3RFJA

Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
268
Chain Sequence
b'TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLYLYHNQLQSLPKGVFDKLTNLTRLDLDNNQLQSLPEGVFDKLTQLKQLSLNDNQLKSVPDGVFDRLTSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin B, repeat modules, Variable lymphocyte receptor
publication title Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
total genus 84
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2011-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3rfjA00
3RIZA 1A4YA 1K5DC 2Z64A 4LSAA 3ZYIA 3VQ2A 3WPGA 3W3KA 3G39A 4RCWA 1XECA 1M10B 4ARNA 3W3MA 3PMHG 4PKIG 4CP6A 2O6QA 4WP6A 3CIYA 4RCAB 2XWTC 1ZIWA 4R0AA 3OGMB 5LFNA 2JE0A 4ECNA 4CNCA 2P1QB 4Z8GA 1WWLA 2OMYA 4U7LA 1P8TA 5IJBA 4WYKA 4R5DA 1M9LA 3OJAB 3RFSA 4FDWA 2UZXA 4Z64C 3WPEA 3OGKB 1YRGA 1M0ZA 5AWCA 1P9AG 5D3IA 4BSSA 2OMXA 2P1PB 5CMPA 3W3GA 4FS7A 5IJCA 4PEQB 3G06A 4GT6A 4U09A 1DFJI 2OMTA 5B4PA 3ULUA 4R6AA 4CILA 1W8AA 4ARRA 4EZGA 1JL5A 2Z65A 3WPIA 1FQVA 1OZNA 3WPCA 4YEBB 4KNGA 2OMWA 3ULAA 3WN4A 2P1OB 4Q3GA 4Z79A 4IM6A 4QBZA 1OTOA 4MN8B 4FCGA 4P8SA 1H6UA 3W3JA 1K5GC 2P1MB 3RFEA 1DCEA 2BNHA 3KJ4A 2ID5A 4LXSA 4PERA 2Z62A 1OGQA 1LTXA 5HDHA 5B0NA 4R09A 1G9UA 4C2BB 3M18A 1M9SA 3OJAA 2OMZA 3REZA 4AW4A 4LI1A 3UL9A 4C2AB 3W3NA 5FTTB 2ASTB 5AWBA 3WPBA 3E4GA 4R6FA 3VQ1A 3UN9A 2WQUA 3CIGA 1P8VA 4PSJA 3BZ5A 2WQXA 4LSXC 4XOSA 2V70A 4PQ8A 1OTNA 1SQ0B 4P91A 4M7EC 4AY9X 1OTMA 2R9UA 3ZYJA 2IFGA 4ECOA 4QXEA 1OOKG 2O6SA 4G8AA 4J4LA 1O6VA 3G3BA 4HQ1A 3WPHA 3RW6A 3CVRA 3FXIA 4LSXA 2Z81A 1XWDC 4L3AA 1D0BA 4UFRA 4V2EA 2V9TB 4M7EA 2Z7XA 5IYXC 1XEUA 3RW7A 4BV4R 5GQRK 4Q62A 5B0TA 4LSCA 4Y61B 1XCDA 3C6OB 2FT3A 5AZ5A 2P1NB 4NKGA 2Y5QA 3G3AA 1FO1A 3RGXA 2BEXA 5HZLB 2RA8A 4TZHA 1U0ND 2OMVA 1IO0A 5GS2B 4R6GA 5A5CA 4Q3IA 3C6PB 1O6SA 1KOOA 4FMZA 3UL7A 3O6NA 4RWTC 4R07A 4GLPA 4XGOA 5GMGA 5CMNA 5AWDA 2CA6A 1XKUA 3W3LA 3E2JA 3E6JA 3C6NB 2WQWA 1O6TA 3O53A 3OGLB 3G04C 2Z63A 4KXFB 1FT8A 5GMHA 4L3FA 4R58A 4U08A 4R5CA 4R6JA 3SB4A 3JB9j 1Z7XW 2WQVA 2UZYA 4I6JB 3M19A 3A79B 4LXRA 4H09A 3ZYOA 4CC4C 2WFHA 2ASSB 4LI2A 3RFJA 2Z82A 3DZEA 1FS2A 2ELLA 4FD0A 4MQWX 4FHOA 2Z66A 3RGZA 2V9SA 3E3ZA 2JE1A 4QC0A 5IJDA 4B8CD 1QYYA 5GMFA 4Z61C 1GWBA 3P72A 2Q4GW 4CC4A 3ZYNA 2JQDA 1H6TA 1KOHA 5AWAA 2A0ZA 4R08A 4BSUA 3WPFA 4KT1A 2XOTA 3UL8A 4V2CA 2OMUA 4BSRA 1PGVA 2RR6A 3RJ0A 2O6RA 4K17A 4Z94G 4XSQA 4V2DA 4CNMA 4NKHA 3WPDA 1DS9A 5GS0A 4U06A 3TSRE 3GOZA 1A9NA 2Z7XB 4J0MA 4OQTA 3ULVA
chains in the Genus database with same CATH superfamily
3RIZA 1A4YA 1K5DC 2Z64A 4LSAA 3ZYIA 3VQ2A 3WPGA 3W3KA 3G39A 4RCWA 1XECA 1M10B 4ARNA 3W3MA 3PMHG 4PKIG 4CP6A 2O6QA 4WP6A 3CIYA 4RCAB 2XWTC 1ZIWA 4R0AA 3OGMB 4NZTM 5LFNA 2JE0A 4ECNA 4CNCA 2P1QB 4Z8GA 1WWLA 2OMYA 4U7LA 1P8TA 5IJBA 4WYKA 4R5DA 1M9LA 3OJAB 3RFSA 4FDWA 2UZXA 4Z64C 3WPEA 3OGKB 1YRGA 1M0ZA 5AWCA 1P9AG 5D3IA 4BSSA 2OMXA 2P1PB 5CMPA 3W3GA 4FS7A 5IJCA 4PEQB 3G06A 4GT6A 4U09A 1DFJI 2OMTA 5B4PA 3ULUA 4R6AA 4CILA 1W8AA 4ARRA 4EZGA 1JL5A 2Z65A 3WPIA 1FQVA 1OZNA 3WPCA 4YEBB 4KNGA 2OMWA 3ULAA 3WN4A 2P1OB 4Q3GA 4Z79A 4IM6A 4QBZA 1OTOA 4MN8B 4FCGA 4P8SA 1H6UA 3W3JA 1K5GC 2P1MB 3RFEA 1DCEA 2BNHA 3KJ4A 2ID5A 4LXSA 4PERA 2Z62A 1OGQA 1LTXA 5HDHA 5B0NA 4R09A 1G9UA 4C2BB 3M18A 1M9SA 3OJAA 2OMZA 3REZA 4AW4A 4LI1A 3UL9A 4C2AB 3W3NA 5FTTB 2ASTB 5AWBA 3WPBA 3E4GA 4R6FA 3VQ1A 3UN9A 2WQUA 3CIGA 1P8VA 4PSJA 3BZ5A 2WQXA 4LSXC 4XOSA 2V70A 4PQ8A 1OTNA 1SQ0B 4P91A 4M7EC 4AY9X 1OTMA 2R9UA 3ZYJA 2IFGA 4ECOA 4QXEA 1OOKG 2O6SA 4G8AA 4J4LA 1O6VA 3G3BA 4HQ1A 3WPHA 3RW6A 3CVRA 3FXIA 4LSXA 2Z81A 1XWDC 4L3AA 1D0BA 4UFRA 4V2EA 2V9TB 4M7EA 2Z7XA 5IYXC 1XEUA 3RW7A 4BV4R 5GQRK 4Q62A 5B0TA 4LSCA 4Y61B 1XCDA 3C6OB 2FT3A 5AZ5A 2P1NB 4NKGA 2Y5QA 3G3AA 1FO1A 3RGXA 2BEXA 5HZLB 2RA8A 4TZHA 1U0ND 2OMVA 1IO0A 5GS2B 4R6GA 5A5CA 4Q3IA 3C6PB 1O6SA 1KOOA 4FMZA 3UL7A 3O6NA 4RWTC 4R07A 4GLPA 4XGOA 5GMGA 5CMNA 5AWDA 2CA6A 1XKUA 3W3LA 3E2JA 3E6JA 3C6NB 2WQWA 1O6TA 3O53A 3OGLB 3G04C 4NZRM 2Z63A 4KXFB 1FT8A 5GMHA 4L3FA 4R58A 4U08A 4R5CA 4R6JA 3SB4A 3JB9j 1Z7XW 2WQVA 2UZYA 4I6JB 3M19A 3A79B 4LXRA 4H09A 3ZYOA 4CC4C 2WFHA 2ASSB 4LI2A 3RFJA 2Z82A 3DZEA 1FS2A 2ELLA 4FD0A 4MQWX 4FHOA 2Z66A 3RGZA 2V9SA 3E3ZA 2JE1A 4QC0A 5IJDA 4B8CD 1QYYA 5GMFA 4Z61C 1GWBA 3P72A 2Q4GW 4CC4A 3ZYNA 2JQDA 1H6TA 1KOHA 5AWAA 2A0ZA 4R08A 4BSUA 3WPFA 4KT1A 2XOTA 3UL8A 4V2CA 2OMUA 4BSRA 1PGVA 2RR6A 3RJ0A 2O6RA 4K17A 4Z94G 4XSQA 4V2DA 4CNMA 4NKHA 3WPDA 1DS9A 5GS0A 4U06A 3TSRE 3GOZA 1A9NA 2Z7XB 4J0MA 4OQTA 3ULVA
chains in the Genus database with same CATH topology
3RIZA 1A4YA 1K5DC 2Z64A 4LSAA 3ZYIA 3VQ2A 3WPGA 3W3KA 3G39A 4RCWA 1XECA 1M10B 4ARNA 3W3MA 3PMHG 4PKIG 4CP6A 2O6QA 4WP6A 3CIYA 4RCAB 2XWTC 1ZIWA 4R0AA 3OGMB 5LFNA 2JE0A 4ECNA 4CNCA 2P1QB 4Z8GA 1WWLA 2OMYA 4U7LA 1P8TA 5IJBA 4WYKA 4R5DA 1M9LA 3OJAB 3RFSA 4FDWA 2UZXA 4Z64C 3WPEA 3OGKB 1YRGA 1M0ZA 5AWCA 1P9AG 5D3IA 4BSSA 2OMXA 2P1PB 5CMPA 3W3GA 4FS7A 5IJCA 4PEQB 3G06A 4GT6A 4U09A 1DFJI 2OMTA 5B4PA 3ULUA 4R6AA 4CILA 1W8AA 4ARRA 4EZGA 1JL5A 2Z65A 3WPIA 1FQVA 1OZNA 3WPCA 4YEBB 4KNGA 2OMWA 3ULAA 3WN4A 2P1OB 4Q3GA 4Z79A 4IM6A 4QBZA 1OTOA 4MN8B 4FCGA 4P8SA 1H6UA 3W3JA 1K5GC 2P1MB 3RFEA 1DCEA 2BNHA 3KJ4A 2ID5A 4LXSA 4PERA 2Z62A 1OGQA 1LTXA 5HDHA 5B0NA 4R09A 1G9UA 4C2BB 3M18A 1M9SA 3OJAA 2OMZA 3REZA 4AW4A 4LI1A 3UL9A 4C2AB 3W3NA 5FTTB 2ASTB 5AWBA 3WPBA 3E4GA 4R6FA 3VQ1A 3UN9A 2WQUA 3CIGA 1P8VA 4PSJA 3BZ5A 2WQXA 4LSXC 4XOSA 2V70A 4PQ8A 1OTNA 1SQ0B 4P91A 4M7EC 4AY9X 1OTMA 2R9UA 3ZYJA 2IFGA 4ECOA 4QXEA 1OOKG 2O6SA 4G8AA 4J4LA 1O6VA 3G3BA 4HQ1A 3WPHA 3RW6A 3CVRA 3FXIA 4LSXA 2Z81A 1XWDC 4L3AA 1D0BA 4UFRA 4V2EA 2V9TB 4M7EA 2Z7XA 5IYXC 1XEUA 3RW7A 4BV4R 5GQRK 4Q62A 5B0TA 4LSCA 4Y61B 1XCDA 3C6OB 2FT3A 5AZ5A 2P1NB 4NKGA 2Y5QA 3G3AA 1FO1A 3RGXA 2BEXA 5HZLB 2RA8A 4TZHA 1U0ND 2OMVA 1IO0A 5GS2B 4R6GA 5A5CA 4Q3IA 3C6PB 1O6SA 1KOOA 4FMZA 3UL7A 3O6NA 4RWTC 4R07A 4GLPA 4XGOA 5GMGA 5CMNA 5AWDA 2CA6A 1XKUA 3W3LA 3E2JA 3E6JA 3C6NB 2WQWA 1O6TA 3O53A 3OGLB 3G04C 2Z63A 4KXFB 1FT8A 5GMHA 4L3FA 4R58A 4U08A 4R5CA 4R6JA 3SB4A 3JB9j 1Z7XW 2WQVA 2UZYA 4I6JB 3M19A 3A79B 4LXRA 4H09A 3ZYOA 4CC4C 2WFHA 2ASSB 4LI2A 3RFJA 2Z82A 3DZEA 1FS2A 2ELLA 4FD0A 4MQWX 4FHOA 2Z66A 3RGZA 2V9SA 3E3ZA 2JE1A 4QC0A 5IJDA 4B8CD 1QYYA 5GMFA 4Z61C 1GWBA 3P72A 2Q4GW 4CC4A 3ZYNA 2JQDA 1H6TA 1KOHA 5AWAA 2A0ZA 4R08A 4BSUA 3WPFA 4KT1A 2XOTA 3UL8A 4V2CA 2OMUA 4BSRA 1PGVA 2RR6A 3RJ0A 2O6RA 4K17A 4Z94G 4XSQA 4V2DA 4CNMA 4NKHA 3WPDA 1DS9A 5GS0A 4U06A 3TSRE 3GOZA 1A9NA 2Z7XB 4J0MA 4OQTA 3ULVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIZ A;  1A4Y A;  1K5D C;  2Z64 A;  4LSA A;  3ZYI A;  3VQ2 A;  3WPG A;  3W3K A;  3G39 A;  4RCW A;  1XEC A;  1M10 B;  4ARN A;  3W3M A;  3PMH G;  4PKI G;  4CP6 A;  2O6Q A;  4WP6 A;  3CIY A;  4RCA B;  2XWT C;  1ZIW A;  4R0A A;  3OGM B;  5LFN A;  2JE0 A;  4ECN A;  4CNC A;  2P1Q B;  4Z8G A;  1WWL A;  2OMY A;  4U7L A;  1P8T A;  5IJB A;  4WYK A;  4R5D A;  1M9L A;  3OJA B;  3RFS A;  4FDW A;  2UZX A;  4Z64 C;  3WPE A;  3OGK B;  1YRG A;  1M0Z A;  5AWC A;  1P9A G;  5D3I A;  4BSS A;  2OMX A;  2P1P B;  5CMP A;  3W3G A;  4FS7 A;  5IJC A;  4PEQ B;  3G06 A;  4GT6 A;  4U09 A;  1DFJ I;  2OMT A;  5B4P A;  3ULU A;  4R6A A;  4CIL A;  1W8A A;  4ARR A;  4EZG A;  1JL5 A;  2Z65 A;  3WPI A;  1FQV A;  1OZN A;  3WPC A;  4YEB B;  4KNG A;  2OMW A;  3ULA A;  3WN4 A;  2P1O B;  4Q3G A;  4Z79 A;  4IM6 A;  4QBZ A;  1OTO A;  4MN8 B;  4FCG A;  4P8S A;  1H6U A;  3W3J A;  1K5G C;  2P1M B;  3RFE A;  1DCE A;  2BNH A;  3KJ4 A;  2ID5 A;  4LXS A;  4PER A;  2Z62 A;  1OGQ A;  1LTX A;  5HDH A;  5B0N A;  4R09 A;  1G9U A;  4C2B B;  3M18 A;  1M9S A;  3OJA A;  2OMZ A;  3REZ A;  4AW4 A;  4LI1 A;  3UL9 A;  4C2A B;  3W3N A;  5FTT B;  2AST B;  5AWB A;  3WPB A;  3E4G A;  4R6F A;  3VQ1 A;  3UN9 A;  2WQU A;  3CIG A;  1P8V A;  4PSJ A;  3BZ5 A;  2WQX A;  4LSX C;  4XOS A;  2V70 A;  4PQ8 A;  1OTN A;  1SQ0 B;  4P91 A;  4M7E C;  4AY9 X;  1OTM A;  2R9U A;  3ZYJ A;  2IFG A;  4ECO A;  4QXE A;  1OOK G;  2O6S A;  4G8A A;  4J4L A;  1O6V A;  3G3B A;  4HQ1 A;  3WPH A;  3RW6 A;  3CVR A;  3FXI A;  4LSX A;  2Z81 A;  1XWD C;  4L3A A;  1D0B A;  4UFR A;  4V2E A;  2V9T B;  4M7E A;  2Z7X A;  5IYX C;  1XEU A;  3RW7 A;  4BV4 R;  5GQR K;  4Q62 A;  5B0T A;  4LSC A;  4Y61 B;  1XCD A;  3C6O B;  2FT3 A;  5AZ5 A;  2P1N B;  4NKG A;  2Y5Q A;  3G3A A;  1FO1 A;  3RGX A;  2BEX A;  5HZL B;  2RA8 A;  4TZH A;  1U0N D;  2OMV A;  1IO0 A;  5GS2 B;  4R6G A;  5A5C A;  4Q3I A;  3C6P B;  1O6S A;  1KOO A;  4FMZ A;  3UL7 A;  3O6N A;  4RWT C;  4R07 A;  4GLP A;  4XGO A;  5GMG A;  5CMN A;  5AWD A;  2CA6 A;  1XKU A;  3W3L A;  3E2J A;  3E6J A;  3C6N B;  2WQW A;  1O6T A;  3O53 A;  3OGL B;  3G04 C;  2Z63 A;  4KXF B;  1FT8 A;  5GMH A;  4L3F A;  4R58 A;  4U08 A;  4R5C A;  4R6J A;  3SB4 A;  3JB9 j;  1Z7X W;  2WQV A;  2UZY A;  4I6J B;  3M19 A;  3A79 B;  4LXR A;  4H09 A;  3ZYO A;  4CC4 C;  2WFH A;  2ASS B;  4LI2 A;  3RFJ A;  2Z82 A;  3DZE A;  1FS2 A;  2ELL A;  4FD0 A;  4MQW X;  4FHO A;  2Z66 A;  3RGZ A;  2V9S A;  3E3Z A;  2JE1 A;  4QC0 A;  5IJD A;  4B8C D;  1QYY A;  5GMF A;  4Z61 C;  1GWB A;  3P72 A;  2Q4G W;  4CC4 A;  3ZYN A;  2JQD A;  1H6T A;  1KOH A;  5AWA A;  2A0Z A;  4R08 A;  4BSU A;  3WPF A;  4KT1 A;  2XOT A;  3UL8 A;  4V2C A;  2OMU A;  4BSR A;  1PGV A;  2RR6 A;  3RJ0 A;  2O6R A;  4K17 A;  4Z94 G;  4XSQ A;  4V2D A;  4CNM A;  4NKH A;  3WPD A;  1DS9 A;  5GS0 A;  4U06 A;  3TSR E;  3GOZ A;  1A9N A;  2Z7X B;  4J0M A;  4OQT A;  3ULV A; 
#chains in the Genus database with same CATH topology
 3RIZ A;  1A4Y A;  1K5D C;  2Z64 A;  4LSA A;  3ZYI A;  3VQ2 A;  3WPG A;  3W3K A;  3G39 A;  4RCW A;  1XEC A;  1M10 B;  4ARN A;  3W3M A;  3PMH G;  4PKI G;  4CP6 A;  2O6Q A;  4WP6 A;  3CIY A;  4RCA B;  2XWT C;  1ZIW A;  4R0A A;  3OGM B;  4NZT M;  5LFN A;  2JE0 A;  4ECN A;  4CNC A;  2P1Q B;  4Z8G A;  1WWL A;  2OMY A;  4U7L A;  1P8T A;  5IJB A;  4WYK A;  4R5D A;  1M9L A;  3OJA B;  3RFS A;  4FDW A;  2UZX A;  4Z64 C;  3WPE A;  3OGK B;  1YRG A;  1M0Z A;  5AWC A;  1P9A G;  5D3I A;  4BSS A;  2OMX A;  2P1P B;  5CMP A;  3W3G A;  4FS7 A;  5IJC A;  4PEQ B;  3G06 A;  4GT6 A;  4U09 A;  1DFJ I;  2OMT A;  5B4P A;  3ULU A;  4R6A A;  4CIL A;  1W8A A;  4ARR A;  4EZG A;  1JL5 A;  2Z65 A;  3WPI A;  1FQV A;  1OZN A;  3WPC A;  4YEB B;  4KNG A;  2OMW A;  3ULA A;  3WN4 A;  2P1O B;  4Q3G A;  4Z79 A;  4IM6 A;  4QBZ A;  1OTO A;  4MN8 B;  4FCG A;  4P8S A;  1H6U A;  3W3J A;  1K5G C;  2P1M B;  3RFE A;  1DCE A;  2BNH A;  3KJ4 A;  2ID5 A;  4LXS A;  4PER A;  2Z62 A;  1OGQ A;  1LTX A;  5HDH A;  5B0N A;  4R09 A;  1G9U A;  4C2B B;  3M18 A;  1M9S A;  3OJA A;  2OMZ A;  3REZ A;  4AW4 A;  4LI1 A;  3UL9 A;  4C2A B;  3W3N A;  5FTT B;  2AST B;  5AWB A;  3WPB A;  3E4G A;  4R6F A;  3VQ1 A;  3UN9 A;  2WQU A;  3CIG A;  1P8V A;  4PSJ A;  3BZ5 A;  2WQX A;  4LSX C;  4XOS A;  2V70 A;  4PQ8 A;  1OTN A;  1SQ0 B;  4P91 A;  4M7E C;  4AY9 X;  1OTM A;  2R9U A;  3ZYJ A;  2IFG A;  4ECO A;  4QXE A;  1OOK G;  2O6S A;  4G8A A;  4J4L A;  1O6V A;  3G3B A;  4HQ1 A;  3WPH A;  3RW6 A;  3CVR A;  3FXI A;  4LSX A;  2Z81 A;  1XWD C;  4L3A A;  1D0B A;  4UFR A;  4V2E A;  2V9T B;  4M7E A;  2Z7X A;  5IYX C;  1XEU A;  3RW7 A;  4BV4 R;  5GQR K;  4Q62 A;  5B0T A;  4LSC A;  4Y61 B;  1XCD A;  3C6O B;  2FT3 A;  5AZ5 A;  2P1N B;  4NKG A;  2Y5Q A;  3G3A A;  1FO1 A;  3RGX A;  2BEX A;  5HZL B;  2RA8 A;  4TZH A;  1U0N D;  2OMV A;  1IO0 A;  5GS2 B;  4R6G A;  5A5C A;  4Q3I A;  3C6P B;  1O6S A;  1KOO A;  4FMZ A;  3UL7 A;  3O6N A;  4RWT C;  4R07 A;  4GLP A;  4XGO A;  5GMG A;  5CMN A;  5AWD A;  2CA6 A;  1XKU A;  3W3L A;  3E2J A;  3E6J A;  3C6N B;  2WQW A;  1O6T A;  3O53 A;  3OGL B;  3G04 C;  4NZR M;  2Z63 A;  4KXF B;  1FT8 A;  5GMH A;  4L3F A;  4R58 A;  4U08 A;  4R5C A;  4R6J A;  3SB4 A;  3JB9 j;  1Z7X W;  2WQV A;  2UZY A;  4I6J B;  3M19 A;  3A79 B;  4LXR A;  4H09 A;  3ZYO A;  4CC4 C;  2WFH A;  2ASS B;  4LI2 A;  3RFJ A;  2Z82 A;  3DZE A;  1FS2 A;  2ELL A;  4FD0 A;  4MQW X;  4FHO A;  2Z66 A;  3RGZ A;  2V9S A;  3E3Z A;  2JE1 A;  4QC0 A;  5IJD A;  4B8C D;  1QYY A;  5GMF A;  4Z61 C;  1GWB A;  3P72 A;  2Q4G W;  4CC4 A;  3ZYN A;  2JQD A;  1H6T A;  1KOH A;  5AWA A;  2A0Z A;  4R08 A;  4BSU A;  3WPF A;  4KT1 A;  2XOT A;  3UL8 A;  4V2C A;  2OMU A;  4BSR A;  1PGV A;  2RR6 A;  3RJ0 A;  2O6R A;  4K17 A;  4Z94 G;  4XSQ A;  4V2D A;  4CNM A;  4NKH A;  3WPD A;  1DS9 A;  5GS0 A;  4U06 A;  3TSR E;  3GOZ A;  1A9N A;  2Z7X B;  4J0M A;  4OQT A;  3ULV A; 
#chains in the Genus database with same CATH homology
 3RIZ A;  1A4Y A;  1K5D C;  2Z64 A;  4LSA A;  3ZYI A;  3VQ2 A;  3WPG A;  3W3K A;  3G39 A;  4RCW A;  1XEC A;  1M10 B;  4ARN A;  3W3M A;  3PMH G;  4PKI G;  4CP6 A;  2O6Q A;  4WP6 A;  3CIY A;  4RCA B;  2XWT C;  1ZIW A;  4R0A A;  3OGM B;  5LFN A;  2JE0 A;  4ECN A;  4CNC A;  2P1Q B;  4Z8G A;  1WWL A;  2OMY A;  4U7L A;  1P8T A;  5IJB A;  4WYK A;  4R5D A;  1M9L A;  3OJA B;  3RFS A;  4FDW A;  2UZX A;  4Z64 C;  3WPE A;  3OGK B;  1YRG A;  1M0Z A;  5AWC A;  1P9A G;  5D3I A;  4BSS A;  2OMX A;  2P1P B;  5CMP A;  3W3G A;  4FS7 A;  5IJC A;  4PEQ B;  3G06 A;  4GT6 A;  4U09 A;  1DFJ I;  2OMT A;  5B4P A;  3ULU A;  4R6A A;  4CIL A;  1W8A A;  4ARR A;  4EZG A;  1JL5 A;  2Z65 A;  3WPI A;  1FQV A;  1OZN A;  3WPC A;  4YEB B;  4KNG A;  2OMW A;  3ULA A;  3WN4 A;  2P1O B;  4Q3G A;  4Z79 A;  4IM6 A;  4QBZ A;  1OTO A;  4MN8 B;  4FCG A;  4P8S A;  1H6U A;  3W3J A;  1K5G C;  2P1M B;  3RFE A;  1DCE A;  2BNH A;  3KJ4 A;  2ID5 A;  4LXS A;  4PER A;  2Z62 A;  1OGQ A;  1LTX A;  5HDH A;  5B0N A;  4R09 A;  1G9U A;  4C2B B;  3M18 A;  1M9S A;  3OJA A;  2OMZ A;  3REZ A;  4AW4 A;  4LI1 A;  3UL9 A;  4C2A B;  3W3N A;  5FTT B;  2AST B;  5AWB A;  3WPB A;  3E4G A;  4R6F A;  3VQ1 A;  3UN9 A;  2WQU A;  3CIG A;  1P8V A;  4PSJ A;  3BZ5 A;  2WQX A;  4LSX C;  4XOS A;  2V70 A;  4PQ8 A;  1OTN A;  1SQ0 B;  4P91 A;  4M7E C;  4AY9 X;  1OTM A;  2R9U A;  3ZYJ A;  2IFG A;  4ECO A;  4QXE A;  1OOK G;  2O6S A;  4G8A A;  4J4L A;  1O6V A;  3G3B A;  4HQ1 A;  3WPH A;  3RW6 A;  3CVR A;  3FXI A;  4LSX A;  2Z81 A;  1XWD C;  4L3A A;  1D0B A;  4UFR A;  4V2E A;  2V9T B;  4M7E A;  2Z7X A;  5IYX C;  1XEU A;  3RW7 A;  4BV4 R;  5GQR K;  4Q62 A;  5B0T A;  4LSC A;  4Y61 B;  1XCD A;  3C6O B;  2FT3 A;  5AZ5 A;  2P1N B;  4NKG A;  2Y5Q A;  3G3A A;  1FO1 A;  3RGX A;  2BEX A;  5HZL B;  2RA8 A;  4TZH A;  1U0N D;  2OMV A;  1IO0 A;  5GS2 B;  4R6G A;  5A5C A;  4Q3I A;  3C6P B;  1O6S A;  1KOO A;  4FMZ A;  3UL7 A;  3O6N A;  4RWT C;  4R07 A;  4GLP A;  4XGO A;  5GMG A;  5CMN A;  5AWD A;  2CA6 A;  1XKU A;  3W3L A;  3E2J A;  3E6J A;  3C6N B;  2WQW A;  1O6T A;  3O53 A;  3OGL B;  3G04 C;  2Z63 A;  4KXF B;  1FT8 A;  5GMH A;  4L3F A;  4R58 A;  4U08 A;  4R5C A;  4R6J A;  3SB4 A;  3JB9 j;  1Z7X W;  2WQV A;  2UZY A;  4I6J B;  3M19 A;  3A79 B;  4LXR A;  4H09 A;  3ZYO A;  4CC4 C;  2WFH A;  2ASS B;  4LI2 A;  3RFJ A;  2Z82 A;  3DZE A;  1FS2 A;  2ELL A;  4FD0 A;  4MQW X;  4FHO A;  2Z66 A;  3RGZ A;  2V9S A;  3E3Z A;  2JE1 A;  4QC0 A;  5IJD A;  4B8C D;  1QYY A;  5GMF A;  4Z61 C;  1GWB A;  3P72 A;  2Q4G W;  4CC4 A;  3ZYN A;  2JQD A;  1H6T A;  1KOH A;  5AWA A;  2A0Z A;  4R08 A;  4BSU A;  3WPF A;  4KT1 A;  2XOT A;  3UL8 A;  4V2C A;  2OMU A;  4BSR A;  1PGV A;  2RR6 A;  3RJ0 A;  2O6R A;  4K17 A;  4Z94 G;  4XSQ A;  4V2D A;  4CNM A;  4NKH A;  3WPD A;  1DS9 A;  5GS0 A;  4U06 A;  3TSR E;  3GOZ A;  1A9N A;  2Z7X B;  4J0M A;  4OQT A;  3ULV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...