  4TZH A;  4Z61 C;  5AWD A;  1YRG A;  3M19 A;  4HQ1 A;  4M7E A;  4P91 A;  4U7L A;  3UL9 A;  2RA8 A;  3RGZ A;  3G06 A;  4NZT M;  4CNC A;  1OTN A;  4NZR M;  1IO0 A;  3UL7 A;  3RFE A;  4CC4 A;  3OGM B;  4QBZ A;  4QXE A;  1A4Y A;  4V2C A;  1FT8 A;  5GMF A;  1O6V A;  2OMX A;  5B0T A;  4H09 A;  3W3L A;  3RW6 A;  4BSU A;  4C2A B;  1G9U A;  4R0A A;  3ZYO A;  2WQV A;  1OTM A;  1DFJ I;  3CVR A;  5GQR K;  4CIL A;  1U0N D;  4Q3I A;  4J0M A;  3OJA A;  2BNH A;  4FMZ A;  1Z7X W;  5FTT B;  4LSA A;  4FDW A;  5IJB A;  1DS9 A;  4CP6 A;  4NKG A;  2UZX A;  4IM6 A;  4PKI G;  1K5G C;  1OTO A;  4R6A A;  4J4L A;  1H6U A;  3ZYN A;  4XOS A;  4LI1 A;  4C2B B;  1FQV A;  2OMZ A;  1XEU A;  3A79 B;  4R08 A;  5GMH A;  1OZN A;  2Y5Q A;  2R9U A;  3SB4 A;  1PGV A;  3RFJ A;  4FD0 A;  4ECN A;  3G3B A;  2P1O B;  4Z64 C;  4PQ8 A;  1P9A G;  4ARR A;  2Q4G W;  4LSX C;  4UFR A;  4Z94 G;  1DCE A;  3RIZ A;  4R5C A;  3W3M A;  2XWT C;  3P72 A;  1P8V A;  1KOO A;  2Z64 A;  4RWT C;  3W3J A;  4V2D A;  4AW4 A;  4KNG A;  4LXS A;  4Q62 A;  4CNM A;  3W3N A;  4XGO A;  3WPH A;  2ASS B;  4ECO A;  4NKH A;  1OOK G;  2BEX A;  2JQD A;  3ULV A;  2V70 A;  5LFN A;  4Z8G A;  1M9S A;  1LTX A;  4LSC A;  4R5D A;  5B0N A;  4FS7 A;  4FCG A;  2P1N B;  2ELL A;  4PEQ B;  4U09 A;  1SQ0 B;  2V9T B;  3PMH G;  4WYK A;  3O6N A;  3RGX A;  4RCW A;  3C6O B;  4ARN A;  2RR6 A;  3VQ2 A;  2WQX A;  4LXR A;  2UZY A;  2V9S A;  5HZL B;  1XEC A;  1WWL A;  2Z66 A; 
#chains in the Genus database with same CATH homology
 3OJA B;  4MQW X;  4U06 A;  4V2E A;  2OMV A;  4R07 A;  3G39 A;  4GT6 A;  2OMU A;  1KOH A;  4GLP A;  3WPG A;  5A5C A;  4M7E C;  4OQT A;  4R6F A;  3TSR E;  3ZYI A;  4B8C D;  1ZIW A;  3ZYJ A;  3JB9 j;  1K5D C;  4WP6 A;  4EZG A;  4P8S A;  3C6N B;  1XCD A;  2O6S A;  2Z7X A;  4L3A A;  5HDH A;  5GMG A;  2A0Z A;  2OMY A;  3OGK B;  1GWB A;  4CC4 C;  4LI2 A;  1FS2 A;  1P8T A;  2JE0 A;  1W8A A;  3RW7 A;  4R09 A;  3E6J A;  3ULA A;  1M10 B;  4PER A;  5IJC A;  2P1Q B;  2WQU A;  3G3A A;  2O6R A;  4I6J B;  2Z7X B;  1O6S A;  2ID5 A;  3E2J A;  1M0Z A;  5IJD A;  1OGQ A;  2OMW A;  4K17 A;  3RFS A;  3GOZ A;  3ULU A;  1D0B A;  3REZ A;  3OGL B;  4KT1 A;  5D3I A;  2O6Q A;  3WN4 A;  4RCA B;  3DZE A;  4LSX A;  3WPF A;  1FO1 A;  2FT3 A;  3KJ4 A;  5CMP A;  4R58 A;  1QYY A;  2JE1 A;  3WPI A;  4R6G A;  5AWB A;  3W3G A;  4G8A A;  2Z63 A;  4Y61 B;  2AST B;  4L3F A;  4Q3G A;  2CA6 A;  4QC0 A;  2Z62 A;  5AZ5 A;  4BV4 R;  4R6J A;  3M18 A;  2WQW A;  5GS0 A;  5GS2 B;  4MN8 B;  1XWD C;  3E3Z A;  2P1P B;  4FHO A;  3W3K A;  2OMT A;  2IFG A;  3O53 A;  3WPD A;  4U08 A;  4BSS A;  1O6T A;  4Z79 A;  3G04 C;  3WPB A;  3C6P B;  1H6T A;  3CIY A;  2P1M B;  3FXI A;  4PSJ A;  1XKU A;  4XSQ A;  5CMN A;  2Z82 A;  5AWA A;  3BZ5 A;  2WFH A;  3UL8 A;  5IYX C;  3E4G A;  2XOT A;  3VQ1 A;  4YEB B;  2Z81 A;  1A9N A;  1M9L A;  3CIG A;  5AWC A;  3RJ0 A;  3WPE A;  3WPC A;  2Z65 A;  3UN9 A;  1JL5 A;  5B4P A;  4BSR A;  4AY9 X;  4KXF B;  4TZH A;  4Z61 C;  5AWD A;  1YRG A;  3M19 A;  4HQ1 A;  4M7E A;  4P91 A;  4U7L A;  3UL9 A;  2RA8 A;  3RGZ A;  3G06 A;  4CNC A;  1OTN A;  1IO0 A;  3UL7 A;  3RFE A;  4CC4 A;  3OGM B;  4QBZ A;  4QXE A;  1A4Y A;  4V2C A;  1FT8 A;  5GMF A;  1O6V A;  2OMX A;  5B0T A;  4H09 A;  3W3L A;  3RW6 A;  4BSU A;  4C2A B;  1G9U A;  4R0A A;  3ZYO A;  2WQV A;  1OTM A;  1DFJ I;  3CVR A;  5GQR K;  4CIL A;  1U0N D;  4Q3I A;  4J0M A;  3OJA A;  2BNH A;  4FMZ A;  1Z7X W;  5FTT B;  4LSA A;  4FDW A;  5IJB A;  1DS9 A;  4CP6 A;  4NKG A;  2UZX A;  4IM6 A;  4PKI G;  1K5G C;  1OTO A;  4R6A A;  4J4L A;  1H6U A;  3ZYN A;  4XOS A;  4LI1 A;  4C2B B;  1FQV A;  2OMZ A;  1XEU A;  3A79 B;  4R08 A;  5GMH A;  1OZN A;  2Y5Q A;  2R9U A;  3SB4 A;  1PGV A;  3RFJ A;  4FD0 A;  4ECN A;  3G3B A;  2P1O B;  4Z64 C;  4PQ8 A;  1P9A G;  4ARR A;  2Q4G W;  4LSX C;  4UFR A;  4Z94 G;  1DCE A;  3RIZ A;  4R5C A;  3W3M A;  2XWT C;  3P72 A;  1P8V A;  1KOO A;  2Z64 A;  4RWT C;  3W3J A;  4V2D A;  4AW4 A;  4KNG A;  4LXS A;  4Q62 A;  4CNM A;  3W3N A;  4XGO A;  3WPH A;  2ASS B;  4ECO A;  4NKH A;  1OOK G;  2BEX A;  2JQD A;  3ULV A;  2V70 A;  5LFN A;  4Z8G A;  1M9S A;  1LTX A;  4LSC A;  4R5D A;  5B0N A;  4FS7 A;  4FCG A;  2P1N B;  2ELL A;  4PEQ B;  4U09 A;  1SQ0 B;  2V9T B;  3PMH G;  4WYK A;  3O6N A;  3RGX A;  4RCW A;  3C6O B;  4ARN A;  2RR6 A;  3VQ2 A;  2WQX A;  4LXR A;  2UZY A;  2V9S A;  5HZL B;  1XEC A;  1WWL A;  2Z66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...