3RFJA

Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
268
Chain Sequence
TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLYLYHNQLQSLPKGVFDKLTNLTRLDLDNNQLQSLPEGVFDKLTQLKQLSLNDNQLKSVPDGVFDRLTSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
molecule keywords Internalin B, repeat modules, Variable lymphocyte receptor
total genus 84
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfjA00
4R09A 2Q4GW 2O6SA 3ZYOA 4MN8B 5IJCA 2CA6A 4Z64C 2OMZA 4GT6A 1O6SA 4R5CA 3WPCA 3TSRE 3G3BA 4R58A 1H6UA 3CVRA 4V2EA 2ASTB 2Z64A 4FS7A 2BNHA 2V70A 3UL8A 4J0MA 4R08A 3G3AA 4Q3IA 2ELLA 3ZYNA 3P72A 1P8TA 3G39A 4PSJA 2R9UA 4FDWA 1KOOA 4KT1A 3C6OB 4L3AA 4XGOA 4PKIG 1FQVA 3OGMB 5D3IA 3ULAA 1OTNA 4LSAA 5GMFA 2XWTC 2JE1A 3G04C 2WQXA 4Q3GA 2P1OB 4P91A 3WPGA 5FTTB 3C6PB 4CP6A 5A5CA 5GMGA 4U7LA 4R6JA 1M0ZA 4LSXA 5IJDA 4QXEA 3E4GA 1OGQA 5IJBA 2WFHA 1XWDC 3W3JA 4M7EA 3RFJA 3W3KA 1FS2A 5AWBA 3W3MA 2BEXA 4PERA 4HQ1A 3WPFA 3BZ5A 2Z66A 1XKUA 3REZA 2UZYA 3SB4A 1DCEA 4AY9X 2Z82A 3UN9A 4ECNA 4FCGA 4G8AA 4LXSA 4B8CD 1FT8A 3ULUA 2OMTA 3CIGA 2RA8A 2V9SA 4LXRA 3E3ZA 4KNGA 3C6NB 4BSUA 4Z61C 4CILA 3RJ0A 2Z65A 1XECA 2OMVA 4MQWX 2Z63A 4BSRA 4U06A 2WQVA 2P1QB 5AZ5A 4CC4C 2WQUA 1O6VA 4R6GA 4M7EC 5AWAA 4R5DA 4Z8GA 1A9NA 4AW4A 4TZHA 4K17A 4RCWA 1P8VA 4U09A 5GQRK 5AWCA 3JB9j 1Z7XW 4KXFB 4U08A 1DS9A 2Z7XA 3DZEA 4R6FA 4WYKA 3G06A 4R0AA 1IO0A 4LSXC 2XOTA 3RW7A 4PEQB 4Z94G 3M18A 4FHOA 1PGVA 1K5GC 3W3LA 1H6TA 4XSQA 4BV4R 1KOHA 4C2AB 3W3GA 4ARNA 4YEBB 3OJAA 2OMYA 3W3NA 1DFJI 4XOSA 2WQWA 4R6AA 3WPEA 3CIYA 2FT3A 1M10B 3E2JA 2Z62A 1FO1A 3ZYIA 2JE0A 3KJ4A 3PMHG 4IM6A 4H09A 4NKHA 5HZLB 1U0ND 2UZXA 3OJAB 1ZIWA 3GOZA 1OTMA 2P1MB 3O53A 2Z7XB 2A0ZA 4CNCA 4FD0A 3RW6A 1XEUA 5LFNA 5HDHA 1A4YA 4QC0A 1SQ0B 3RFSA 5CMPA 2ID5A 2OMUA 2IFGA 3A79B 4CC4A 3RGZA 3E6JA 3OGKB 2ASSB 5B0TA 1D0BA 3RGXA 5B4PA 3WPBA 4ARRA 2O6QA 4FMZA 4PQ8A 5CMNA 2JQDA 3UL9A 4R07A 4CNMA 5GMHA 3WPDA 1QYYA 2Z81A 5GS2B 2OMXA 1OZNA 4Y61B 3FXIA 1P9AG 4ECOA 1LTXA 3WPIA 1K5DC 4LI2A 4QBZA 1M9LA 1OTOA 3OGLB 3WN4A 4EZGA 2O6RA 4Z79A 4RWTC 2OMWA 1YRGA 2V9TB 4BSSA 3VQ1A 4LI1A 3M19A 4GLPA 2P1PB 4J4LA 4V2DA 4V2CA 1M9SA 2Y5QA 4UFRA 4OQTA 3O6NA 4Q62A 4I6JB 3RFEA 5IYXC 3UL7A 5AWDA 1WWLA 3WPHA 2P1NB 3VQ2A 1O6TA 1GWBA 1W8AA 2RR6A 4LSCA 5B0NA 1OOKG 3ZYJA 5GS0A 3ULVA 4L3FA 1G9UA 1XCDA 4NKGA 4RCAB 4WP6A 4C2BB 4P8SA 3RIZA 1JL5A
chains in the Genus database with same CATH superfamily
4R09A 2Q4GW 2O6SA 3ZYOA 4MN8B 5IJCA 2CA6A 4Z64C 2OMZA 4GT6A 1O6SA 4R5CA 3WPCA 3TSRE 3G3BA 4R58A 1H6UA 3CVRA 4V2EA 2ASTB 2Z64A 4FS7A 2BNHA 2V70A 3UL8A 4J0MA 4R08A 3G3AA 4Q3IA 2ELLA 3ZYNA 3P72A 1P8TA 3G39A 4PSJA 2R9UA 4FDWA 1KOOA 4KT1A 3C6OB 4L3AA 4XGOA 4PKIG 1FQVA 3OGMB 5D3IA 3ULAA 1OTNA 4LSAA 5GMFA 2XWTC 2JE1A 3G04C 2WQXA 4Q3GA 2P1OB 4P91A 3WPGA 5FTTB 3C6PB 4CP6A 5A5CA 5GMGA 4U7LA 4R6JA 1M0ZA 4LSXA 5IJDA 4QXEA 3E4GA 1OGQA 5IJBA 2WFHA 1XWDC 3W3JA 4M7EA 3RFJA 3W3KA 1FS2A 5AWBA 3W3MA 2BEXA 4PERA 4HQ1A 3WPFA 3BZ5A 2Z66A 1XKUA 3REZA 2UZYA 3SB4A 4NZRM 1DCEA 4AY9X 2Z82A 3UN9A 4ECNA 4FCGA 4G8AA 4LXSA 4B8CD 1FT8A 3ULUA 2OMTA 3CIGA 2RA8A 2V9SA 4LXRA 3E3ZA 4KNGA 3C6NB 4NZTM 4BSUA 4Z61C 4CILA 3RJ0A 2Z65A 1XECA 2OMVA 4MQWX 2Z63A 4BSRA 4U06A 2WQVA 2P1QB 5AZ5A 4CC4C 2WQUA 1O6VA 4R6GA 4M7EC 5AWAA 4R5DA 4Z8GA 1A9NA 4AW4A 4TZHA 4K17A 4RCWA 1P8VA 4U09A 5GQRK 5AWCA 3JB9j 1Z7XW 4KXFB 4U08A 1DS9A 2Z7XA 3DZEA 4R6FA 4WYKA 3G06A 4R0AA 1IO0A 4LSXC 2XOTA 3RW7A 4PEQB 4Z94G 3M18A 4FHOA 1PGVA 1K5GC 3W3LA 1H6TA 4XSQA 4BV4R 1KOHA 4C2AB 3W3GA 4ARNA 4YEBB 3OJAA 2OMYA 3W3NA 1DFJI 4XOSA 2WQWA 4R6AA 3WPEA 3CIYA 2FT3A 1M10B 3E2JA 2Z62A 1FO1A 3ZYIA 2JE0A 3KJ4A 3PMHG 4IM6A 4H09A 4NKHA 5HZLB 1U0ND 2UZXA 3OJAB 1ZIWA 3GOZA 1OTMA 2P1MB 3O53A 2Z7XB 2A0ZA 4CNCA 4FD0A 3RW6A 1XEUA 5LFNA 5HDHA 1A4YA 4QC0A 1SQ0B 3RFSA 5CMPA 2ID5A 2OMUA 2IFGA 3A79B 4CC4A 3RGZA 3E6JA 3OGKB 2ASSB 5B0TA 1D0BA 3RGXA 5B4PA 3WPBA 4ARRA 2O6QA 4FMZA 4PQ8A 5CMNA 2JQDA 3UL9A 4R07A 4CNMA 5GMHA 3WPDA 1QYYA 2Z81A 5GS2B 2OMXA 1OZNA 4Y61B 3FXIA 1P9AG 4ECOA 1LTXA 3WPIA 1K5DC 4LI2A 4QBZA 1M9LA 1OTOA 3OGLB 3WN4A 4EZGA 2O6RA 4Z79A 4RWTC 2OMWA 1YRGA 2V9TB 4BSSA 3VQ1A 4LI1A 3M19A 4GLPA 2P1PB 4J4LA 4V2DA 4V2CA 1M9SA 2Y5QA 4UFRA 4OQTA 3O6NA 4Q62A 4I6JB 3RFEA 5IYXC 3UL7A 5AWDA 1WWLA 3WPHA 2P1NB 3VQ2A 1O6TA 1GWBA 1W8AA 2RR6A 4LSCA 5B0NA 1OOKG 3ZYJA 5GS0A 3ULVA 4L3FA 1G9UA 1XCDA 4NKGA 4RCAB 4WP6A 4C2BB 4P8SA 3RIZA 1JL5A
chains in the Genus database with same CATH topology
4R09A 2Q4GW 2O6SA 3ZYOA 4MN8B 5IJCA 2CA6A 4Z64C 2OMZA 4GT6A 1O6SA 4R5CA 3WPCA 3TSRE 3G3BA 4R58A 1H6UA 3CVRA 4V2EA 2ASTB 2Z64A 4FS7A 2BNHA 2V70A 3UL8A 4J0MA 4R08A 3G3AA 4Q3IA 2ELLA 3ZYNA 3P72A 1P8TA 3G39A 4PSJA 2R9UA 4FDWA 1KOOA 4KT1A 3C6OB 4L3AA 4XGOA 4PKIG 1FQVA 3OGMB 5D3IA 3ULAA 1OTNA 4LSAA 5GMFA 2XWTC 2JE1A 3G04C 2WQXA 4Q3GA 2P1OB 4P91A 3WPGA 5FTTB 3C6PB 4CP6A 5A5CA 5GMGA 4U7LA 4R6JA 1M0ZA 4LSXA 5IJDA 4QXEA 3E4GA 1OGQA 5IJBA 2WFHA 1XWDC 3W3JA 4M7EA 3RFJA 3W3KA 1FS2A 5AWBA 3W3MA 2BEXA 4PERA 4HQ1A 3WPFA 3BZ5A 2Z66A 1XKUA 3REZA 2UZYA 3SB4A 1DCEA 4AY9X 2Z82A 3UN9A 4ECNA 4FCGA 4G8AA 4LXSA 4B8CD 1FT8A 3ULUA 2OMTA 3CIGA 2RA8A 2V9SA 4LXRA 3E3ZA 4KNGA 3C6NB 4BSUA 4Z61C 4CILA 3RJ0A 2Z65A 1XECA 2OMVA 4MQWX 2Z63A 4BSRA 4U06A 2WQVA 2P1QB 5AZ5A 4CC4C 2WQUA 1O6VA 4R6GA 4M7EC 5AWAA 4R5DA 4Z8GA 1A9NA 4AW4A 4TZHA 4K17A 4RCWA 1P8VA 4U09A 5GQRK 5AWCA 3JB9j 1Z7XW 4KXFB 4U08A 1DS9A 2Z7XA 3DZEA 4R6FA 4WYKA 3G06A 4R0AA 1IO0A 4LSXC 2XOTA 3RW7A 4PEQB 4Z94G 3M18A 4FHOA 1PGVA 1K5GC 3W3LA 1H6TA 4XSQA 4BV4R 1KOHA 4C2AB 3W3GA 4ARNA 4YEBB 3OJAA 2OMYA 3W3NA 1DFJI 4XOSA 2WQWA 4R6AA 3WPEA 3CIYA 2FT3A 1M10B 3E2JA 2Z62A 1FO1A 3ZYIA 2JE0A 3KJ4A 3PMHG 4IM6A 4H09A 4NKHA 5HZLB 1U0ND 2UZXA 3OJAB 1ZIWA 3GOZA 1OTMA 2P1MB 3O53A 2Z7XB 2A0ZA 4CNCA 4FD0A 3RW6A 1XEUA 5LFNA 5HDHA 1A4YA 4QC0A 1SQ0B 3RFSA 5CMPA 2ID5A 2OMUA 2IFGA 3A79B 4CC4A 3RGZA 3E6JA 3OGKB 2ASSB 5B0TA 1D0BA 3RGXA 5B4PA 3WPBA 4ARRA 2O6QA 4FMZA 4PQ8A 5CMNA 2JQDA 3UL9A 4R07A 4CNMA 5GMHA 3WPDA 1QYYA 2Z81A 5GS2B 2OMXA 1OZNA 4Y61B 3FXIA 1P9AG 4ECOA 1LTXA 3WPIA 1K5DC 4LI2A 4QBZA 1M9LA 1OTOA 3OGLB 3WN4A 4EZGA 2O6RA 4Z79A 4RWTC 2OMWA 1YRGA 2V9TB 4BSSA 3VQ1A 4LI1A 3M19A 4GLPA 2P1PB 4J4LA 4V2DA 4V2CA 1M9SA 2Y5QA 4UFRA 4OQTA 3O6NA 4Q62A 4I6JB 3RFEA 5IYXC 3UL7A 5AWDA 1WWLA 3WPHA 2P1NB 3VQ2A 1O6TA 1GWBA 1W8AA 2RR6A 4LSCA 5B0NA 1OOKG 3ZYJA 5GS0A 3ULVA 4L3FA 1G9UA 1XCDA 4NKGA 4RCAB 4WP6A 4C2BB 4P8SA 3RIZA 1JL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R09 A;  2Q4G W;  2O6S A;  3ZYO A;  4MN8 B;  5IJC A;  2CA6 A;  4Z64 C;  2OMZ A;  4GT6 A;  1O6S A;  4R5C A;  3WPC A;  3TSR E;  3G3B A;  4R58 A;  1H6U A;  3CVR A;  4V2E A;  2AST B;  2Z64 A;  4FS7 A;  2BNH A;  2V70 A;  3UL8 A;  4J0M A;  4R08 A;  3G3A A;  4Q3I A;  2ELL A;  3ZYN A;  3P72 A;  1P8T A;  3G39 A;  4PSJ A;  2R9U A;  4FDW A;  1KOO A;  4KT1 A;  3C6O B;  4L3A A;  4XGO A;  4PKI G;  1FQV A;  3OGM B;  5D3I A;  3ULA A;  1OTN A;  4LSA A;  5GMF A;  2XWT C;  2JE1 A;  3G04 C;  2WQX A;  4Q3G A;  2P1O B;  4P91 A;  3WPG A;  5FTT B;  3C6P B;  4CP6 A;  5A5C A;  5GMG A;  4U7L A;  4R6J A;  1M0Z A;  4LSX A;  5IJD A;  4QXE A;  3E4G A;  1OGQ A;  5IJB A;  2WFH A;  1XWD C;  3W3J A;  4M7E A;  3RFJ A;  3W3K A;  1FS2 A;  5AWB A;  3W3M A;  2BEX A;  4PER A;  4HQ1 A;  3WPF A;  3BZ5 A;  2Z66 A;  1XKU A;  3REZ A;  2UZY A;  3SB4 A;  1DCE A;  4AY9 X;  2Z82 A;  3UN9 A;  4ECN A;  4FCG A;  4G8A A;  4LXS A;  4B8C D;  1FT8 A;  3ULU A;  2OMT A;  3CIG A;  2RA8 A;  2V9S A;  4LXR A;  3E3Z A;  4KNG A;  3C6N B;  4BSU A;  4Z61 C;  4CIL A;  3RJ0 A;  2Z65 A;  1XEC A;  2OMV A;  4MQW X;  2Z63 A;  4BSR A;  4U06 A;  2WQV A;  2P1Q B;  5AZ5 A;  4CC4 C;  2WQU A;  1O6V A;  4R6G A;  4M7E C;  5AWA A;  4R5D A;  4Z8G A;  1A9N A;  4AW4 A;  4TZH A;  4K17 A;  4RCW A;  1P8V A;  4U09 A;  5GQR K;  5AWC A;  3JB9 j;  1Z7X W;  4KXF B;  4U08 A;  1DS9 A;  2Z7X A;  3DZE A;  4R6F A;  4WYK A;  3G06 A;  4R0A A;  1IO0 A;  4LSX C;  2XOT A;  3RW7 A;  4PEQ B;  4Z94 G;  3M18 A;  4FHO A;  1PGV A;  1K5G C;  3W3L A;  1H6T A;  4XSQ A;  4BV4 R;  1KOH A;  4C2A B;  3W3G A;  4ARN A;  4YEB B;  3OJA A;  2OMY A;  3W3N A;  1DFJ I;  4XOS A;  2WQW A;  4R6A A;  3WPE A;  3CIY A;  2FT3 A;  1M10 B;  3E2J A;  2Z62 A;  1FO1 A;  3ZYI A;  2JE0 A;  3KJ4 A;  3PMH G;  4IM6 A;  4H09 A;  4NKH A;  5HZL B;  1U0N D;  2UZX A;  3OJA B;  1ZIW A;  3GOZ A;  1OTM A;  2P1M B;  3O53 A;  2Z7X B;  2A0Z A;  4CNC A;  4FD0 A;  3RW6 A;  1XEU A;  5LFN A;  5HDH A;  1A4Y A;  4QC0 A;  1SQ0 B;  3RFS A;  5CMP A;  2ID5 A;  2OMU A;  2IFG A;  3A79 B;  4CC4 A;  3RGZ A;  3E6J A;  3OGK B;  2ASS B;  5B0T A;  1D0B A;  3RGX A;  5B4P A;  3WPB A;  4ARR A;  2O6Q A;  4FMZ A;  4PQ8 A;  5CMN A;  2JQD A;  3UL9 A;  4R07 A;  4CNM A;  5GMH A;  3WPD A;  1QYY A;  2Z81 A;  5GS2 B;  2OMX A;  1OZN A;  4Y61 B;  3FXI A;  1P9A G;  4ECO A;  1LTX A;  3WPI A;  1K5D C;  4LI2 A;  4QBZ A;  1M9L A;  1OTO A;  3OGL B;  3WN4 A;  4EZG A;  2O6R A;  4Z79 A;  4RWT C;  2OMW A;  1YRG A;  2V9T B;  4BSS A;  3VQ1 A;  4LI1 A;  3M19 A;  4GLP A;  2P1P B;  4J4L A;  4V2D A;  4V2C A;  1M9S A;  2Y5Q A;  4UFR A;  4OQT A;  3O6N A;  4Q62 A;  4I6J B;  3RFE A;  5IYX C;  3UL7 A;  5AWD A;  1WWL A;  3WPH A;  2P1N B;  3VQ2 A;  1O6T A;  1GWB A;  1W8A A;  2RR6 A;  4LSC A;  5B0N A;  1OOK G;  3ZYJ A;  5GS0 A;  3ULV A;  4L3F A;  1G9U A;  1XCD A;  4NKG A;  4RCA B;  4WP6 A;  4C2B B;  4P8S A;  3RIZ A;  1JL5 A; 
#chains in the Genus database with same CATH topology
 4R09 A;  2Q4G W;  2O6S A;  3ZYO A;  4MN8 B;  5IJC A;  2CA6 A;  4Z64 C;  2OMZ A;  4GT6 A;  1O6S A;  4R5C A;  3WPC A;  3TSR E;  3G3B A;  4R58 A;  1H6U A;  3CVR A;  4V2E A;  2AST B;  2Z64 A;  4FS7 A;  2BNH A;  2V70 A;  3UL8 A;  4J0M A;  4R08 A;  3G3A A;  4Q3I A;  2ELL A;  3ZYN A;  3P72 A;  1P8T A;  3G39 A;  4PSJ A;  2R9U A;  4FDW A;  1KOO A;  4KT1 A;  3C6O B;  4L3A A;  4XGO A;  4PKI G;  1FQV A;  3OGM B;  5D3I A;  3ULA A;  1OTN A;  4LSA A;  5GMF A;  2XWT C;  2JE1 A;  3G04 C;  2WQX A;  4Q3G A;  2P1O B;  4P91 A;  3WPG A;  5FTT B;  3C6P B;  4CP6 A;  5A5C A;  5GMG A;  4U7L A;  4R6J A;  1M0Z A;  4LSX A;  5IJD A;  4QXE A;  3E4G A;  1OGQ A;  5IJB A;  2WFH A;  1XWD C;  3W3J A;  4M7E A;  3RFJ A;  3W3K A;  1FS2 A;  5AWB A;  3W3M A;  2BEX A;  4PER A;  4HQ1 A;  3WPF A;  3BZ5 A;  2Z66 A;  1XKU A;  3REZ A;  2UZY A;  3SB4 A;  4NZR M;  1DCE A;  4AY9 X;  2Z82 A;  3UN9 A;  4ECN A;  4FCG A;  4G8A A;  4LXS A;  4B8C D;  1FT8 A;  3ULU A;  2OMT A;  3CIG A;  2RA8 A;  2V9S A;  4LXR A;  3E3Z A;  4KNG A;  3C6N B;  4NZT M;  4BSU A;  4Z61 C;  4CIL A;  3RJ0 A;  2Z65 A;  1XEC A;  2OMV A;  4MQW X;  2Z63 A;  4BSR A;  4U06 A;  2WQV A;  2P1Q B;  5AZ5 A;  4CC4 C;  2WQU A;  1O6V A;  4R6G A;  4M7E C;  5AWA A;  4R5D A;  4Z8G A;  1A9N A;  4AW4 A;  4TZH A;  4K17 A;  4RCW A;  1P8V A;  4U09 A;  5GQR K;  5AWC A;  3JB9 j;  1Z7X W;  4KXF B;  4U08 A;  1DS9 A;  2Z7X A;  3DZE A;  4R6F A;  4WYK A;  3G06 A;  4R0A A;  1IO0 A;  4LSX C;  2XOT A;  3RW7 A;  4PEQ B;  4Z94 G;  3M18 A;  4FHO A;  1PGV A;  1K5G C;  3W3L A;  1H6T A;  4XSQ A;  4BV4 R;  1KOH A;  4C2A B;  3W3G A;  4ARN A;  4YEB B;  3OJA A;  2OMY A;  3W3N A;  1DFJ I;  4XOS A;  2WQW A;  4R6A A;  3WPE A;  3CIY A;  2FT3 A;  1M10 B;  3E2J A;  2Z62 A;  1FO1 A;  3ZYI A;  2JE0 A;  3KJ4 A;  3PMH G;  4IM6 A;  4H09 A;  4NKH A;  5HZL B;  1U0N D;  2UZX A;  3OJA B;  1ZIW A;  3GOZ A;  1OTM A;  2P1M B;  3O53 A;  2Z7X B;  2A0Z A;  4CNC A;  4FD0 A;  3RW6 A;  1XEU A;  5LFN A;  5HDH A;  1A4Y A;  4QC0 A;  1SQ0 B;  3RFS A;  5CMP A;  2ID5 A;  2OMU A;  2IFG A;  3A79 B;  4CC4 A;  3RGZ A;  3E6J A;  3OGK B;  2ASS B;  5B0T A;  1D0B A;  3RGX A;  5B4P A;  3WPB A;  4ARR A;  2O6Q A;  4FMZ A;  4PQ8 A;  5CMN A;  2JQD A;  3UL9 A;  4R07 A;  4CNM A;  5GMH A;  3WPD A;  1QYY A;  2Z81 A;  5GS2 B;  2OMX A;  1OZN A;  4Y61 B;  3FXI A;  1P9A G;  4ECO A;  1LTX A;  3WPI A;  1K5D C;  4LI2 A;  4QBZ A;  1M9L A;  1OTO A;  3OGL B;  3WN4 A;  4EZG A;  2O6R A;  4Z79 A;  4RWT C;  2OMW A;  1YRG A;  2V9T B;  4BSS A;  3VQ1 A;  4LI1 A;  3M19 A;  4GLP A;  2P1P B;  4J4L A;  4V2D A;  4V2C A;  1M9S A;  2Y5Q A;  4UFR A;  4OQT A;  3O6N A;  4Q62 A;  4I6J B;  3RFE A;  5IYX C;  3UL7 A;  5AWD A;  1WWL A;  3WPH A;  2P1N B;  3VQ2 A;  1O6T A;  1GWB A;  1W8A A;  2RR6 A;  4LSC A;  5B0N A;  1OOK G;  3ZYJ A;  5GS0 A;  3ULV A;  4L3F A;  1G9U A;  1XCD A;  4NKG A;  4RCA B;  4WP6 A;  4C2B B;  4P8S A;  3RIZ A;  1JL5 A; 
#chains in the Genus database with same CATH homology
 4R09 A;  2Q4G W;  2O6S A;  3ZYO A;  4MN8 B;  5IJC A;  2CA6 A;  4Z64 C;  2OMZ A;  4GT6 A;  1O6S A;  4R5C A;  3WPC A;  3TSR E;  3G3B A;  4R58 A;  1H6U A;  3CVR A;  4V2E A;  2AST B;  2Z64 A;  4FS7 A;  2BNH A;  2V70 A;  3UL8 A;  4J0M A;  4R08 A;  3G3A A;  4Q3I A;  2ELL A;  3ZYN A;  3P72 A;  1P8T A;  3G39 A;  4PSJ A;  2R9U A;  4FDW A;  1KOO A;  4KT1 A;  3C6O B;  4L3A A;  4XGO A;  4PKI G;  1FQV A;  3OGM B;  5D3I A;  3ULA A;  1OTN A;  4LSA A;  5GMF A;  2XWT C;  2JE1 A;  3G04 C;  2WQX A;  4Q3G A;  2P1O B;  4P91 A;  3WPG A;  5FTT B;  3C6P B;  4CP6 A;  5A5C A;  5GMG A;  4U7L A;  4R6J A;  1M0Z A;  4LSX A;  5IJD A;  4QXE A;  3E4G A;  1OGQ A;  5IJB A;  2WFH A;  1XWD C;  3W3J A;  4M7E A;  3RFJ A;  3W3K A;  1FS2 A;  5AWB A;  3W3M A;  2BEX A;  4PER A;  4HQ1 A;  3WPF A;  3BZ5 A;  2Z66 A;  1XKU A;  3REZ A;  2UZY A;  3SB4 A;  1DCE A;  4AY9 X;  2Z82 A;  3UN9 A;  4ECN A;  4FCG A;  4G8A A;  4LXS A;  4B8C D;  1FT8 A;  3ULU A;  2OMT A;  3CIG A;  2RA8 A;  2V9S A;  4LXR A;  3E3Z A;  4KNG A;  3C6N B;  4BSU A;  4Z61 C;  4CIL A;  3RJ0 A;  2Z65 A;  1XEC A;  2OMV A;  4MQW X;  2Z63 A;  4BSR A;  4U06 A;  2WQV A;  2P1Q B;  5AZ5 A;  4CC4 C;  2WQU A;  1O6V A;  4R6G A;  4M7E C;  5AWA A;  4R5D A;  4Z8G A;  1A9N A;  4AW4 A;  4TZH A;  4K17 A;  4RCW A;  1P8V A;  4U09 A;  5GQR K;  5AWC A;  3JB9 j;  1Z7X W;  4KXF B;  4U08 A;  1DS9 A;  2Z7X A;  3DZE A;  4R6F A;  4WYK A;  3G06 A;  4R0A A;  1IO0 A;  4LSX C;  2XOT A;  3RW7 A;  4PEQ B;  4Z94 G;  3M18 A;  4FHO A;  1PGV A;  1K5G C;  3W3L A;  1H6T A;  4XSQ A;  4BV4 R;  1KOH A;  4C2A B;  3W3G A;  4ARN A;  4YEB B;  3OJA A;  2OMY A;  3W3N A;  1DFJ I;  4XOS A;  2WQW A;  4R6A A;  3WPE A;  3CIY A;  2FT3 A;  1M10 B;  3E2J A;  2Z62 A;  1FO1 A;  3ZYI A;  2JE0 A;  3KJ4 A;  3PMH G;  4IM6 A;  4H09 A;  4NKH A;  5HZL B;  1U0N D;  2UZX A;  3OJA B;  1ZIW A;  3GOZ A;  1OTM A;  2P1M B;  3O53 A;  2Z7X B;  2A0Z A;  4CNC A;  4FD0 A;  3RW6 A;  1XEU A;  5LFN A;  5HDH A;  1A4Y A;  4QC0 A;  1SQ0 B;  3RFS A;  5CMP A;  2ID5 A;  2OMU A;  2IFG A;  3A79 B;  4CC4 A;  3RGZ A;  3E6J A;  3OGK B;  2ASS B;  5B0T A;  1D0B A;  3RGX A;  5B4P A;  3WPB A;  4ARR A;  2O6Q A;  4FMZ A;  4PQ8 A;  5CMN A;  2JQD A;  3UL9 A;  4R07 A;  4CNM A;  5GMH A;  3WPD A;  1QYY A;  2Z81 A;  5GS2 B;  2OMX A;  1OZN A;  4Y61 B;  3FXI A;  1P9A G;  4ECO A;  1LTX A;  3WPI A;  1K5D C;  4LI2 A;  4QBZ A;  1M9L A;  1OTO A;  3OGL B;  3WN4 A;  4EZG A;  2O6R A;  4Z79 A;  4RWT C;  2OMW A;  1YRG A;  2V9T B;  4BSS A;  3VQ1 A;  4LI1 A;  3M19 A;  4GLP A;  2P1P B;  4J4L A;  4V2D A;  4V2C A;  1M9S A;  2Y5Q A;  4UFR A;  4OQT A;  3O6N A;  4Q62 A;  4I6J B;  3RFE A;  5IYX C;  3UL7 A;  5AWD A;  1WWL A;  3WPH A;  2P1N B;  3VQ2 A;  1O6T A;  1GWB A;  1W8A A;  2RR6 A;  4LSC A;  5B0N A;  1OOK G;  3ZYJ A;  5GS0 A;  3ULV A;  4L3F A;  1G9U A;  1XCD A;  4NKG A;  4RCA B;  4WP6 A;  4C2B B;  4P8S A;  3RIZ A;  1JL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...